tree path: root node -> 8e7400500
clusters in node: 931
spam scores: The spammiest documents have a score of 0, and the least spammy have a score of 99. The spam score is the percentage of documents in the collection more spammy than this document. Cluster spam scores are averaged across all documents in a cluster.

clusterid = 8e7854120
RMSE = 0
spam score = 23
documents = 1
clusterid = 8e77d64c0
RMSE = 0
spam score = 79
documents = 1
clusterid = 8e76a5770
RMSE = 0
spam score = 84
documents = 1
clusterid = 8e7ab5bc0
RMSE = 0
spam score = 82
documents = 1
clusterid = 8e7b224e0
RMSE = 0
spam score = 23
documents = 1
clusterid = 8e7ddcaa0
RMSE = 0
spam score = 80
documents = 1
clusterid = 8e7980ba0
RMSE = 26.0864
spam score = 61.5
documents = 2
clusterid = 8e7754d90
RMSE = 52.1967
spam score = 74
documents = 2
clusterid = 8e7b7e2c0
RMSE = 73.624
spam score = 64.5
documents = 2
clusterid = 8e7a022d0
RMSE = 114.077
spam score = 72.7818
documents = 55
clusterid = 8e83b3980
RMSE = 121.72
spam score = 80.1904
documents = 478
clusterid = 8e7f7a110
RMSE = 134.156
spam score = 63.2857
documents = 14
clusterid = 8e83e9e10
RMSE = 192.949
spam score = 76.9902
documents = 1934
clusterid = 8e7b3b5c0
RMSE = 212.491
spam score = 70
documents = 9
clusterid = 8e75f1a80
RMSE = 214.151
spam score = 59.75
documents = 20
clusterid = 8e762c5e0
RMSE = 293.828
spam score = 78.0455
documents = 44
clusterid = 8e7a38760
RMSE = 316.856
spam score = 55.0273
documents = 183
clusterid = 8e7bf3180
RMSE = 322.282
spam score = 58.5946
documents = 37
clusterid = 8e840b490
RMSE = 322.456
spam score = 72.6705
documents = 1493
clusterid = 8e80a28c0
RMSE = 332.095
spam score = 67.5178
documents = 253
clusterid = 8e76be850
RMSE = 350.332
spam score = 72.8312
documents = 770
clusterid = 8e822f3f0
RMSE = 356.243
spam score = 54.4727
documents = 256
clusterid = 8e754ecd0
RMSE = 376.961
spam score = 67.45
documents = 100
clusterid = 8e74c90d0
RMSE = 391.845
spam score = 59.75
documents = 12
clusterid = 8e8138e00
RMSE = 403.081
spam score = 60.8
documents = 25
clusterid = 8e7df18b0
RMSE = 409.514
spam score = 58.0455
documents = 22
clusterid = 8e77658d0
RMSE = 410.362
spam score = 62.9815
documents = 54
clusterid = 8e7882010
RMSE = 410.654
spam score = 44.5
documents = 10
clusterid = 8e78757a0
RMSE = 413.371
spam score = 59.25
documents = 24
clusterid = 8e78322a0
RMSE = 424.672
spam score = 59.5484
documents = 310
clusterid = 8e7a87cd0
RMSE = 460.352
spam score = 66.4433
documents = 97
clusterid = 8e74a7a50
RMSE = 482.388
spam score = 57.767
documents = 103
clusterid = 8e74e6480
RMSE = 489.728
spam score = 70
documents = 6
clusterid = 8e817bb00
RMSE = 494.801
spam score = 48.4828
documents = 812
clusterid = 8e81b6260
RMSE = 508.381
spam score = 76.093
documents = 43
clusterid = 8e7649990
RMSE = 510.621
spam score = 50.7586
documents = 174
clusterid = 8e790ffb0
RMSE = 511.377
spam score = 63.0577
documents = 52
clusterid = 8e746d1f0
RMSE = 511.865
spam score = 71.0636
documents = 110
clusterid = 8e74bc860
RMSE = 520.424
spam score = 60.0584
documents = 291
clusterid = 8e77a0030
RMSE = 527.551
spam score = 60
documents = 10
clusterid = 8e805b8f0
RMSE = 528.5
spam score = 65.5
documents = 2
clusterid = 8e76c2b20
RMSE = 530.303
spam score = 64.7383
documents = 149
clusterid = 8e7e55c30
RMSE = 534.435
spam score = 72.64
documents = 25
clusterid = 8e83c8790
RMSE = 534.755
spam score = 64.7228
documents = 1479
clusterid = 8e82b4df0
RMSE = 536.289
spam score = 19.436
documents = 172
clusterid = 8e7feefd0
RMSE = 546.521
spam score = 49.7596
documents = 104
clusterid = 8e830c900
RMSE = 554.361
spam score = 50.6238
documents = 210
clusterid = 8e7b05130
RMSE = 561.468
spam score = 58.0406
documents = 197
clusterid = 8e7b60f10
RMSE = 561.914
spam score = 61.1855
documents = 221
clusterid = 8e7c5b7d0
RMSE = 568.314
spam score = 45.2547
documents = 267
clusterid = 8e778b220
RMSE = 570.311
spam score = 49.5269
documents = 186
clusterid = 8e83e1870
RMSE = 576.649
spam score = 64.02
documents = 100
clusterid = 8e839eb70
RMSE = 578.203
spam score = 64.4379
documents = 153
clusterid = 8e7f6d8a0
RMSE = 578.811
spam score = 54.6852
documents = 54
clusterid = 8e804f080
RMSE = 579.415
spam score = 58.0399
documents = 401
clusterid = 8e7a1b3b0
RMSE = 585.937
spam score = 72.8043
documents = 46
clusterid = 8e83fec20
RMSE = 588.732
spam score = 61.5
documents = 336
clusterid = 8e79f9d30
RMSE = 595.824
spam score = 68.0967
documents = 393
clusterid = 8e8364410
RMSE = 597.232
spam score = 59.5
documents = 4
clusterid = 8e7ae3ab0
RMSE = 597.725
spam score = 49.8158
documents = 114
clusterid = 8e7a9cae0
RMSE = 598.94
spam score = 59.1672
documents = 640
clusterid = 8e77a4300
RMSE = 603.474
spam score = 51.0398
documents = 452
clusterid = 8e76840f0
RMSE = 607.935
spam score = 69.5294
documents = 34
clusterid = 8e8226e50
RMSE = 614.314
spam score = 60.4232
documents = 241
clusterid = 8e760ee30
RMSE = 616.471
spam score = 83.6667
documents = 3
clusterid = 8e78714d0
RMSE = 622.406
spam score = 54.7194
documents = 2035
clusterid = 8e78ea660
RMSE = 626.079
spam score = 58
documents = 5
clusterid = 8e83ee0e0
RMSE = 628.399
spam score = 65.0112
documents = 179
clusterid = 8e759e240
RMSE = 630.573
spam score = 53.9375
documents = 464
clusterid = 8e77dea60
RMSE = 633.67
spam score = 44.6082
documents = 245
clusterid = 8e7beeeb0
RMSE = 646.677
spam score = 55.5333
documents = 60
clusterid = 8e7f7e3e0
RMSE = 647.563
spam score = 57.5
documents = 2
clusterid = 8e79959b0
RMSE = 649.699
spam score = 63.5138
documents = 506
clusterid = 8e82dea10
RMSE = 649.739
spam score = 56.399
documents = 584
clusterid = 8e8145670
RMSE = 650.03
spam score = 64.1419
documents = 733
clusterid = 8e80aae60
RMSE = 650.14
spam score = 49.6406
documents = 498
clusterid = 8e78191c0
RMSE = 650.448
spam score = 63.5264
documents = 965
clusterid = 8e7f8ef20
RMSE = 651.115
spam score = 66.875
documents = 80
clusterid = 8e7afcb90
RMSE = 652.32
spam score = 52.8752
documents = 785
clusterid = 8e74a3780
RMSE = 653.916
spam score = 53.021
documents = 525
clusterid = 8e826de20
RMSE = 654.396
spam score = 52.8123
documents = 325
clusterid = 8e8035fa0
RMSE = 660.607
spam score = 64.1186
documents = 118
clusterid = 8e83af6b0
RMSE = 660.916
spam score = 66.7233
documents = 889
clusterid = 8e82615b0
RMSE = 663.588
spam score = 64.9699
documents = 1098
clusterid = 8e74eea20
RMSE = 665.062
spam score = 61.7826
documents = 46
clusterid = 8e7a6a920
RMSE = 666.192
spam score = 60.9642
documents = 866
clusterid = 8e84350b0
RMSE = 666.994
spam score = 58.8959
documents = 961
clusterid = 8e79c7b70
RMSE = 667.485
spam score = 56.3222
documents = 478
clusterid = 8e8123ff0
RMSE = 667.774
spam score = 66.5
documents = 4
clusterid = 8e7e59f00
RMSE = 669.497
spam score = 54.5379
documents = 145
clusterid = 8e78c0a40
RMSE = 671.479
spam score = 87.9456
documents = 1489
clusterid = 8e7a492a0
RMSE = 673.679
spam score = 66.5172
documents = 698
clusterid = 8e7df5b80
RMSE = 674.235
spam score = 66.7586
documents = 58
clusterid = 8e7d4eb00
RMSE = 674.963
spam score = 58.219
documents = 1260
clusterid = 8e7ac6700
RMSE = 675.648
spam score = 57.8958
documents = 528
clusterid = 8e80897e0
RMSE = 675.688
spam score = 53.6416
documents = 173
clusterid = 8e7d18670
RMSE = 679.889
spam score = 57.8357
documents = 554
clusterid = 8e744bb70
RMSE = 680.704
spam score = 76.2979
documents = 94
clusterid = 8e7bff9f0
RMSE = 682.092
spam score = 57.5556
documents = 9
clusterid = 8e81d3610
RMSE = 683.145
spam score = 75.4915
documents = 59
clusterid = 8e7436cd0
RMSE = 684.235
spam score = 64.5526
documents = 38
clusterid = 8e76add10
RMSE = 685.018
spam score = 56.1742
documents = 706
clusterid = 8e8162a20
RMSE = 685.671
spam score = 58.9016
documents = 244
clusterid = 8e837d4f0
RMSE = 687.225
spam score = 52.8553
documents = 477
clusterid = 8e7a55b10
RMSE = 689.443
spam score = 56.5655
documents = 458
clusterid = 8e83817c0
RMSE = 691.859
spam score = 56.7948
documents = 1501
clusterid = 8e79d0110
RMSE = 692.178
spam score = 57.4942
documents = 1372
clusterid = 8e7606890
RMSE = 694.277
spam score = 27.2
documents = 5
clusterid = 8e76d7930
RMSE = 695.001
spam score = 61.2687
documents = 789
clusterid = 8e841bfd0
RMSE = 695.977
spam score = 58.9009
documents = 686
clusterid = 8e78435e0
RMSE = 699.09
spam score = 55.4725
documents = 673
clusterid = 8e7426150
RMSE = 699.338
spam score = 69.8064
documents = 62
clusterid = 8e8250a70
RMSE = 702.162
spam score = 82.4268
documents = 799
clusterid = 8e7bda0a0
RMSE = 702.418
spam score = 58.2152
documents = 1050
clusterid = 8e7a90270
RMSE = 706.218
spam score = 60.0316
documents = 95
clusterid = 8e831d440
RMSE = 706.851
spam score = 59.398
documents = 1088
clusterid = 8e7b9f940
RMSE = 707.561
spam score = 64.7009
documents = 331
clusterid = 8e8081240
RMSE = 708.842
spam score = 61.7143
documents = 14
clusterid = 8e8374f50
RMSE = 710.114
spam score = 62.8154
documents = 1593
clusterid = 8e7896e20
RMSE = 711.425
spam score = 54.951
documents = 510
clusterid = 8e7da6610
RMSE = 711.46
spam score = 57.0982
documents = 652
clusterid = 8e76ba580
RMSE = 712.049
spam score = 60.7552
documents = 192
clusterid = 8e78d9b20
RMSE = 713.192
spam score = 66.1
documents = 10
clusterid = 8e7ca7a80
RMSE = 714.958
spam score = 77.0348
documents = 316
clusterid = 8e7b58970
RMSE = 715.04
spam score = 60.8422
documents = 2927
clusterid = 8e7a170e0
RMSE = 719.715
spam score = 52.9475
documents = 495
clusterid = 8e7dd87d0
RMSE = 720.013
spam score = 55.68
documents = 100
clusterid = 8e7539ec0
RMSE = 720.707
spam score = 54.4727
documents = 55
clusterid = 8e79e0c50
RMSE = 721.498
spam score = 84.8974
documents = 195
clusterid = 8e821a5e0
RMSE = 721.593
spam score = 58.9805
documents = 718
clusterid = 8e755b540
RMSE = 722.642
spam score = 62.3191
documents = 47
clusterid = 8e7a94540
RMSE = 723.601
spam score = 60.8941
documents = 85
clusterid = 8e7ad2f70
RMSE = 723.905
spam score = 57.5857
documents = 700
clusterid = 8e7a7f730
RMSE = 725.111
spam score = 64.8125
documents = 16
clusterid = 8e772b170
RMSE = 725.151
spam score = 70.5192
documents = 104
clusterid = 8e7dbf6f0
RMSE = 727.223
spam score = 69.6786
documents = 56
clusterid = 8e7f268d0
RMSE = 727.677
spam score = 63.0625
documents = 160
clusterid = 8e7cb85c0
RMSE = 728.414
spam score = 60.0934
documents = 942
clusterid = 8e835be70
RMSE = 730.097
spam score = 70.3052
documents = 888
clusterid = 8e796bd90
RMSE = 730.889
spam score = 53.726
documents = 2033
clusterid = 8e7d39cf0
RMSE = 731.297
spam score = 34.7391
documents = 138
clusterid = 8e82e2ce0
RMSE = 731.986
spam score = 60.6441
documents = 59
clusterid = 8e82a42b0
RMSE = 732.521
spam score = 69.5508
documents = 305
clusterid = 8e7b267b0
RMSE = 733.32
spam score = 66.59
documents = 100
clusterid = 8e7dc39c0
RMSE = 739.838
spam score = 61.3529
documents = 340
clusterid = 8e81f4c90
RMSE = 740.243
spam score = 56.4653
documents = 432
clusterid = 8e7ee3bd0
RMSE = 741.8
spam score = 24.6027
documents = 73
clusterid = 8e7d20c10
RMSE = 742.219
spam score = 58.6971
documents = 241
clusterid = 8e7492c40
RMSE = 743.702
spam score = 69.0889
documents = 45
clusterid = 8e7a0eb40
RMSE = 744.644
spam score = 58.8926
documents = 121
clusterid = 8e7924dc0
RMSE = 744.701
spam score = 56.9831
documents = 59
clusterid = 8e80f1e30
RMSE = 745.305
spam score = 58.5333
documents = 60
clusterid = 8e8190910
RMSE = 745.972
spam score = 63.6306
documents = 360
clusterid = 8e8053350
RMSE = 746.156
spam score = 57.0942
documents = 467
clusterid = 8e782dfd0
RMSE = 746.624
spam score = 65.4023
documents = 348
clusterid = 8e795f520
RMSE = 747
spam score = 19
documents = 1
clusterid = 8e7b2ed50
RMSE = 747.24
spam score = 64.3265
documents = 147
clusterid = 8e7af0320
RMSE = 747.472
spam score = 55.7584
documents = 269
clusterid = 8e7833060
RMSE = 748.495
spam score = 68.0816
documents = 343
clusterid = 8e8282c30
RMSE = 749.635
spam score = 49.3468
documents = 248
clusterid = 8e78e6390
RMSE = 750.376
spam score = 68.7635
documents = 389
clusterid = 8e7eb1a10
RMSE = 750.452
spam score = 64.2219
documents = 365
clusterid = 8e8018bf0
RMSE = 750.707
spam score = 51.75
documents = 28
clusterid = 8e7d5f640
RMSE = 750.789
spam score = 56.4022
documents = 179
clusterid = 8e82c1660
RMSE = 751.276
spam score = 28.0534
documents = 206
clusterid = 8e764dc60
RMSE = 751.607
spam score = 56.5336
documents = 611
clusterid = 8e7cd9c40
RMSE = 751.677
spam score = 68.8286
documents = 35
clusterid = 8e7a59de0
RMSE = 752.291
spam score = 78
documents = 5
clusterid = 8e80fa3d0
RMSE = 752.779
spam score = 61.0286
documents = 105
clusterid = 8e7d89260
RMSE = 753.106
spam score = 56.4324
documents = 148
clusterid = 8e77b0b70
RMSE = 755.692
spam score = 61.2917
documents = 408
clusterid = 8e7698f00
RMSE = 755.741
spam score = 59.5868
documents = 121
clusterid = 8e7ea51a0
RMSE = 756.426
spam score = 72.1355
documents = 701
clusterid = 8e82da740
RMSE = 756.957
spam score = 59.9753
documents = 810
clusterid = 8e75bb5f0
RMSE = 758.841
spam score = 53
documents = 18
clusterid = 8e7aec050
RMSE = 759.325
spam score = 60.1871
documents = 2239
clusterid = 8e78f6ed0
RMSE = 759.343
spam score = 51.0074
documents = 135
clusterid = 8e7ed7360
RMSE = 760.186
spam score = 56.6985
documents = 325
clusterid = 8e7712090
RMSE = 760.843
spam score = 83.0367
documents = 982
clusterid = 8e79aea90
RMSE = 762.426
spam score = 65.7691
documents = 853
clusterid = 8e7a23950
RMSE = 762.559
spam score = 68.5
documents = 2
clusterid = 8e742a480
RMSE = 763.158
spam score = 59.563
documents = 135
clusterid = 8e8259010
RMSE = 763.545
spam score = 60.0058
documents = 856
clusterid = 8e80f6100
RMSE = 765.743
spam score = 61.3333
documents = 3
clusterid = 8e75d89a0
RMSE = 766.682
spam score = 72.2143
documents = 14
clusterid = 8e80edb60
RMSE = 766.718
spam score = 54.7931
documents = 87
clusterid = 8e7da2340
RMSE = 767.534
spam score = 60.2439
documents = 287
clusterid = 8e8293770
RMSE = 767.938
spam score = 60.0574
documents = 732
clusterid = 8e83cca60
RMSE = 769.091
spam score = 53.9356
documents = 435
clusterid = 8e7821760
RMSE = 769.335
spam score = 87.2152
documents = 223
clusterid = 8e7c2d8e0
RMSE = 773.29
spam score = 68.5882
documents = 17
clusterid = 8e7989140
RMSE = 773.451
spam score = 53.9833
documents = 180
clusterid = 8e8188370
RMSE = 774.215
spam score = 61.0958
documents = 261
clusterid = 8e802da00
RMSE = 774.412
spam score = 57.9115
documents = 689
clusterid = 8e83b7c50
RMSE = 775.191
spam score = 66.1852
documents = 162
clusterid = 8e7a3ca30
RMSE = 775.317
spam score = 58.9861
documents = 1007
clusterid = 8e7cd5970
RMSE = 777.304
spam score = 65.1315
documents = 289
clusterid = 8e822b120
RMSE = 779.513
spam score = 59.4874
documents = 199
clusterid = 8e8244200
RMSE = 779.747
spam score = 62.2562
documents = 203
clusterid = 8e7fffb10
RMSE = 779.965
spam score = 62.5368
documents = 136
clusterid = 8e7d42290
RMSE = 780.168
spam score = 60.6199
documents = 371
clusterid = 8e7f9fa60
RMSE = 780.611
spam score = 50.9457
documents = 129
clusterid = 8e8003de0
RMSE = 780.838
spam score = 36.092
documents = 87
clusterid = 8e79bb300
RMSE = 781.57
spam score = 59.2584
documents = 685
clusterid = 8e7bb0480
RMSE = 781.799
spam score = 64.8158
documents = 190
clusterid = 8e83fa950
RMSE = 781.865
spam score = 55.9531
documents = 490
clusterid = 8e8134b30
RMSE = 785.885
spam score = 64.7279
documents = 136
clusterid = 8e7ef89e0
RMSE = 786.63
spam score = 66.7154
documents = 123
clusterid = 8e82d21a0
RMSE = 787.389
spam score = 53.9076
documents = 660
clusterid = 8e77eb2d0
RMSE = 787.9
spam score = 67.3474
documents = 95
clusterid = 8e7aa9350
RMSE = 788.722
spam score = 73.2632
documents = 38
clusterid = 8e7432a00
RMSE = 788.899
spam score = 59.2779
documents = 1943
clusterid = 8e7aca9d0
RMSE = 789.996
spam score = 59.1973
documents = 2595
clusterid = 8e7af88c0
RMSE = 790.993
spam score = 53.4062
documents = 421
clusterid = 8e7628330
RMSE = 791.67
spam score = 67.3474
documents = 498
clusterid = 8e7705820
RMSE = 792.697
spam score = 61.9206
documents = 63
clusterid = 8e76e41a0
RMSE = 795.37
spam score = 62.6
documents = 85
clusterid = 8e7de0d70
RMSE = 795.588
spam score = 66.7793
documents = 734
clusterid = 8e74b42c0
RMSE = 796.457
spam score = 58.1139
documents = 79
clusterid = 8e7dc7c90
RMSE = 800.04
spam score = 72.6996
documents = 223
clusterid = 8e7599f70
RMSE = 801.421
spam score = 50.9468
documents = 376
clusterid = 8e7d99da0
RMSE = 801.43
spam score = 70.3453
documents = 139
clusterid = 8e7677880
RMSE = 801.504
spam score = 58.5227
documents = 662
clusterid = 8e78b84a0
RMSE = 801.796
spam score = 64.5871
documents = 155
clusterid = 8e77937c0
RMSE = 803.259
spam score = 63.2609
documents = 138
clusterid = 8e81ba530
RMSE = 804.231
spam score = 52.142
documents = 324
clusterid = 8e8042810
RMSE = 804.812
spam score = 58.2053
documents = 263
clusterid = 8e79a64f0
RMSE = 805.909
spam score = 63.8836
documents = 292
clusterid = 8e750bdd0
RMSE = 806.383
spam score = 62.4286
documents = 7
clusterid = 8e7de5040
RMSE = 808.53
spam score = 47.2353
documents = 34
clusterid = 8e7a77190
RMSE = 811.261
spam score = 66.6579
documents = 874
clusterid = 8e8441920
RMSE = 811.692
spam score = 43.4326
documents = 282
clusterid = 8e7a44fd0
RMSE = 813.11
spam score = 72.9065
documents = 214
clusterid = 8e77a85d0
RMSE = 814.051
spam score = 59.6273
documents = 110
clusterid = 8e83686e0
RMSE = 822.618
spam score = 59.3038
documents = 79
clusterid = 8e7b3f890
RMSE = 822.792
spam score = 55.7601
documents = 271
clusterid = 8e7e51960
RMSE = 822.82
spam score = 62.1094
documents = 64
clusterid = 8e7510360
RMSE = 822.887
spam score = 60.0331
documents = 726
clusterid = 8e803a270
RMSE = 823.28
spam score = 53.1466
documents = 832
clusterid = 8e79e91f0
RMSE = 824.01
spam score = 45.5518
documents = 560
clusterid = 8e799df50
RMSE = 824.419
spam score = 53.7641
documents = 462
clusterid = 8e7e83b20
RMSE = 825.733
spam score = 62
documents = 19
clusterid = 8e78fb1a0
RMSE = 827.452
spam score = 55.8981
documents = 108
clusterid = 8e743afa0
RMSE = 828.415
spam score = 62.9583
documents = 48
clusterid = 8e76ec740
RMSE = 828.429
spam score = 68.2742
documents = 186
clusterid = 8e7a27c20
RMSE = 828.539
spam score = 62.5251
documents = 179
clusterid = 8e7e1f7a0
RMSE = 829.094
spam score = 59
documents = 18
clusterid = 8e8265880
RMSE = 830.225
spam score = 55.9129
documents = 333
clusterid = 8e7e7f850
RMSE = 832.092
spam score = 23.3043
documents = 23
clusterid = 8e8332250
RMSE = 835.278
spam score = 51.5057
documents = 87
clusterid = 8e8449ec0
RMSE = 836.307
spam score = 54.8269
documents = 2502
clusterid = 8e81c2ad0
RMSE = 838.787
spam score = 63.049
documents = 1633
clusterid = 8e80e9890
RMSE = 839.287
spam score = 56.6327
documents = 2001
clusterid = 8e7c25340
RMSE = 841.286
spam score = 48.115
documents = 113
clusterid = 8e74c0b30
RMSE = 842.089
spam score = 55.3146
documents = 728
clusterid = 8e7e493c0
RMSE = 843.373
spam score = 61.6087
documents = 23
clusterid = 8e7503830
RMSE = 843.902
spam score = 52.4818
documents = 1183
clusterid = 8e7a51840
RMSE = 844.453
spam score = 53.5372
documents = 121
clusterid = 8e7a4d570
RMSE = 844.94
spam score = 61.7081
documents = 185
clusterid = 8e8173560
RMSE = 845.163
spam score = 81.6027
documents = 730
clusterid = 8e7d6beb0
RMSE = 845.459
spam score = 62.0333
documents = 300
clusterid = 8e7dbb420
RMSE = 845.695
spam score = 61.3636
documents = 132
clusterid = 8e7c35e80
RMSE = 846.161
spam score = 61.8601
documents = 143
clusterid = 8e76c6df0
RMSE = 848.692
spam score = 55.9307
documents = 1861
clusterid = 8e7c82130
RMSE = 848.719
spam score = 65
documents = 77
clusterid = 8e7832820
RMSE = 849.508
spam score = 56.5303
documents = 66
clusterid = 8e7cea780
RMSE = 850.305
spam score = 64.2215
documents = 316
clusterid = 8e7510410
RMSE = 850.97
spam score = 64.2406
documents = 212
clusterid = 8e7edf900
RMSE = 851.357
spam score = 64
documents = 2
clusterid = 8e7404aa0
RMSE = 851.508
spam score = 57.3819
documents = 288
clusterid = 8e7864c60
RMSE = 852.28
spam score = 55.5064
documents = 2413
clusterid = 8e76456c0
RMSE = 853.929
spam score = 56.3585
documents = 159
clusterid = 8e811fd20
RMSE = 856.723
spam score = 72.2281
documents = 171
clusterid = 8e7914280
RMSE = 856.96
spam score = 61.5833
documents = 12
clusterid = 8e7638e50
RMSE = 859.23
spam score = 56.8212
documents = 1460
clusterid = 8e82336c0
RMSE = 860.023
spam score = 70.1939
documents = 1346
clusterid = 8e8428840
RMSE = 860.461
spam score = 64.2957
documents = 186
clusterid = 8e7fda1c0
RMSE = 864.054
spam score = 58.3844
documents = 835
clusterid = 8e80bb9a0
RMSE = 864.84
spam score = 55.9604
documents = 1994
clusterid = 8e8021190
RMSE = 865.094
spam score = 73.4715
documents = 473
clusterid = 8e7c426f0
RMSE = 866.801
spam score = 63.0839
documents = 1574
clusterid = 8e78cd2b0
RMSE = 869.713
spam score = 56.1957
documents = 46
clusterid = 8e7b79ff0
RMSE = 870.27
spam score = 58.6786
documents = 28
clusterid = 8e8357ba0
RMSE = 870.805
spam score = 51.7198
documents = 182
clusterid = 8e75788f0
RMSE = 871.222
spam score = 67.9
documents = 40
clusterid = 8e789f3c0
RMSE = 871.35
spam score = 55.6386
documents = 332
clusterid = 8e83f6680
RMSE = 872.867
spam score = 53.025
documents = 40
clusterid = 8e7e0ec60
RMSE = 873.186
spam score = 58.0485
documents = 103
clusterid = 8e769d1d0
RMSE = 873.854
spam score = 52.25
documents = 4
clusterid = 8e8329cb0
RMSE = 874.555
spam score = 58.7226
documents = 1067
clusterid = 8e74f6fc0
RMSE = 875.029
spam score = 71.2353
documents = 68
clusterid = 8e7d31750
RMSE = 875.207
spam score = 58.4613
documents = 284
clusterid = 8e7fb4870
RMSE = 875.315
spam score = 64.4452
documents = 146
clusterid = 8e7f71b70
RMSE = 875.375
spam score = 62.5882
documents = 3244
clusterid = 8e840f760
RMSE = 876.583
spam score = 65.1834
documents = 796
clusterid = 8e7d35a20
RMSE = 877.979
spam score = 64.5954
documents = 215
clusterid = 8e75d46d0
RMSE = 878.335
spam score = 35.2041
documents = 98
clusterid = 8e775d330
RMSE = 878.7
spam score = 60.2178
documents = 101
clusterid = 8e8070700
RMSE = 879.759
spam score = 65.8636
documents = 110
clusterid = 8e7690960
RMSE = 880.698
spam score = 53.9091
documents = 110
clusterid = 8e787dd40
RMSE = 881.948
spam score = 52.625
documents = 272
clusterid = 8e7edb630
RMSE = 882.942
spam score = 65.2222
documents = 9
clusterid = 8e7a8bfa0
RMSE = 883.526
spam score = 61.3021
documents = 768
clusterid = 8e7e40e20
RMSE = 884.124
spam score = 73.75
documents = 4
clusterid = 8e78abc30
RMSE = 885.142
spam score = 66.9468
documents = 263
clusterid = 8e81dbbb0
RMSE = 885.728
spam score = 60.1364
documents = 22
clusterid = 8e7651f30
RMSE = 886.27
spam score = 65.2841
documents = 176
clusterid = 8e7c14800
RMSE = 886.423
spam score = 53.4872
documents = 39
clusterid = 8e82a8580
RMSE = 887.922
spam score = 12.7691
documents = 901
clusterid = 8e7e345b0
RMSE = 888.126
spam score = 60
documents = 2
clusterid = 8e7415610
RMSE = 888.854
spam score = 56.381
documents = 21
clusterid = 8e7ae7d80
RMSE = 890.009
spam score = 65.011
documents = 91
clusterid = 8e7b09400
RMSE = 890.035
spam score = 62.5456
documents = 2973
clusterid = 8e844e190
RMSE = 891.456
spam score = 72.5645
documents = 62
clusterid = 8e80af130
RMSE = 891.488
spam score = 56.5916
documents = 262
clusterid = 8e8314ea0
RMSE = 892.155
spam score = 67.0538
documents = 279
clusterid = 8e7942170
RMSE = 893.341
spam score = 57.6126
documents = 111
clusterid = 8e7b694b0
RMSE = 893.672
spam score = 86.8184
documents = 1377
clusterid = 8e7810c20
RMSE = 893.839
spam score = 63.8042
documents = 143
clusterid = 8e81f8f60
RMSE = 894.57
spam score = 67.7945
documents = 253
clusterid = 8e7dd0230
RMSE = 894.612
spam score = 55.2247
documents = 841
clusterid = 8e7f15d90
RMSE = 894.835
spam score = 66.1198
documents = 167
clusterid = 8e7d9e070
RMSE = 895.361
spam score = 55.4496
documents = 1886
clusterid = 8e7f65300
RMSE = 896.541
spam score = 72.805
documents = 482
clusterid = 8e75fa020
RMSE = 896.677
spam score = 31.7463
documents = 268
clusterid = 8e7daa8e0
RMSE = 897.344
spam score = 69.2903
documents = 124
clusterid = 8e774c7f0
RMSE = 898.695
spam score = 58.6855
documents = 798
clusterid = 8e8392300
RMSE = 900.246
spam score = 74.8462
documents = 91
clusterid = 8e81134b0
RMSE = 900.684
spam score = 38.8429
documents = 140
clusterid = 8e7b372f0
RMSE = 902.698
spam score = 57.2636
documents = 110
clusterid = 8e7d100d0
RMSE = 902.926
spam score = 56.0925
documents = 1308
clusterid = 8e7918550
RMSE = 903.22
spam score = 53.7314
documents = 4173
clusterid = 8e7cf6ff0
RMSE = 903.921
spam score = 61.9103
documents = 156
clusterid = 8e7d143a0
RMSE = 904.827
spam score = 69.9721
documents = 179
clusterid = 8e813d0d0
RMSE = 906.682
spam score = 59.9563
documents = 229
clusterid = 8e79b7030
RMSE = 910.475
spam score = 63.6445
documents = 256
clusterid = 8e7b0d6d0
RMSE = 910.573
spam score = 46.4006
documents = 634
clusterid = 8e78862e0
RMSE = 910.592
spam score = 68.3846
documents = 169
clusterid = 8e7ac2430
RMSE = 911.215
spam score = 54.1918
documents = 146
clusterid = 8e7589430
RMSE = 911.704
spam score = 33.4121
documents = 614
clusterid = 8e83965d0
RMSE = 911.889
spam score = 70.8443
documents = 122
clusterid = 8e81a1450
RMSE = 913.503
spam score = 11.5
documents = 2
clusterid = 8e7fa3d30
RMSE = 913.564
spam score = 55.9014
documents = 71
clusterid = 8e81a5720
RMSE = 913.859
spam score = 56.47
documents = 100
clusterid = 8e74261e0
RMSE = 914.256
spam score = 53.8826
documents = 1525
clusterid = 8e79d86b0
RMSE = 914.684
spam score = 61.0668
documents = 659
clusterid = 8e7fe2760
RMSE = 915.58
spam score = 65.1322
documents = 121
clusterid = 8e82f3820
RMSE = 916.088
spam score = 55.6875
documents = 80
clusterid = 8e7421e80
RMSE = 917.842
spam score = 51.024
documents = 125
clusterid = 8e74abd20
RMSE = 918.312
spam score = 54.8284
documents = 204
clusterid = 8e7b82590
RMSE = 919.891
spam score = 62.2122
documents = 1866
clusterid = 8e77379e0
RMSE = 920.243
spam score = 64.1316
documents = 76
clusterid = 8e7ecaaf0
RMSE = 920.7
spam score = 64.8454
documents = 1818
clusterid = 8e7808680
RMSE = 921.221
spam score = 56.2941
documents = 153
clusterid = 8e77ac8a0
RMSE = 921.619
spam score = 63.8895
documents = 353
clusterid = 8e7c8e9a0
RMSE = 922.232
spam score = 27
documents = 4
clusterid = 8e7529380
RMSE = 922.415
spam score = 59.5405
documents = 37
clusterid = 8e76735b0
RMSE = 923.375
spam score = 58.0063
documents = 1435
clusterid = 8e8151ee0
RMSE = 924.007
spam score = 63.7154
documents = 123
clusterid = 8e75e94e0
RMSE = 931.189
spam score = 60.3
documents = 250
clusterid = 8e7cb0020
RMSE = 933.058
spam score = 50.2825
documents = 1600
clusterid = 8e74cd3a0
RMSE = 933.603
spam score = 68.7662
documents = 278
clusterid = 8e767bb50
RMSE = 934.22
spam score = 52.9091
documents = 66
clusterid = 8e8085510
RMSE = 934.707
spam score = 57.9291
documents = 127
clusterid = 8e81f09c0
RMSE = 935.56
spam score = 68.6959
documents = 217
clusterid = 8e81b1f90
RMSE = 938.411
spam score = 52.7724
documents = 1472
clusterid = 8e80cc4e0
RMSE = 938.775
spam score = 62.2265
documents = 4636
clusterid = 8e82c5930
RMSE = 939.912
spam score = 62.3942
documents = 312
clusterid = 8e7f47f50
RMSE = 940.235
spam score = 64.3942
documents = 104
clusterid = 8e74e21b0
RMSE = 941.167
spam score = 32.3011
documents = 1076
clusterid = 8e7fc53b0
RMSE = 941.997
spam score = 65.1852
documents = 162
clusterid = 8e8166cf0
RMSE = 943.205
spam score = 64.8843
documents = 242
clusterid = 8e82e6fb0
RMSE = 944.589
spam score = 67.6897
documents = 203
clusterid = 8e78ff470
RMSE = 944.632
spam score = 56.9789
documents = 142
clusterid = 8e7967ac0
RMSE = 944.693
spam score = 55.7312
documents = 532
clusterid = 8e7e772b0
RMSE = 944.923
spam score = 66.783
documents = 106
clusterid = 8e838e030
RMSE = 945.037
spam score = 70.4154
documents = 65
clusterid = 8e75a67e0
RMSE = 945.401
spam score = 85.0404
documents = 272
clusterid = 8e77bd3e0
RMSE = 946.921
spam score = 65.9333
documents = 150
clusterid = 8e8424570
RMSE = 947.143
spam score = 57.023
documents = 174
clusterid = 8e81e8420
RMSE = 947.649
spam score = 57.2346
documents = 81
clusterid = 8e75e0f40
RMSE = 948.348
spam score = 84.6141
documents = 640
clusterid = 8e745c6b0
RMSE = 948.527
spam score = 61.094
documents = 117
clusterid = 8e7c29610
RMSE = 949.355
spam score = 66.8252
documents = 143
clusterid = 8e7e38880
RMSE = 949.747
spam score = 70.7778
documents = 27
clusterid = 8e7f86980
RMSE = 949.974
spam score = 54.5
documents = 2
clusterid = 8e7af45f0
RMSE = 950.279
spam score = 70.2076
documents = 159
clusterid = 8e7b9b670
RMSE = 950.416
spam score = 61.8094
documents = 404
clusterid = 8e7a66650
RMSE = 950.754
spam score = 68.8182
documents = 22
clusterid = 8e7769ba0
RMSE = 951.231
spam score = 57.6401
documents = 364
clusterid = 8e793dea0
RMSE = 951.33
spam score = 58.0208
documents = 240
clusterid = 8e761b960
RMSE = 951.492
spam score = 69.2126
documents = 668
clusterid = 8e81adcc0
RMSE = 951.817
spam score = 56.7816
documents = 316
clusterid = 8e74d9c10
RMSE = 953.644
spam score = 50.3171
documents = 41
clusterid = 8e7694c30
RMSE = 954.142
spam score = 49.2366
documents = 372
clusterid = 8e8413a30
RMSE = 954.804
spam score = 59.0433
documents = 1086
clusterid = 8e784bb80
RMSE = 955.507
spam score = 51.3609
documents = 363
clusterid = 8e8010650
RMSE = 956
spam score = 42
documents = 1
clusterid = 8e825d2e0
RMSE = 956.66
spam score = 50.3252
documents = 326
clusterid = 8e788e880
RMSE = 956.903
spam score = 56.6531
documents = 1280
clusterid = 8e792d360
RMSE = 958.084
spam score = 62.3733
documents = 75
clusterid = 8e76b62b0
RMSE = 958.216
spam score = 58.1021
documents = 519
clusterid = 8e8209aa0
RMSE = 958.492
spam score = 59.1314
documents = 312
clusterid = 8e74b8590
RMSE = 958.593
spam score = 56.8514
documents = 175
clusterid = 8e7868f30
RMSE = 959.066
spam score = 59.3032
documents = 188
clusterid = 8e8269b50
RMSE = 959.558
spam score = 66.9354
documents = 1409
clusterid = 8e810f1e0
RMSE = 959.801
spam score = 53.8321
documents = 131
clusterid = 8e7ef4710
RMSE = 960.09
spam score = 63.7433
documents = 1461
clusterid = 8e7776410
RMSE = 960.222
spam score = 57.615
documents = 187
clusterid = 8e7b6d780
RMSE = 964.241
spam score = 23.625
documents = 8
clusterid = 8e76dfed0
RMSE = 964.294
spam score = 55.4955
documents = 111
clusterid = 8e78d1580
RMSE = 964.626
spam score = 51.465
documents = 671
clusterid = 8e83f23b0
RMSE = 965.316
spam score = 62.6875
documents = 16
clusterid = 8e77d21f0
RMSE = 965.802
spam score = 70.3173
documents = 104
clusterid = 8e7443540
RMSE = 966.402
spam score = 65.3009
documents = 329
clusterid = 8e83bbf20
RMSE = 966.512
spam score = 64.2621
documents = 103
clusterid = 8e7fac2d0
RMSE = 967.796
spam score = 50.1031
documents = 291
clusterid = 8e7709af0
RMSE = 969.476
spam score = 62.7848
documents = 1069
clusterid = 8e8310bd0
RMSE = 969.699
spam score = 62.4559
documents = 590
clusterid = 8e741dbb0
RMSE = 969.896
spam score = 57.9787
documents = 47
clusterid = 8e82b90c0
RMSE = 970.462
spam score = 67.0294
documents = 204
clusterid = 8e7e8c0c0
RMSE = 970.718
spam score = 53.6331
documents = 1897
clusterid = 8e7d3dfc0
RMSE = 971.293
spam score = 63.3301
documents = 5640
clusterid = 8e7d46560
RMSE = 974.091
spam score = 59.6512
documents = 43
clusterid = 8e80c8210
RMSE = 974.1
spam score = 62.6903
documents = 339
clusterid = 8e7c92c70
RMSE = 974.479
spam score = 61.7097
documents = 62
clusterid = 8e7e94660
RMSE = 974.719
spam score = 65.7042
documents = 71
clusterid = 8e7d67be0
RMSE = 975.073
spam score = 68.6272
documents = 397
clusterid = 8e7903740
RMSE = 975.843
spam score = 63.5667
documents = 30
clusterid = 8e7dd4500
RMSE = 976.365
spam score = 66.0715
documents = 825
clusterid = 8e7ffb840
RMSE = 978.881
spam score = 53.9922
documents = 129
clusterid = 8e80080b0
RMSE = 978.99
spam score = 56.0952
documents = 21
clusterid = 8e7ead740
RMSE = 979.082
spam score = 54.9778
documents = 45
clusterid = 8e803e540
RMSE = 980.612
spam score = 64.0093
documents = 108
clusterid = 8e7b19f40
RMSE = 981.001
spam score = 74.4789
documents = 284
clusterid = 8e7970060
RMSE = 983.455
spam score = 70.6562
documents = 64
clusterid = 8e7cff590
RMSE = 983.877
spam score = 53.7577
documents = 260
clusterid = 8e781d490
RMSE = 983.974
spam score = 71.2117
documents = 326
clusterid = 8e7a065a0
RMSE = 984.239
spam score = 83.2716
documents = 335
clusterid = 8e777a6e0
RMSE = 984.606
spam score = 58.4317
documents = 1837
clusterid = 8e8370c80
RMSE = 984.749
spam score = 66.5106
documents = 94
clusterid = 8e80dd020
RMSE = 985.227
spam score = 57.9326
documents = 1528
clusterid = 8e83dd5a0
RMSE = 987.344
spam score = 59.7283
documents = 184
clusterid = 8e7a1f680
RMSE = 987.555
spam score = 56.3659
documents = 41
clusterid = 8e74f2cf0
RMSE = 987.564
spam score = 51.3636
documents = 22
clusterid = 8e7ec2550
RMSE = 988.67
spam score = 62.2593
documents = 27
clusterid = 8e78000e0
RMSE = 989.664
spam score = 54.9351
documents = 2127
clusterid = 8e77c5980
RMSE = 990.587
spam score = 51.6105
documents = 190
clusterid = 8e7984e70
RMSE = 991.336
spam score = 58.6371
documents = 496
clusterid = 8e80d07b0
RMSE = 993.986
spam score = 49.2286
documents = 433
clusterid = 8e83c01f0
RMSE = 994.431
spam score = 63.8974
documents = 195
clusterid = 8e7c21070
RMSE = 997.521
spam score = 53.6628
documents = 258
clusterid = 8e82ac850
RMSE = 997.775
spam score = 65.8125
documents = 304
clusterid = 8e7570350
RMSE = 997.883
spam score = 64.6087
documents = 276
clusterid = 8e7c4ef60
RMSE = 998.552
spam score = 54.4138
documents = 87
clusterid = 8e740d070
RMSE = 1000.23
spam score = 66.4083
documents = 387
clusterid = 8e77cdf20
RMSE = 1001.21
spam score = 68.6394
documents = 635
clusterid = 8e816f290
RMSE = 1002.47
spam score = 71.5362
documents = 621
clusterid = 8e8130860
RMSE = 1002.49
spam score = 62.7162
documents = 740
clusterid = 8e7447810
RMSE = 1004.21
spam score = 71.0981
documents = 479
clusterid = 8e743f270
RMSE = 1004.5
spam score = 59.75
documents = 48
clusterid = 8e7d70180
RMSE = 1005.73
spam score = 65.7753
documents = 89
clusterid = 8e7ba7ee0
RMSE = 1006.39
spam score = 60.7084
documents = 391
clusterid = 8e8029730
RMSE = 1006.41
spam score = 58.304
documents = 273
clusterid = 8e7d63910
RMSE = 1007.54
spam score = 55.8333
documents = 6
clusterid = 8e77e2d30
RMSE = 1008.26
spam score = 58.3001
documents = 1683
clusterid = 8e7d291b0
RMSE = 1008.33
spam score = 58.7487
documents = 378
clusterid = 8e757cbc0
RMSE = 1008.78
spam score = 57.8619
documents = 572
clusterid = 8e761b6a0
RMSE = 1008.87
spam score = 62.9474
documents = 38
clusterid = 8e7f0d7f0
RMSE = 1009.35
spam score = 49.9319
documents = 631
clusterid = 8e797c8d0
RMSE = 1009.49
spam score = 62.6019
documents = 859
clusterid = 8e7b8ee00
RMSE = 1012.03
spam score = 64.4346
documents = 902
clusterid = 8e7d8d530
RMSE = 1012.36
spam score = 55.1667
documents = 162
clusterid = 8e78f2c00
RMSE = 1013.91
spam score = 60.4615
documents = 13
clusterid = 8e80d8d50
RMSE = 1014.44
spam score = 59.3962
documents = 53
clusterid = 8e7f1a060
RMSE = 1015.76
spam score = 48.1185
documents = 658
clusterid = 8e82f7af0
RMSE = 1016.02
spam score = 58.8084
documents = 689
clusterid = 8e74007b0
RMSE = 1016.35
spam score = 70.5887
documents = 124
clusterid = 8e7ad7240
RMSE = 1016.36
spam score = 63.8845
documents = 303
clusterid = 8e8216310
RMSE = 1017.71
spam score = 60.7391
documents = 115
clusterid = 8e82057d0
RMSE = 1019.05
spam score = 65.3226
documents = 93
clusterid = 8e7bcd830
RMSE = 1019.51
spam score = 64.4
documents = 15
clusterid = 8e7b119a0
RMSE = 1019.53
spam score = 66.525
documents = 120
clusterid = 8e78bc770
RMSE = 1019.82
spam score = 59.9529
documents = 85
clusterid = 8e7860990
RMSE = 1020.04
spam score = 62.2463
documents = 1502
clusterid = 8e7f4c220
RMSE = 1020.08
spam score = 54.7011
documents = 619
clusterid = 8e79a2220
RMSE = 1020.5
spam score = 61.1333
documents = 30
clusterid = 8e828b1d0
RMSE = 1020.96
spam score = 66.9715
documents = 1263
clusterid = 8e75f5d50
RMSE = 1020.96
spam score = 68.4499
documents = 409
clusterid = 8e75a2510
RMSE = 1021.88
spam score = 60.5521
documents = 518
clusterid = 8e7b47e30
RMSE = 1022.66
spam score = 60.5379
documents = 660
clusterid = 8e80b3400
RMSE = 1022.71
spam score = 64.8084
documents = 261
clusterid = 8e8360140
RMSE = 1022.76
spam score = 59.85
documents = 40
clusterid = 8e75aaab0
RMSE = 1022.97
spam score = 57.1818
documents = 154
clusterid = 8e7f5cd60
RMSE = 1025.48
spam score = 64.471
documents = 310
clusterid = 8e7e23a70
RMSE = 1025.99
spam score = 60.6061
documents = 33
clusterid = 8e8025460
RMSE = 1026.34
spam score = 52.5009
documents = 1132
clusterid = 8e8031cd0
RMSE = 1026.63
spam score = 67.7586
documents = 29
clusterid = 8e7507b00
RMSE = 1026.67
spam score = 52.2688
documents = 506
clusterid = 8e7bc5290
RMSE = 1026.94
spam score = 63.1901
documents = 1147
clusterid = 8e7e66770
RMSE = 1026.97
spam score = 62.6296
documents = 1080
clusterid = 8e7759060
RMSE = 1027.16
spam score = 65.0288
documents = 312
clusterid = 8e79e4f20
RMSE = 1027.24
spam score = 63.0789
documents = 634
clusterid = 8e7d95ad0
RMSE = 1027.75
spam score = 44.1814
documents = 237
clusterid = 8e8078ca0
RMSE = 1028.43
spam score = 62.0189
documents = 53
clusterid = 8e765a4d0
RMSE = 1028.6
spam score = 47.0476
documents = 21
clusterid = 8e7750ac0
RMSE = 1029.87
spam score = 63.9365
documents = 1196
clusterid = 8e7c4ac90
RMSE = 1030.23
spam score = 66.5
documents = 96
clusterid = 8e7ab9e90
RMSE = 1030.28
spam score = 6
documents = 11
clusterid = 8e839a8a0
RMSE = 1031.19
spam score = 57.5357
documents = 196
clusterid = 8e7f9b790
RMSE = 1033.05
spam score = 70.3699
documents = 73
clusterid = 8e7ea0ed0
RMSE = 1033.15
spam score = 59.5643
documents = 319
clusterid = 8e785c6c0
RMSE = 1034.04
spam score = 55.553
documents = 1631
clusterid = 8e8308630
RMSE = 1034.99
spam score = 60.7513
documents = 197
clusterid = 8e828f4a0
RMSE = 1035.97
spam score = 59.7241
documents = 87
clusterid = 8e8198eb0
RMSE = 1036.04
spam score = 72.9277
documents = 83
clusterid = 8e8342d90
RMSE = 1036.08
spam score = 45
documents = 4
clusterid = 8e81840a0
RMSE = 1036.62
spam score = 58.0278
documents = 36
clusterid = 8e78c4d10
RMSE = 1037.23
spam score = 68.2489
documents = 454
clusterid = 8e7b00e60
RMSE = 1038.86
spam score = 58.5949
documents = 1486
clusterid = 8e7e4d690
RMSE = 1039.56
spam score = 58.3824
documents = 34
clusterid = 8e7cabd50
RMSE = 1040.63
spam score = 65.6015
documents = 261
clusterid = 8e7722bd0
RMSE = 1040.92
spam score = 55.4529
documents = 223
clusterid = 8e7cc4e30
RMSE = 1041
spam score = 31
documents = 1
clusterid = 8e7be6910
RMSE = 1041.55
spam score = 52.1995
documents = 827
clusterid = 8e7c3e420
RMSE = 1041.83
spam score = 64.7347
documents = 147
clusterid = 8e78dddf0
RMSE = 1042.47
spam score = 64.8846
documents = 52
clusterid = 8e76883c0
RMSE = 1042.94
spam score = 73.4348
documents = 69
clusterid = 8e7d03860
RMSE = 1043.54
spam score = 62.6914
documents = 5946
clusterid = 8e823ff30
RMSE = 1044.61
spam score = 67.8889
documents = 9
clusterid = 8e7726ea0
RMSE = 1044.81
spam score = 70.1738
documents = 282
clusterid = 8e7f547c0
RMSE = 1044.94
spam score = 59.7912
documents = 91
clusterid = 8e7e1b4d0
RMSE = 1046.12
spam score = 63.8917
documents = 120
clusterid = 8e809e5f0
RMSE = 1046.42
spam score = 59.6753
documents = 77
clusterid = 8e7b973a0
RMSE = 1046.91
spam score = 36.8142
documents = 759
clusterid = 8e76025c0
RMSE = 1047.82
spam score = 72.5
documents = 144
clusterid = 8e7a0a870
RMSE = 1048.04
spam score = 42.9273
documents = 440
clusterid = 8e754aa00
RMSE = 1049.18
spam score = 59.4762
documents = 84
clusterid = 8e80e12f0
RMSE = 1049.45
spam score = 65.4893
documents = 797
clusterid = 8e7bf7450
RMSE = 1050.26
spam score = 61.125
documents = 8
clusterid = 8e7f09520
RMSE = 1050.28
spam score = 74.0564
documents = 195
clusterid = 8e75dcc70
RMSE = 1050.86
spam score = 62.0531
documents = 113
clusterid = 8e768c690
RMSE = 1051.09
spam score = 38.5774
documents = 310
clusterid = 8e75ed7b0
RMSE = 1051.61
spam score = 92.0617
documents = 81
clusterid = 8e752d650
RMSE = 1052.71
spam score = 63.7194
documents = 834
clusterid = 8e748a650
RMSE = 1052.83
spam score = 65.7115
documents = 2298
clusterid = 8e75d0400
RMSE = 1052.89
spam score = 63.5865
documents = 399
clusterid = 8e83e5b40
RMSE = 1053.82
spam score = 65.4571
documents = 2483
clusterid = 8e7542460
RMSE = 1054.13
spam score = 70.7517
documents = 443
clusterid = 8e7cfb2c0
RMSE = 1054.28
spam score = 67.6309
documents = 363
clusterid = 8e75e5210
RMSE = 1054.86
spam score = 54.5244
documents = 431
clusterid = 8e76e8470
RMSE = 1054.94
spam score = 45.5487
documents = 113
clusterid = 8e7b8ab30
RMSE = 1055.6
spam score = 62.8592
documents = 206
clusterid = 8e7a5e0b0
RMSE = 1056.44
spam score = 35.1915
documents = 141
clusterid = 8e7fe6a30
RMSE = 1056.69
spam score = 59.6154
documents = 286
clusterid = 8e786d200
RMSE = 1057.98
spam score = 60.1093
documents = 732
clusterid = 8e8177830
RMSE = 1058.88
spam score = 64.975
documents = 160
clusterid = 8e80a6b90
RMSE = 1059.01
spam score = 67.2349
documents = 464
clusterid = 8e77ef5a0
RMSE = 1059.07
spam score = 64.2632
documents = 133
clusterid = 8e761bc20
RMSE = 1059.35
spam score = 63.75
documents = 8
clusterid = 8e7e6aa40
RMSE = 1060.7
spam score = 65.8352
documents = 358
clusterid = 8e82763c0
RMSE = 1060.9
spam score = 49.8333
documents = 6
clusterid = 8e76a9a40
RMSE = 1061
spam score = 64.8006
documents = 341
clusterid = 8e7c1cda0
RMSE = 1061.36
spam score = 60.7544
documents = 395
clusterid = 8e794e9e0
RMSE = 1061.63
spam score = 67.4781
documents = 615
clusterid = 8e74d5940
RMSE = 1061.7
spam score = 62.2941
documents = 17
clusterid = 8e7c57500
RMSE = 1061.72
spam score = 63.2571
documents = 35
clusterid = 8e7beabe0
RMSE = 1062.69
spam score = 68.5129
documents = 349
clusterid = 8e7475790
RMSE = 1063.92
spam score = 54
documents = 17
clusterid = 8e7531920
RMSE = 1064.07
spam score = 65.2532
documents = 2251
clusterid = 8e7c469c0
RMSE = 1064.12
spam score = 66.3051
documents = 59
clusterid = 8e7a83a00
RMSE = 1065.42
spam score = 62.2543
documents = 3040
clusterid = 8e804adb0
RMSE = 1066.17
spam score = 62.1107
documents = 614
clusterid = 8e7f2aba0
RMSE = 1066.37
spam score = 67.8713
documents = 171
clusterid = 8e8319170
RMSE = 1067.48
spam score = 60.5084
documents = 297
clusterid = 8e7adb510
RMSE = 1067.49
spam score = 57.2236
documents = 416
clusterid = 8e7557270
RMSE = 1068.16
spam score = 63.1561
documents = 506
clusterid = 8e79f5a60
RMSE = 1068.2
spam score = 62.6082
documents = 855
clusterid = 8e7cf2d20
RMSE = 1068.46
spam score = 61.7797
documents = 404
clusterid = 8e7aa5080
RMSE = 1068.64
spam score = 61.6316
documents = 19
clusterid = 8e7460980
RMSE = 1068.83
spam score = 70.975
documents = 40
clusterid = 8e7656200
RMSE = 1068.9
spam score = 61.1387
documents = 238
clusterid = 8e83a2e40
RMSE = 1070.2
spam score = 68.9348
documents = 276
clusterid = 8e7e3cb50
RMSE = 1071.29
spam score = 42.6367
documents = 600
clusterid = 8e8304360
RMSE = 1071.4
spam score = 59.8195
documents = 1086
clusterid = 8e7aa0db0
RMSE = 1074.01
spam score = 58.7524
documents = 412
clusterid = 8e7fde490
RMSE = 1074.02
spam score = 69
documents = 18
clusterid = 8e7567db0
RMSE = 1074.11
spam score = 59.9231
documents = 221
clusterid = 8e7fd1c20
RMSE = 1075.46
spam score = 52.8921
documents = 315
clusterid = 8e78043b0
RMSE = 1075.55
spam score = 58.8889
documents = 9
clusterid = 8e7bb4750
RMSE = 1075.65
spam score = 63.2835
documents = 127
clusterid = 8e75cc130
RMSE = 1077.04
spam score = 60.2245
documents = 49
clusterid = 8e7772140
RMSE = 1077.68
spam score = 31.745
documents = 149
clusterid = 8e7e27d40
RMSE = 1078.21
spam score = 66.8737
documents = 475
clusterid = 8e7e0a990
RMSE = 1078.46
spam score = 59.1864
documents = 236
clusterid = 8e7d91800
RMSE = 1078.97
spam score = 65.3535
documents = 215
clusterid = 8e7dcbf60
RMSE = 1079.9
spam score = 34.9965
documents = 567
clusterid = 8e7b503d0
RMSE = 1080.37
spam score = 67.2544
documents = 169
clusterid = 8e7b15c70
RMSE = 1080.71
spam score = 64.0697
documents = 445
clusterid = 8e789b0f0
RMSE = 1081
spam score = 53.324
documents = 179
clusterid = 8e801cec0
RMSE = 1081.37
spam score = 57.2449
documents = 49
clusterid = 8e83ab3e0
RMSE = 1081.67
spam score = 63.3887
documents = 1258
clusterid = 8e7832ae0
RMSE = 1081.74
spam score = 48.5829
documents = 561
clusterid = 8e7e066c0
RMSE = 1082.16
spam score = 55.5763
documents = 59
clusterid = 8e7613100
RMSE = 1082.71
spam score = 76.4516
documents = 31
clusterid = 8e76b1fe0
RMSE = 1083.57
spam score = 65.5021
documents = 243
clusterid = 8e7cb42f0
RMSE = 1087.11
spam score = 51.6667
documents = 3
clusterid = 8e766f2e0
RMSE = 1087.22
spam score = 67.9593
documents = 565
clusterid = 8e7c9f4e0
RMSE = 1088.17
spam score = 66.1571
documents = 1190
clusterid = 8e778f4f0
RMSE = 1088.44
spam score = 58.3728
documents = 169
clusterid = 8e758d700
RMSE = 1089.03
spam score = 40.9502
documents = 201
clusterid = 8e78331c0
RMSE = 1090.13
spam score = 68.7747
documents = 213
clusterid = 8e7ded5e0
RMSE = 1090.31
spam score = 41.75
documents = 4
clusterid = 8e82bd390
RMSE = 1090.9
spam score = 39.2609
documents = 46
clusterid = 8e7cbc890
RMSE = 1091.56
spam score = 59.6443
documents = 253
clusterid = 8e81c6da0
RMSE = 1092.08
spam score = 62.7143
documents = 14
clusterid = 8e7d7c9f0
RMSE = 1093.11
spam score = 55.5
documents = 132
clusterid = 8e833eac0
RMSE = 1093.67
spam score = 57.7831
documents = 83
clusterid = 8e773bcb0
RMSE = 1093.86
spam score = 67.3187
documents = 160
clusterid = 8e7454110
RMSE = 1094.03
spam score = 70.2427
documents = 103
clusterid = 8e784fe50
RMSE = 1094.05
spam score = 62.8139
documents = 634
clusterid = 8e7ccd3d0
RMSE = 1094.23
spam score = 60
documents = 23
clusterid = 8e824c7a0
RMSE = 1095.95
spam score = 52.75
documents = 8
clusterid = 8e80749d0
RMSE = 1096.07
spam score = 50.2
documents = 5
clusterid = 8e777e9b0
RMSE = 1096.8
spam score = 59
documents = 9
clusterid = 8e7bb8a20
RMSE = 1099.18
spam score = 51.6365
documents = 630
clusterid = 8e7f3b6e0
RMSE = 1100.35
spam score = 48.3358
documents = 134
clusterid = 8e74862d0
RMSE = 1100.77
spam score = 53.4513
documents = 195
clusterid = 8e7b1e210
RMSE = 1101.93
spam score = 64.4762
documents = 63
clusterid = 8e76d3660
RMSE = 1102.49
spam score = 71.9688
documents = 32
clusterid = 8e7f931f0
RMSE = 1103.13
spam score = 35.2759
documents = 424
clusterid = 8e7829d00
RMSE = 1103.21
spam score = 61.7562
documents = 402
clusterid = 8e7d24ee0
RMSE = 1106.51
spam score = 59.949
documents = 98
clusterid = 8e7832560
RMSE = 1106.85
spam score = 65.5106
documents = 141
clusterid = 8e81cf340
RMSE = 1107.01
spam score = 52.8607
documents = 244
clusterid = 8e7a62380
RMSE = 1107.43
spam score = 64.9267
documents = 860
clusterid = 8e79aa7c0
RMSE = 1108.21
spam score = 63.9203
documents = 138
clusterid = 8e7797a90
RMSE = 1109.73
spam score = 55.7245
documents = 962
clusterid = 8e834f600
RMSE = 1110.66
spam score = 67.1477
documents = 88
clusterid = 8e75b7320
RMSE = 1112.24
spam score = 69.8363
documents = 452
clusterid = 8e8297a40
RMSE = 1112.88
spam score = 60.8221
documents = 1147
clusterid = 8e8379220
RMSE = 1113.09
spam score = 50.7759
documents = 58
clusterid = 8e7832da0
RMSE = 1114.7
spam score = 58.232
documents = 125
clusterid = 8e7bde370
RMSE = 1115.33
spam score = 67.155
documents = 200
clusterid = 8e755f810
RMSE = 1115.53
spam score = 66.0225
documents = 89
clusterid = 8e795b250
RMSE = 1116.61
spam score = 64.8487
documents = 119
clusterid = 8e744fe40
RMSE = 1117.13
spam score = 63.3429
documents = 35
clusterid = 8e8254d40
RMSE = 1117.28
spam score = 66.3274
documents = 339
clusterid = 8e75bf8c0
RMSE = 1117.87
spam score = 65.1396
documents = 1089
clusterid = 8e7b86860
RMSE = 1118.94
spam score = 70.4775
documents = 467
clusterid = 8e7fead00
RMSE = 1120.19
spam score = 67.8776
documents = 237
clusterid = 8e7fc9680
RMSE = 1121.19
spam score = 58.3855
documents = 83
clusterid = 8e81cb070
RMSE = 1123.1
spam score = 65.9826
documents = 288
clusterid = 8e7dfe120
RMSE = 1123.47
spam score = 59.4047
documents = 215
clusterid = 8e776de70
RMSE = 1123.81
spam score = 57.05
documents = 80
clusterid = 8e7ef0440
RMSE = 1124.41
spam score = 64.3945
documents = 109
clusterid = 8e82fbdc0
RMSE = 1125.18
spam score = 60.8915
documents = 2341
clusterid = 8e7e6ed10
RMSE = 1125.31
spam score = 66.8795
documents = 473
clusterid = 8e81a99f0
RMSE = 1126.73
spam score = 61.1154
documents = 130
clusterid = 8e7f2ee70
RMSE = 1127.05
spam score = 61.2373
documents = 413
clusterid = 8e83c44c0
RMSE = 1127.19
spam score = 59.3396
documents = 845
clusterid = 8e7d84f90
RMSE = 1128.77
spam score = 68.6215
documents = 1831
clusterid = 8e7920af0
RMSE = 1129.48
spam score = 62.2331
documents = 459
clusterid = 8e7df9e50
RMSE = 1130.86
spam score = 67
documents = 16
clusterid = 8e8321710
RMSE = 1131.11
spam score = 65.375
documents = 32
clusterid = 8e834b330
RMSE = 1131.71
spam score = 61.6176
documents = 272
clusterid = 8e7bfb720
RMSE = 1132.07
spam score = 62.7655
documents = 290
clusterid = 8e82484d0
RMSE = 1135.55
spam score = 66.1205
documents = 224
clusterid = 8e7f00f80
RMSE = 1135.6
spam score = 56.3984
documents = 128
clusterid = 8e8063e90
RMSE = 1137.54
spam score = 62.0873
documents = 481
clusterid = 8e7546730
RMSE = 1138.54
spam score = 64.4554
documents = 101
clusterid = 8e783f310
RMSE = 1138.81
spam score = 61.107
documents = 374
clusterid = 8e7a12e10
RMSE = 1138.94
spam score = 67.1389
documents = 324
clusterid = 8e7974330
RMSE = 1140.29
spam score = 58.9773
documents = 660
clusterid = 8e7c0c260
RMSE = 1141.57
spam score = 67.9536
documents = 151
clusterid = 8e7952cb0
RMSE = 1141.6
spam score = 64.9013
documents = 598
clusterid = 8e8068160
RMSE = 1141.95
spam score = 55.1356
documents = 1047
clusterid = 8e83a7110
RMSE = 1143.53
spam score = 57.2086
documents = 1122
clusterid = 8e82720f0
RMSE = 1143.87
spam score = 67.9538
documents = 238
clusterid = 8e7fb05a0
RMSE = 1144.7
spam score = 61.84
documents = 250
clusterid = 8e7d4a830
RMSE = 1146.97
spam score = 64.6806
documents = 216
clusterid = 8e7a72ec0
RMSE = 1148.23
spam score = 61.1302
documents = 215
clusterid = 8e77b4e40
RMSE = 1148.52
spam score = 65.3
documents = 20
clusterid = 8e791c820
RMSE = 1148.65
spam score = 58.4132
documents = 334
clusterid = 8e7b930d0
RMSE = 1151.74
spam score = 61.2
documents = 25
clusterid = 8e7e98930
RMSE = 1151.93
spam score = 60.3895
documents = 842
clusterid = 8e842cb10
RMSE = 1153.42
spam score = 57.0899
documents = 445
clusterid = 8e8430de0
RMSE = 1154.18
spam score = 65.4387
documents = 2913
clusterid = 8e7a301c0
RMSE = 1154.67
spam score = 67.8496
documents = 379
clusterid = 8e81e4150
RMSE = 1154.74
spam score = 59.3935
documents = 1131
clusterid = 8e84071c0
RMSE = 1155.7
spam score = 63.8833
documents = 180
clusterid = 8e7408d90
RMSE = 1156.04
spam score = 62.0489
documents = 307
clusterid = 8e76dbc00
RMSE = 1158.14
spam score = 65.5213
documents = 2436
clusterid = 8e7d5b370
RMSE = 1159.12
spam score = 60.8803
documents = 610
clusterid = 8e74fb290
RMSE = 1159.12
spam score = 60.7176
documents = 825
clusterid = 8e7825a30
RMSE = 1159.93
spam score = 63.102
documents = 245
clusterid = 8e7d07b30
RMSE = 1160.2
spam score = 59.8606
documents = 459
clusterid = 8e748a700
RMSE = 1161.05
spam score = 50.8158
documents = 38
clusterid = 8e749f4b0
RMSE = 1161.35
spam score = 67.198
documents = 995
clusterid = 8e7879a70
RMSE = 1161.77
spam score = 51.5416
documents = 397
clusterid = 8e7ea9470
RMSE = 1163.98
spam score = 45.375
documents = 56
clusterid = 8e81282c0
RMSE = 1164.65
spam score = 67.7706
documents = 170
clusterid = 8e77fbe10
RMSE = 1164.67
spam score = 41.6078
documents = 102
clusterid = 8e7ec6820
RMSE = 1164.8
spam score = 58.1333
documents = 15
clusterid = 8e7520de0
RMSE = 1165.26
spam score = 63.7762
documents = 143
clusterid = 8e7b546a0
RMSE = 1167.54
spam score = 61.7099
documents = 717
clusterid = 8e7eb5ce0
RMSE = 1167.54
spam score = 63.9647
documents = 2718
clusterid = 8e8286f00
RMSE = 1167.77
spam score = 69.2255
documents = 1574
clusterid = 8e74198e0
RMSE = 1168.29
spam score = 55.05
documents = 180
clusterid = 8e78b41d0
RMSE = 1168.58
spam score = 63.0331
documents = 242
clusterid = 8e7956f80
RMSE = 1169.5
spam score = 59.4184
documents = 141
clusterid = 8e767fe20
RMSE = 1170.25
spam score = 65.2628
documents = 156
clusterid = 8e83538d0
RMSE = 1172.95
spam score = 65.09
documents = 756
clusterid = 8e7ff32a0
RMSE = 1173.14
spam score = 60.5
documents = 8
clusterid = 8e7b71a50
RMSE = 1173.75
spam score = 62.481
documents = 501
clusterid = 8e8445bf0
RMSE = 1174.63
spam score = 68.5353
documents = 170
clusterid = 8e7bac1b0
RMSE = 1177.24
spam score = 69.4194
documents = 279
clusterid = 8e7978600
RMSE = 1177.84
spam score = 65.3141
documents = 191
clusterid = 8e76173d0
RMSE = 1178.14
spam score = 62.1478
documents = 230
clusterid = 8e8212040
RMSE = 1178.68
spam score = 68.9697
documents = 33
clusterid = 8e7563ae0
RMSE = 1179.59
spam score = 59.5502
documents = 787
clusterid = 8e7580e90
RMSE = 1181.5
spam score = 66.296
documents = 277
clusterid = 8e8194be0
RMSE = 1181.5
spam score = 44.2765
documents = 293
clusterid = 8e82ef550
RMSE = 1182.95
spam score = 59.4524
documents = 84
clusterid = 8e7535bf0
RMSE = 1183.5
spam score = 62.7333
documents = 45
clusterid = 8e76308b0
RMSE = 1183.94
spam score = 63.0091
documents = 549
clusterid = 8e8096050
RMSE = 1184.14
spam score = 61.6697
documents = 433
clusterid = 8e78583f0
RMSE = 1184.17
spam score = 64.9527
documents = 3255
clusterid = 8e7d0be00
RMSE = 1184.29
spam score = 63.5404
documents = 470
clusterid = 8e8149940
RMSE = 1184.51
spam score = 57.9718
documents = 177
clusterid = 8e805fbc0
RMSE = 1184.61
spam score = 64.037
documents = 81
clusterid = 8e83259e0
RMSE = 1185.3
spam score = 25.2759
documents = 29
clusterid = 8e77c9c50
RMSE = 1185.48
spam score = 75.5172
documents = 87
clusterid = 8e82cded0
RMSE = 1185.59
spam score = 61.8026
documents = 613
clusterid = 8e80c3f40
RMSE = 1185.89
spam score = 63.8421
documents = 1526
clusterid = 8e78478b0
RMSE = 1187.42
spam score = 62.7647
documents = 34
clusterid = 8e81dfe80
RMSE = 1187.67
spam score = 64.6263
documents = 1330
clusterid = 8e7ecedc0
RMSE = 1188.37
spam score = 78
documents = 3
clusterid = 8e78ee930
RMSE = 1188.83
spam score = 72.8571
documents = 7
clusterid = 8e8347060
RMSE = 1191.42
spam score = 75.2997
documents = 387
clusterid = 8e7be2640
RMSE = 1192.08
spam score = 59.6654
documents = 257
clusterid = 8e8091d80
RMSE = 1192.12
spam score = 17.3229
documents = 477
clusterid = 8e747dd30
RMSE = 1192.45
spam score = 56.5961
documents = 255
clusterid = 8e7ebe280
RMSE = 1192.6
spam score = 59.2413
documents = 1115
clusterid = 8e8300090
RMSE = 1193.16
spam score = 61.4198
documents = 81
clusterid = 8e810af10
RMSE = 1195.8
spam score = 62.2787
documents = 2153
clusterid = 8e7ff7570
RMSE = 1196.44
spam score = 61.3077
documents = 234
clusterid = 8e76f0a10
RMSE = 1196.49
spam score = 66.5096
documents = 312
clusterid = 8e772f440
RMSE = 1198.43
spam score = 36.1591
documents = 264
clusterid = 8e7e7b580
RMSE = 1198.98
spam score = 59.1357
documents = 1120
clusterid = 8e78e20c0
RMSE = 1199.09
spam score = 60.724
documents = 192
clusterid = 8e7b75d20
RMSE = 1199.95
spam score = 39.25
documents = 8
clusterid = 8e760ab60
RMSE = 1200.31
spam score = 59.8867
documents = 1765
clusterid = 8e7db2e80
RMSE = 1201.4
spam score = 64.1864
documents = 59
clusterid = 8e7db7150
RMSE = 1202.2
spam score = 62.8537
documents = 205
clusterid = 8e7935900
RMSE = 1203.02
spam score = 50.904
documents = 198
clusterid = 8e836c9b0
RMSE = 1206.84
spam score = 85.0877
documents = 171
clusterid = 8e7833110
RMSE = 1207.22
spam score = 58.1456
documents = 261
clusterid = 8e74ea750
RMSE = 1207.84
spam score = 55.6786
documents = 28
clusterid = 8e818c640
RMSE = 1207.93
spam score = 58.3505
documents = 194
clusterid = 8e7ca37b0
RMSE = 1211.41
spam score = 61.6812
documents = 916
clusterid = 8e832df80
RMSE = 1211.68
spam score = 56.1194
documents = 67
clusterid = 8e7a6ebf0
RMSE = 1211.82
spam score = 40.9178
documents = 1350
clusterid = 8e7468f20
RMSE = 1212.75
spam score = 63.4385
documents = 1512
clusterid = 8e7946440
RMSE = 1215.04
spam score = 64.7717
documents = 219
clusterid = 8e7c86400
RMSE = 1215.51
spam score = 47.5
documents = 4
clusterid = 8e8106c40
RMSE = 1216.07
spam score = 66.6844
documents = 1651
clusterid = 8e81413a0
RMSE = 1216.89
spam score = 64.5
documents = 608
clusterid = 8e7748520
RMSE = 1217.37
spam score = 56.8571
documents = 21
clusterid = 8e83d5000
RMSE = 1219.52
spam score = 54.1119
documents = 1734
clusterid = 8e7f695d0
RMSE = 1219.79
spam score = 63.8821
documents = 636
clusterid = 8e749b1e0
RMSE = 1221.31
spam score = 54.3333
documents = 3
clusterid = 8e7701550
RMSE = 1222.22
spam score = 45.4118
documents = 17
clusterid = 8e7aad620
RMSE = 1222.86
spam score = 63.6682
documents = 434
clusterid = 8e7bc0fc0
RMSE = 1223.54
spam score = 65.2186
documents = 334
clusterid = 8e816afc0
RMSE = 1223.97
spam score = 64.3466
documents = 1578
clusterid = 8e7662a70
RMSE = 1225.87
spam score = 61.1854
documents = 712
clusterid = 8e7d1c940
RMSE = 1228.95
spam score = 50.3846
documents = 52
clusterid = 8e7c31bb0
RMSE = 1228.99
spam score = 59.322
documents = 441
clusterid = 8e7574620
RMSE = 1230.79
spam score = 60.7742
documents = 279
clusterid = 8e843d650
RMSE = 1231.23
spam score = 69.006
documents = 167
clusterid = 8e821e8b0
RMSE = 1231.46
spam score = 65.3499
documents = 666
clusterid = 8e7ab18f0
RMSE = 1234.49
spam score = 59.1765
documents = 119
clusterid = 8e7cddf10
RMSE = 1234.83
spam score = 63.7509
documents = 562
clusterid = 8e83d0d30
RMSE = 1235.32
spam score = 62.9873
documents = 314
clusterid = 8e7c96f40
RMSE = 1235.64
spam score = 57.87
documents = 200
clusterid = 8e7585160
RMSE = 1236.01
spam score = 59.9541
documents = 1328
clusterid = 8e76cb0c0
RMSE = 1237.77
spam score = 54.8421
documents = 19
clusterid = 8e7999c80
RMSE = 1239.65
spam score = 68.77
documents = 700
clusterid = 8e77b9110
RMSE = 1242.42
spam score = 64.7965
documents = 226
clusterid = 8e814dc10
RMSE = 1242.9
spam score = 48.2973
documents = 37
clusterid = 8e74ddee0
RMSE = 1242.95
spam score = 69.3797
documents = 158
clusterid = 8e806c430
RMSE = 1243.9
spam score = 59.4211
documents = 608
clusterid = 8e7a98810
RMSE = 1244.47
spam score = 43.0741
documents = 27
clusterid = 8e82b0b20
RMSE = 1244.62
spam score = 60.8476
documents = 105
clusterid = 8e76413f0
RMSE = 1244.7
spam score = 65.009
documents = 1553
clusterid = 8e7f75e40
RMSE = 1245.06
spam score = 61.595
documents = 1200
clusterid = 8e7daebb0
RMSE = 1247.4
spam score = 61.4188
documents = 382
clusterid = 8e7716360
RMSE = 1247.69
spam score = 57.2745
documents = 306
clusterid = 8e7f05250
RMSE = 1247.93
spam score = 63.3024
documents = 992
clusterid = 8e79d43e0
RMSE = 1249.23
spam score = 63.4069
documents = 349
clusterid = 8e7814ef0
RMSE = 1249.6
spam score = 64.4815
documents = 135
clusterid = 8e817fdd0
RMSE = 1250.86
spam score = 60.0428
documents = 561
clusterid = 8e7c07f90
RMSE = 1251.64
spam score = 52.6525
documents = 259
clusterid = 8e7c18ad0
RMSE = 1252.42
spam score = 72.9762
documents = 126
clusterid = 8e770ddc0
RMSE = 1253.79
spam score = 58.825
documents = 40
clusterid = 8e74583e0
RMSE = 1255.52
spam score = 28.2
documents = 5
clusterid = 8e7a40d00
RMSE = 1255.76
spam score = 68.5496
documents = 464
clusterid = 8e8117780
RMSE = 1255.84
spam score = 67.176
documents = 250
clusterid = 8e8102970
RMSE = 1258.76
spam score = 57.608
documents = 500
clusterid = 8e7f11ac0
RMSE = 1259.37
spam score = 62.5161
documents = 93
clusterid = 8e74478c0
RMSE = 1263.14
spam score = 59.8894
documents = 642
clusterid = 8e7744250
RMSE = 1264.04
spam score = 65.4208
documents = 1742
clusterid = 8e790bce0
RMSE = 1265.02
spam score = 56.625
documents = 8
clusterid = 8e827a690
RMSE = 1265.32
spam score = 64.4
documents = 170
clusterid = 8e81fd230
RMSE = 1265.35
spam score = 32
documents = 9
clusterid = 8e75100a0
RMSE = 1266.41
spam score = 60.763
documents = 173
clusterid = 8e7bc9560
RMSE = 1266.72
spam score = 64.8182
documents = 22
clusterid = 8e7b2aa80
RMSE = 1266.76
spam score = 67.002
documents = 1489
clusterid = 8e773ff80
RMSE = 1267.13
spam score = 60.4347
documents = 773
clusterid = 8e75250b0
RMSE = 1267.75
spam score = 65.6042
documents = 48
clusterid = 8e76a14a0
RMSE = 1270.19
spam score = 65.6197
documents = 660
clusterid = 8e77e7000
RMSE = 1273
spam score = 62.6926
documents = 231
clusterid = 8e7fbce10
RMSE = 1274.4
spam score = 23.5
documents = 4
clusterid = 8e7c10530
RMSE = 1277.02
spam score = 53.6063
documents = 447
clusterid = 8e7761600
RMSE = 1277.94
spam score = 29.5
documents = 10
clusterid = 8e7f8ac50
RMSE = 1278.82
spam score = 65.86
documents = 100
clusterid = 8e823bc60
RMSE = 1279.99
spam score = 68.3162
documents = 2258
clusterid = 8e780c950
RMSE = 1280.51
spam score = 64.8994
documents = 815
clusterid = 8e771a630
RMSE = 1281.39
spam score = 65.2408
documents = 461
clusterid = 8e79637f0
RMSE = 1282.13
spam score = 54.9322
documents = 59
clusterid = 8e7eb9fb0
RMSE = 1284.14
spam score = 58.3714
documents = 105
clusterid = 8e81d78e0
RMSE = 1286.38
spam score = 59.4776
documents = 469
clusterid = 8e763d120
RMSE = 1287.44
spam score = 64.7619
documents = 105
clusterid = 8e7f974c0
RMSE = 1287.74
spam score = 64.9585
documents = 2095
clusterid = 8e815e750
RMSE = 1288.86
spam score = 66.4791
documents = 1461
clusterid = 8e75b3050
RMSE = 1289.55
spam score = 61.2824
documents = 386
clusterid = 8e7efccb0
RMSE = 1290.46
spam score = 59.8318
documents = 214
clusterid = 8e76fd280
RMSE = 1290.87
spam score = 62.5801
documents = 574
clusterid = 8e833a7f0
RMSE = 1292.42
spam score = 60.8161
documents = 87
clusterid = 8e76f4ce0
RMSE = 1293.86
spam score = 68.0684
documents = 1096
clusterid = 8e7929090
RMSE = 1294.47
spam score = 47.4667
documents = 15
clusterid = 8e7abe160
RMSE = 1295.26
spam score = 62.2164
documents = 901
clusterid = 8e7b5cc40
RMSE = 1296.99
spam score = 65.0806
documents = 62
clusterid = 8e79c38a0
RMSE = 1298.02
spam score = 62.5846
documents = 544
clusterid = 8e7d74450
RMSE = 1299.4
spam score = 42.2632
documents = 19
clusterid = 8e7f3f9b0
RMSE = 1299.89
spam score = 60.7044
documents = 477
clusterid = 8e7595ca0
RMSE = 1301.07
spam score = 63.5819
documents = 177
clusterid = 8e7eec170
RMSE = 1303.19
spam score = 48.3265
documents = 49
clusterid = 8e82c9c00
RMSE = 1304
spam score = 48.2812
documents = 32
clusterid = 8e75c3b90
RMSE = 1305.37
spam score = 58.603
documents = 927
clusterid = 8e77da790
RMSE = 1305.6
spam score = 62.4081
documents = 223
clusterid = 8e7a2bef0
RMSE = 1306.47
spam score = 67.3711
documents = 388
clusterid = 8e8336520
RMSE = 1306.65
spam score = 70.3119
documents = 109
clusterid = 8e7fcd950
RMSE = 1306.73
spam score = 38.5
documents = 2
clusterid = 8e829ffe0
RMSE = 1310.66
spam score = 64.0968
documents = 1012
clusterid = 8e794a710
RMSE = 1311.02
spam score = 70.1405
documents = 121
clusterid = 8e7d78720
RMSE = 1314.03
spam score = 59.3867
documents = 1024
clusterid = 8e809a320
RMSE = 1314.66
spam score = 18.6667
documents = 6
clusterid = 8e7ed3090
RMSE = 1317.98
spam score = 65.437
documents = 1556
clusterid = 8e7c8a6d0
RMSE = 1320.06
spam score = 56.0433
documents = 208
clusterid = 8e79fe000
RMSE = 1320.9
spam score = 61.9315
documents = 73
clusterid = 8e7e5e1d0
RMSE = 1321.53
spam score = 64.5518
documents = 763
clusterid = 8e7733710
RMSE = 1321.59
spam score = 50.8092
documents = 1027
clusterid = 8e7782c80
RMSE = 1324.25
spam score = 66.0526
documents = 760
clusterid = 8e79cbe40
RMSE = 1324.5
spam score = 63.8564
documents = 752
clusterid = 8e7cd16a0
RMSE = 1334.13
spam score = 53.8017
documents = 121
clusterid = 8e80d4a80
RMSE = 1334.25
spam score = 66.4426
documents = 61
clusterid = 8e7f37410
RMSE = 1339.36
spam score = 66.6525
documents = 118
clusterid = 8e7f504f0
RMSE = 1339.78
spam score = 62.2315
documents = 812
clusterid = 8e8389d60
RMSE = 1342.03
spam score = 36.2941
documents = 17
clusterid = 8e7fc10e0
RMSE = 1342.44
spam score = 65.5418
documents = 443
clusterid = 8e7666d40
RMSE = 1342.52
spam score = 58.08
documents = 25
clusterid = 8e7bbccf0
RMSE = 1343.28
spam score = 51.625
documents = 8
clusterid = 8e7d570a0
RMSE = 1345.39
spam score = 69.6689
documents = 447
clusterid = 8e7f33140
RMSE = 1346.1
spam score = 49.1176
documents = 51
clusterid = 8e75c7e60
RMSE = 1349.21
spam score = 61.7752
documents = 476
clusterid = 8e7e9cc00
RMSE = 1349.78
spam score = 38.1979
documents = 96
clusterid = 8e7e023f0
RMSE = 1350.29
spam score = 45.1832
documents = 131
clusterid = 8e7634b80
RMSE = 1351.06
spam score = 51.7045
documents = 335
clusterid = 8e8046ae0
RMSE = 1351.51
spam score = 63.5776
documents = 1302
clusterid = 8e82d6470
RMSE = 1352.79
spam score = 52.1341
documents = 261
clusterid = 8e798d410
RMSE = 1354.76
spam score = 59.2657
documents = 557
clusterid = 8e79bf5d0
RMSE = 1357.87
spam score = 36.8235
documents = 17
clusterid = 8e83d92d0
RMSE = 1361.45
spam score = 58.0824
documents = 85
clusterid = 8e7fa8000
RMSE = 1362.67
spam score = 47.6562
documents = 32
clusterid = 8e7ee7ea0
RMSE = 1366.31
spam score = 59.1377
documents = 363
clusterid = 8e8057620
RMSE = 1373.55
spam score = 62.619
documents = 42
clusterid = 8e7b43b60
RMSE = 1377.6
spam score = 59.2787
documents = 122
clusterid = 8e80b76d0
RMSE = 1383.06
spam score = 27.8333
documents = 6
clusterid = 8e79f1790
RMSE = 1386.86
spam score = 62.4766
documents = 128
clusterid = 8e7e17200
RMSE = 1387.01
spam score = 55.7864
documents = 103
clusterid = 8e74c4e00
RMSE = 1387.19
spam score = 60.5992
documents = 711
clusterid = 8e80bfc70
RMSE = 1392.22
spam score = 36.5714
documents = 35
clusterid = 8e7464c50
RMSE = 1393.51
spam score = 42.6667
documents = 3
clusterid = 8e812c590
RMSE = 1405.28
spam score = 57.3458
documents = 590
clusterid = 8e7ce64b0
RMSE = 1405.46
spam score = 24.2188
documents = 32
clusterid = 8e800c380
RMSE = 1407.03
spam score = 37.8395
documents = 461
clusterid = 8e7b4c100
RMSE = 1408.18
spam score = 67.8325
documents = 209
clusterid = 8e829bd10
RMSE = 1422.96
spam score = 26.3571
documents = 42
clusterid = 8e7f22600
RMSE = 1424.78
spam score = 51.1744
documents = 86
clusterid = 8e7fb8b40
RMSE = 1425.94
spam score = 72.04
documents = 25
clusterid = 8e77f7b40
RMSE = 1426.53
spam score = 65.1296
documents = 54
clusterid = 8e8201500
RMSE = 1428.07
spam score = 67.9669
documents = 242
clusterid = 8e7bd5dd0
RMSE = 1429.29
spam score = 50.8571
documents = 49
clusterid = 8e827e960
RMSE = 1430.39
spam score = 53.5714
documents = 14
clusterid = 8e77c16b0
RMSE = 1442.7
spam score = 45.0631
documents = 206
clusterid = 8e7adf7e0
RMSE = 1447.82
spam score = 59.0769
documents = 78
clusterid = 8e7a34490
RMSE = 1452.19
spam score = 61.7445
documents = 685
clusterid = 8e7907a10
RMSE = 1456.29
spam score = 41.3462
documents = 624
clusterid = 8e78a7960
RMSE = 1463.03
spam score = 41.2
documents = 20
clusterid = 8e7cc9100
RMSE = 1467.93
spam score = 62.4
documents = 10
clusterid = 8e751cb10
RMSE = 1468.98
spam score = 52.3913
documents = 552
clusterid = 8e7f61030
RMSE = 1469.69
spam score = 60.277
documents = 148
clusterid = 8e819d180
RMSE = 1476.24
spam score = 47.0651
documents = 169
clusterid = 8e82eb280
RMSE = 1493.12
spam score = 43.114
documents = 307
clusterid = 8e81561b0
RMSE = 1500.41
spam score = 48.1152
documents = 712
clusterid = 8e7f58a90
RMSE = 1505.21
spam score = 56.8693
documents = 176
clusterid = 8e7c53230
RMSE = 1505.52
spam score = 45.3333
documents = 18
clusterid = 8e753e190
RMSE = 1529.85
spam score = 47.4479
documents = 96
clusterid = 8e79ed4c0
RMSE = 1535.33
spam score = 54.625
documents = 16
clusterid = 8e771e900
RMSE = 1542.77
spam score = 55.0931
documents = 591
clusterid = 8e756c080
RMSE = 1544.97
spam score = 52.3009
documents = 349
clusterid = 8e8237990
RMSE = 1547.43
spam score = 56.1532
documents = 111
clusterid = 8e79b2d60
RMSE = 1571.42
spam score = 55.5556
documents = 36
clusterid = 8e7552fa0
RMSE = 1584.46
spam score = 43.7124
documents = 153
clusterid = 8e7482000
RMSE = 1594.68
spam score = 51.098
documents = 51
clusterid = 8e7786f50
RMSE = 1630
spam score = 54.6667
documents = 3
clusterid = 8e808dab0
RMSE = 1674.14
spam score = 44.3333
documents = 3
clusterid = 8e7aceca0
RMSE = 1802.17
spam score = 24.8
documents = 5
clusterid = 8e80e55c0
RMSE = 1900.54
spam score = 51
documents = 2
distance = 0
spam score = 23
title = ''

distance = 0
spam score = 79
title = ''

distance = 0
spam score = 84
title = ''

distance = 0
spam score = 82
title = ''

distance = 0
spam score = 23
title = ''

distance = 0
spam score = 80
title = ''

distance = 20
spam score = 59
title = ''

distance = 31
spam score = 64
title = ''

distance = 43
spam score = 73
title = ''

distance = 60
spam score = 75
title = ''

distance = 29
spam score = 57
title = ''

distance = 100
spam score = 72
title = ''

distance = 13
spam score = 85
title = ''

distance = 16
spam score = 86
title = ''

distance = 18
spam score = 75
title = ''

distance = 20
spam score = 82
title = ''

distance = 22
spam score = 88
title = ''

distance = 25
spam score = 78
title = ''

distance = 25
spam score = 80
title = ''

distance = 25
spam score = 75
title = ''

distance = 26
spam score = 81
title = ''

distance = 28
spam score = 77
title = ''

distance = 28
spam score = 76
title = ''

distance = 28
spam score = 75
title = ''

distance = 28
spam score = 78
title = ''

distance = 29
spam score = 74
title = ''

distance = 30
spam score = 78
title = ''

distance = 34
spam score = 85
title = ''

distance = 35
spam score = 77
title = ''

distance = 36
spam score = 86
title = ''

distance = 36
spam score = 82
title = ''

distance = 36
spam score = 82
title = ''

distance = 39
spam score = 86
title = ''

distance = 42
spam score = 80
title = ''

distance = 44
spam score = 78
title = ''

distance = 45
spam score = 88
title = ''

distance = 45
spam score = 89
title = ''

distance = 48
spam score = 75
title = ''

distance = 53
spam score = 82
title = ''

distance = 59
spam score = 75
title = ''

distance = 60
spam score = 72
title = ''

distance = 60
spam score = 73
title = ''

distance = 61
spam score = 81
title = ''

distance = 65
spam score = 71
title = ''

distance = 68
spam score = 70
title = ''

distance = 69
spam score = 79
title = ''

distance = 70
spam score = 71
title = ''

distance = 80
spam score = 79
title = ''

distance = 81
spam score = 71
title = ''

distance = 82
spam score = 80
title = ''

distance = 117
spam score = 32
title = ''

distance = 118
spam score = 37
title = ''

distance = 146
spam score = 26
title = ''

distance = 149
spam score = 28
title = ''

distance = 156
spam score = 72
title = ''

distance = 165
spam score = 74
title = ''

distance = 196
spam score = 86
title = ''

distance = 200
spam score = 76
title = ''

distance = 211
spam score = 58
title = ''

distance = 213
spam score = 60
title = ''

distance = 215
spam score = 61
title = ''

distance = 219
spam score = 72
title = ''

distance = 220
spam score = 67
title = ''

distance = 221
spam score = 62
title = ''

distance = 221
spam score = 62
title = ''

distance = 223
spam score = 75
title = ''

distance = 229
spam score = 55
title = ''

distance = 21
spam score = 83
title = 'api help digester 18 api'

distance = 23
spam score = 82
title = 'api help io 13 api'

distance = 25
spam score = 80
title = 'api help lang 23 api'

distance = 25
spam score = 81
title = 'api help axiom 128 api'

distance = 25
spam score = 84
title = 'api help io 11 api'

distance = 26
spam score = 87
title = 'api help tapestry 416 api'

distance = 27
spam score = 72
title = 'api help axis2 api'

distance = 30
spam score = 84
title = 'api help axis2 api'

distance = 33
spam score = 71
title = 'api help hadoop 0164 api'

distance = 33
spam score = 76
title = 'api help lucene 230 api'

distance = 33
spam score = 73
title = 'api help lang 23 api'

distance = 33
spam score = 89
title = 'api help wicket 132 api'

distance = 34
spam score = 71
title = 'api help hadoop 0170 api'

distance = 35
spam score = 81
title = 'api help zookeeper 301 api'

distance = 35
spam score = 80
title = 'api help scxml 07 api'

distance = 36
spam score = 75
title = 'api help lucene 230 api'

distance = 36
spam score = 78
title = 'api help hadoop 0153 api'

distance = 36
spam score = 76
title = 'api help scxml 06 api'

distance = 38
spam score = 84
title = 'api help shale core 104 api'

distance = 39
spam score = 78
title = 'api help commons pool 14 api'

distance = 52
spam score = 85
title = 'api help hadoop 0172 api'

distance = 52
spam score = 86
title = 'api help hbase 0181 api'

distance = 52
spam score = 78
title = 'api help struts faces 1310 api'

distance = 52
spam score = 75
title = 'api help struts 2 core 20111 api'

distance = 53
spam score = 86
title = 'api help transaction 20snapshot api'

distance = 53
spam score = 87
title = 'api help apache synapse 12 api'

distance = 53
spam score = 74
title = 'api help lucene 231 api'

distance = 53
spam score = 73
title = 'api help lucene 231 api'

distance = 54
spam score = 87
title = 'api help struts core 1310 api'

distance = 54
spam score = 77
title = 'api help tiles 2 207 test api'

distance = 63
spam score = 82
title = 'api help jdo2 api 22'

distance = 63
spam score = 79
title = 'api help lucene 232 api'

distance = 64
spam score = 81
title = 'api help commons jxpath 13 api'

distance = 64
spam score = 87
title = 'api help apache jackrabbit 150 api'

distance = 64
spam score = 78
title = 'api help commons dbcp 122 api'

distance = 65
spam score = 73
title = 'api help struts 2 tiles plugin 208 api'

distance = 66
spam score = 83
title = 'api help solr nightly api'

distance = 66
spam score = 82
title = 'api help shale tiger extensions 104 api'

distance = 66
spam score = 87
title = 'api help commons digester 20 api'

distance = 67
spam score = 85
title = 'api help struts extras 1310 api'

distance = 78
spam score = 89
title = 'api help httpmime 40beta2 api'

distance = 78
spam score = 91
title = 'api help commons primitives 11snapshot api'

distance = 79
spam score = 86
title = 'api help shale tiger extensions 110snapshot api'

distance = 79
spam score = 85
title = 'api help commons vfs 11snapshot api'

distance = 80
spam score = 74
title = 'api help portlet 411snapshot api'

distance = 80
spam score = 75
title = 'api help lucene 240 api'

distance = 80
spam score = 87
title = 'api help'

distance = 80
spam score = 78
title = 'api help struts 2 tiles plugin 20111 api'

distance = 80
spam score = 78
title = 'api help commons transaction 13snapshot test api'

distance = 81
spam score = 88
title = 'api help shale dialog manager 110snapshot api'

distance = 91
spam score = 78
title = 'api help struts 2 sitegraph plugin 2011 api'

distance = 92
spam score = 86
title = 'api help commons digester 21snapshot api'

distance = 92
spam score = 88
title = 'api help sandbox core 118snapshot api'

distance = 92
spam score = 85
title = 'api help shale application controller 110snapshot api'

distance = 92
spam score = 88
title = 'api help commons jexl 111snapshot api'

distance = 93
spam score = 80
title = 'api help shale dialog manager 104 api'

distance = 93
spam score = 84
title = 'api help fulcrum quartz 11snapshot api'

distance = 93
spam score = 74
title = 'api help struts 2 sitegraph plugin 208 api'

distance = 94
spam score = 81
title = 'api help'

distance = 95
spam score = 79
title = 'api help pluto utilities 200snapshot test api'

distance = 108
spam score = 79
title = 'api help maven surefire plugin 243 api'

distance = 108
spam score = 81
title = 'api help commons id sandbox 10snapshot test api'

distance = 109
spam score = 76
title = 'api help pluto portal driver implementation classes 200snapshot api'

distance = 110
spam score = 86
title = 'api help commons csv sandbox 10snapshot api'

distance = 111
spam score = 89
title = 'api help apache velocity 16 api'

distance = 111
spam score = 89
title = 'api help apache velocity 161 api'

distance = 111
spam score = 87
title = 'api help texen 10snapshot api'

distance = 111
spam score = 78
title = 'api help commons monitoring sandbox 10snapshot test api'

distance = 111
spam score = 78
title = 'api help httpcore 40beta4snapshot api'

distance = 112
spam score = 85
title = 'api help shale use cases sample app 110snapshot api'

distance = 138
spam score = 79
title = 'api help apache james basic mailet toolkit 10snapshot api'

distance = 139
spam score = 79
title = 'api help struts faces 1310 test api'

distance = 139
spam score = 81
title = 'api help apache velocity 17dev test api'

distance = 139
spam score = 86
title = 'api help commons javaflow sandbox 10snapshot api'

distance = 140
spam score = 81
title = 'api help neethi 204 test api'

distance = 140
spam score = 75
title = 'api help apache james standard mailets 10snapshot test api'

distance = 141
spam score = 75
title = 'api help shale spring integration 110snapshot api'

distance = 141
spam score = 75
title = 'api help struts 2 sitegraph plugin 206 api'

distance = 143
spam score = 80
title = 'api help apache myfaces shared for jsf 11 core 209snapshot api'

distance = 144
spam score = 77
title = 'api help apache myfaces jsf11 api 117snapshot test api'

distance = 160
spam score = 85
title = 'api help shale sql browser sample app 104 api'

distance = 160
spam score = 80
title = 'api help struts 2 jfreechart plugin 212 api'

distance = 160
spam score = 79
title = 'api help struts 2 configuration browser plugin 206 api'

distance = 160
spam score = 71
title = 'api help struts 2 sitemesh plugin 2012 api'

distance = 160
spam score = 71
title = 'api help struts 2 jsf plugin 2012 api'

distance = 161
spam score = 75
title = 'api help struts 2 sitemesh plugin 2011 api'

distance = 161
spam score = 79
title = 'api help struts 2 struts 1 plugin 20112 api'

distance = 161
spam score = 76
title = 'api help struts 2 jasper reports plugin 206 api'

distance = 162
spam score = 82
title = 'api help commons el 101snapshot test api'

distance = 162
spam score = 76
title = 'api help struts 2 plexus plugin 20111 api'

distance = 177
spam score = 87
title = 'api help'

distance = 178
spam score = 92
title = 'api help xmlbeans 220 documentation'

distance = 178
spam score = 83
title = 'api help apache mailet api 25snapshot api'

distance = 179
spam score = 81
title = 'api help'

distance = 179
spam score = 83
title = 'api help shale mailreader sample app 104 api'

distance = 182
spam score = 79
title = 'api help shale blank sample app 110snapshot api'

distance = 182
spam score = 73
title = 'api help jbehave ant 21 api'

distance = 182
spam score = 92
title = 'api help xmlbeans 240 documentation'

distance = 183
spam score = 91
title = 'api help xml standard api'

distance = 183
spam score = 75
title = 'api help struts 2 plexus plugin 206 api'

distance = 244
spam score = 79
title = 'api help multiverse server api version 15'

distance = 245
spam score = 79
title = 'api help java platform se 6'

distance = 252
spam score = 80
title = 'api help'

distance = 259
spam score = 80
title = 'api help'

distance = 259
spam score = 77
title = 'api help echopointng api specification'

distance = 298
spam score = 72
title = 'api help simian similarity analyser v2224'

distance = 367
spam score = 78
title = 'api help jspell sdk 2004 spell checker for the java tm platform'

distance = 368
spam score = 73
title = 'api help zoho reports api docs'

distance = 40
spam score = 78
title = ''

distance = 44
spam score = 71
title = ''

distance = 45
spam score = 72
title = ''

distance = 54
spam score = 68
title = ''

distance = 55
spam score = 64
title = ''

distance = 56
spam score = 68
title = ''

distance = 61
spam score = 62
title = ''

distance = 62
spam score = 69
title = ''

distance = 71
spam score = 68
title = ''

distance = 155
spam score = 47
title = ''

distance = 165
spam score = 55
title = ''

distance = 168
spam score = 52
title = ''

distance = 178
spam score = 57
title = ''

distance = 337
spam score = 55
title = ''

distance = 28
spam score = 74
title = 'api help'

distance = 28
spam score = 77
title = 'api help'

distance = 28
spam score = 84
title = 'api help'

distance = 29
spam score = 69
title = 'api help'

distance = 29
spam score = 70
title = 'api help'

distance = 29
spam score = 79
title = 'api help'

distance = 29
spam score = 85
title = 'api help'

distance = 29
spam score = 88
title = 'api help'

distance = 30
spam score = 74
title = 'api help'

distance = 30
spam score = 84
title = 'api help'

distance = 31
spam score = 76
title = 'api help'

distance = 31
spam score = 71
title = 'api help'

distance = 31
spam score = 74
title = 'api help'

distance = 31
spam score = 76
title = 'api help'

distance = 31
spam score = 86
title = 'api help'

distance = 31
spam score = 81
title = 'api help'

distance = 31
spam score = 74
title = 'api help'

distance = 31
spam score = 79
title = 'api help'

distance = 32
spam score = 75
title = 'api help'

distance = 32
spam score = 79
title = 'api help'

distance = 101
spam score = 75
title = 'api help'

distance = 101
spam score = 75
title = 'api help concurrent building blocks 031 api'

distance = 101
spam score = 83
title = 'api help jedit api'

distance = 101
spam score = 74
title = 'api help seam jsf controls 211ga api'

distance = 101
spam score = 74
title = 'api help swinglabs javadoc'

distance = 102
spam score = 84
title = 'api help io apis'

distance = 102
spam score = 75
title = 'api help architecture rules 210snapshot api'

distance = 102
spam score = 69
title = 'api help test api'

distance = 102
spam score = 71
title = 'api help quipukit 15 api documentation'

distance = 102
spam score = 75
title = 'api help lire api'

distance = 122
spam score = 77
title = 'api help hyfo api'

distance = 122
spam score = 75
title = 'api help hapi 06snapshot api'

distance = 123
spam score = 74
title = 'api help dddsample 101snapshot api'

distance = 123
spam score = 80
title = 'api help'

distance = 123
spam score = 76
title = 'api help datanucleus core 104snapshot api'

distance = 123
spam score = 77
title = 'api help mycore javadoc documentation'

distance = 123
spam score = 79
title = 'api help metaphile api documentation'

distance = 123
spam score = 75
title = 'api help'

distance = 123
spam score = 78
title = 'api help datanucleus rdbms 104snapshot api'

distance = 123
spam score = 79
title = 'api help search api'

distance = 137
spam score = 80
title = 'api help'

distance = 137
spam score = 80
title = 'api help module for jta 10 10snapshot api'

distance = 137
spam score = 87
title = 'api help czt circus parser 10 api'

distance = 137
spam score = 76
title = 'api help m3g 09 scene graphs'

distance = 137
spam score = 82
title = 'api help toolbusjavaadapter'

distance = 138
spam score = 74
title = 'api help sun spot host api purple'

distance = 138
spam score = 73
title = 'api help tapfx component library for tapestry 3 035alpha1 api'

distance = 138
spam score = 65
title = 'api help archive4j 10'

distance = 138
spam score = 78
title = 'api help stella boleto 12 api'

distance = 138
spam score = 78
title = 'api help lazyj web templates api'

distance = 157
spam score = 76
title = 'api help vraptor 2 framework 251 api'

distance = 157
spam score = 85
title = 'api help'

distance = 157
spam score = 76
title = 'api help descargador 100 api'

distance = 157
spam score = 71
title = 'api help'

distance = 157
spam score = 75
title = 'api help'

distance = 157
spam score = 75
title = 'api help java spss writer api'

distance = 157
spam score = 64
title = 'api help jatha api documentation'

distance = 157
spam score = 84
title = 'api help external libraries'

distance = 157
spam score = 81
title = 'api help joelib2alpha api documentation'

distance = 157
spam score = 83
title = 'api help external libraries'

distance = 176
spam score = 82
title = 'api help olap4j version 097136'

distance = 177
spam score = 79
title = 'api help look feel customization library'

distance = 177
spam score = 82
title = 'api help editor utilities'

distance = 177
spam score = 77
title = 'api help mxdublin api'

distance = 177
spam score = 50
title = 'api help jackson json processor'

distance = 177
spam score = 70
title = 'api help the netty project 300m7 api reference'

distance = 177
spam score = 87
title = 'api help debugger core api'

distance = 177
spam score = 85
title = 'api help jdtk 100'

distance = 177
spam score = 86
title = 'api help junit api'

distance = 177
spam score = 81
title = 'api help common palette'

distance = 192
spam score = 69
title = 'api help jackson json processor'

distance = 192
spam score = 78
title = 'api help'

distance = 192
spam score = 83
title = 'api help mime lookup api'

distance = 193
spam score = 30
title = 'api help spring framework api 21 spring framework 210 api java c'

distance = 193
spam score = 86
title = 'api help editor error stripe'

distance = 193
spam score = 87
title = 'api help czt user interface 10 api'

distance = 193
spam score = 74
title = 'api help eigenbase xom resgen version 13011875'

distance = 193
spam score = 82
title = 'api help editor code folding'

distance = 193
spam score = 82
title = 'api help editor settings storage'

distance = 193
spam score = 89
title = 'api help'

distance = 214
spam score = 70
title = 'api help jchart2d api documentation version 310'

distance = 214
spam score = 83
title = 'api help multiview windows'

distance = 214
spam score = 69
title = 'api help sun spot api green'

distance = 214
spam score = 91
title = 'api help jsci api documentation'

distance = 214
spam score = 81
title = 'api help elki environment for developing kddapplications supported by indexstructures'

distance = 214
spam score = 73
title = 'api help bluecove 211snapshot api'

distance = 215
spam score = 81
title = 'api help jpda debugger api'

distance = 215
spam score = 79
title = 'api help example stella boleto 12 api'

distance = 215
spam score = 71
title = 'api help daisy pipeline transformer api documentation'

distance = 215
spam score = 82
title = 'api help google web toolkit javadoc'

distance = 253
spam score = 25
title = 'api help netbeans execution api netbeans api javadoc 551 java c'

distance = 253
spam score = 76
title = 'api help'

distance = 254
spam score = 55
title = 'api help gridgain 210 api'

distance = 254
spam score = 54
title = 'api help 2step documentation'

distance = 254
spam score = 80
title = 'api help greenfoot api'

distance = 254
spam score = 76
title = 'api help geotechnical software services api specification'

distance = 254
spam score = 75
title = 'api help java ee 5 sdk'

distance = 255
spam score = 68
title = 'api help isode java dsapi classes'

distance = 255
spam score = 78
title = 'api help'

distance = 255
spam score = 82
title = 'api help'

distance = 1235
spam score = 59
title = 'oracle9ias portal plsql api reference 9026 documentation help'

distance = 1406
spam score = 65
title = 'uses of package comfacebookapi facebook java library 18final api'

distance = 1421
spam score = 62
title = 'comfacebookapi facebook java library 18final api'

distance = 1742
spam score = 36
title = 'yumdevel patch remove rpmdbpackagesackinstalled'

distance = 126
spam score = 72
title = ''

distance = 133
spam score = 71
title = ''

distance = 134
spam score = 70
title = ''

distance = 137
spam score = 71
title = ''

distance = 142
spam score = 68
title = ''

distance = 146
spam score = 72
title = ''

distance = 151
spam score = 70
title = ''

distance = 151
spam score = 69
title = ''

distance = 499
spam score = 67
title = ''

distance = 39
spam score = 67
title = ''

distance = 44
spam score = 63
title = ''

distance = 47
spam score = 65
title = ''

distance = 57
spam score = 67
title = ''

distance = 68
spam score = 62
title = ''

distance = 78
spam score = 67
title = ''

distance = 81
spam score = 64
title = ''

distance = 82
spam score = 64
title = ''

distance = 83
spam score = 73
title = ''

distance = 94
spam score = 58
title = ''

distance = 97
spam score = 60
title = ''

distance = 98
spam score = 59
title = ''

distance = 99
spam score = 62
title = ''

distance = 121
spam score = 62
title = ''

distance = 251
spam score = 54
title = ''

distance = 375
spam score = 45
title = ''

distance = 379
spam score = 42
title = ''

distance = 386
spam score = 51
title = ''

distance = 404
spam score = 56
title = ''

distance = 407
spam score = 54
title = ''

distance = 57
spam score = 74
title = ''

distance = 57
spam score = 74
title = ''

distance = 57
spam score = 75
title = ''

distance = 57
spam score = 80
title = ''

distance = 57
spam score = 79
title = ''

distance = 58
spam score = 78
title = ''

distance = 59
spam score = 82
title = ''

distance = 59
spam score = 75
title = ''

distance = 59
spam score = 76
title = ''

distance = 59
spam score = 75
title = ''

distance = 59
spam score = 79
title = ''

distance = 59
spam score = 82
title = ''

distance = 59
spam score = 82
title = ''

distance = 59
spam score = 78
title = ''

distance = 60
spam score = 76
title = ''

distance = 60
spam score = 80
title = ''

distance = 60
spam score = 86
title = ''

distance = 61
spam score = 80
title = ''

distance = 62
spam score = 78
title = ''

distance = 62
spam score = 79
title = ''

distance = 64
spam score = 88
title = ''

distance = 72
spam score = 75
title = ''

distance = 73
spam score = 76
title = ''

distance = 95
spam score = 81
title = ''

distance = 98
spam score = 90
title = ''

distance = 149
spam score = 77
title = ''

distance = 159
spam score = 77
title = ''

distance = 163
spam score = 80
title = ''

distance = 197
spam score = 88
title = ''

distance = 203
spam score = 79
title = ''

distance = 208
spam score = 74
title = ''

distance = 220
spam score = 71
title = ''

distance = 226
spam score = 85
title = ''

distance = 231
spam score = 77
title = ''

distance = 234
spam score = 64
title = ''

distance = 236
spam score = 75
title = ''

distance = 244
spam score = 83
title = ''

distance = 250
spam score = 77
title = ''

distance = 291
spam score = 78
title = ''

distance = 299
spam score = 76
title = ''

distance = 308
spam score = 75
title = ''

distance = 312
spam score = 69
title = ''

distance = 858
spam score = 68
title = ''

distance = 1418
spam score = 83
title = ''

distance = 45
spam score = 60
title = 'help'

distance = 52
spam score = 65
title = 'help'

distance = 60
spam score = 48
title = 'help'

distance = 61
spam score = 44
title = 'help'

distance = 64
spam score = 73
title = 'help'

distance = 66
spam score = 60
title = 'help'

distance = 66
spam score = 42
title = 'help'

distance = 67
spam score = 39
title = 'help'

distance = 67
spam score = 64
title = 'help'

distance = 69
spam score = 48
title = 'help'

distance = 70
spam score = 49
title = 'help'

distance = 72
spam score = 44
title = 'help'

distance = 72
spam score = 42
title = 'help'

distance = 74
spam score = 64
title = 'help'

distance = 75
spam score = 40
title = 'help'

distance = 75
spam score = 55
title = 'help'

distance = 76
spam score = 51
title = 'help'

distance = 76
spam score = 56
title = 'help'

distance = 77
spam score = 46
title = 'help'

distance = 77
spam score = 57
title = 'help'

distance = 87
spam score = 61
title = 'help'

distance = 91
spam score = 45
title = 'help'

distance = 91
spam score = 46
title = 'help'

distance = 92
spam score = 75
title = 'help'

distance = 92
spam score = 44
title = 'help'

distance = 93
spam score = 65
title = 'help'

distance = 95
spam score = 66
title = 'help'

distance = 97
spam score = 54
title = 'help'

distance = 98
spam score = 37
title = 'help'

distance = 102
spam score = 74
title = 'help'

distance = 107
spam score = 58
title = 'help'

distance = 107
spam score = 65
title = 'help'

distance = 107
spam score = 67
title = 'help'

distance = 108
spam score = 36
title = 'help'

distance = 109
spam score = 43
title = 'help'

distance = 109
spam score = 46
title = 'help'

distance = 110
spam score = 54
title = 'help'

distance = 110
spam score = 58
title = 'help'

distance = 111
spam score = 61
title = 'help'

distance = 111
spam score = 64
title = 'help'

distance = 115
spam score = 66
title = 'help'

distance = 115
spam score = 43
title = 'help'

distance = 116
spam score = 58
title = 'help'

distance = 116
spam score = 60
title = 'help'

distance = 116
spam score = 62
title = 'help'

distance = 117
spam score = 51
title = 'help'

distance = 117
spam score = 44
title = 'help'

distance = 117
spam score = 59
title = 'help'

distance = 117
spam score = 66
title = 'help'

distance = 118
spam score = 63
title = 'help'

distance = 122
spam score = 41
title = 'help'

distance = 124
spam score = 45
title = 'help'

distance = 124
spam score = 44
title = 'help'

distance = 125
spam score = 41
title = 'help'

distance = 125
spam score = 62
title = 'help'

distance = 126
spam score = 61
title = 'help'

distance = 126
spam score = 61
title = 'help'

distance = 126
spam score = 59
title = 'help'

distance = 126
spam score = 62
title = 'help'

distance = 127
spam score = 60
title = 'help'

distance = 132
spam score = 69
title = 'help'

distance = 132
spam score = 41
title = 'help'

distance = 132
spam score = 45
title = 'help'

distance = 133
spam score = 70
title = 'help'

distance = 133
spam score = 67
title = 'help'

distance = 133
spam score = 76
title = 'help'

distance = 134
spam score = 60
title = 'help'

distance = 134
spam score = 41
title = 'help'

distance = 135
spam score = 44
title = 'help'

distance = 135
spam score = 71
title = 'help'

distance = 140
spam score = 43
title = 'help'

distance = 141
spam score = 70
title = 'help'

distance = 141
spam score = 36
title = 'help'

distance = 141
spam score = 48
title = 'help'

distance = 144
spam score = 35
title = 'help'

distance = 146
spam score = 39
title = 'help'

distance = 146
spam score = 53
title = 'help'

distance = 147
spam score = 61
title = 'help'

distance = 150
spam score = 41
title = 'help'

distance = 153
spam score = 44
title = 'help'

distance = 159
spam score = 44
title = 'help'

distance = 160
spam score = 65
title = 'help'

distance = 160
spam score = 35
title = 'help'

distance = 160
spam score = 71
title = 'help'

distance = 160
spam score = 47
title = 'help'

distance = 161
spam score = 58
title = 'help'

distance = 161
spam score = 66
title = 'help'

distance = 163
spam score = 48
title = 'help'

distance = 164
spam score = 56
title = 'help'

distance = 164
spam score = 58
title = 'help'

distance = 184
spam score = 61
title = 'help'

distance = 199
spam score = 41
title = 'help'

distance = 202
spam score = 61
title = 'help'

distance = 208
spam score = 39
title = 'help'

distance = 211
spam score = 37
title = 'help'

distance = 212
spam score = 76
title = 'help'

distance = 212
spam score = 73
title = 'help'

distance = 222
spam score = 77
title = 'help'

distance = 222
spam score = 82
title = 'help'

distance = 223
spam score = 81
title = 'help'

distance = 1730
spam score = 36
title = 'eoaccessfault'

distance = 1748
spam score = 32
title = 'nsprintpanel'

distance = 1751
spam score = 31
title = 'nsprintpanel'

distance = 8
spam score = 60
title = ''

distance = 10
spam score = 57
title = ''

distance = 12
spam score = 62
title = ''

distance = 12
spam score = 62
title = ''

distance = 12
spam score = 59
title = ''

distance = 12
spam score = 62
title = ''

distance = 14
spam score = 71
title = ''

distance = 15
spam score = 58
title = ''

distance = 15
spam score = 57
title = ''

distance = 15
spam score = 59
title = ''

distance = 15
spam score = 64
title = ''

distance = 15
spam score = 58
title = ''

distance = 16
spam score = 68
title = ''

distance = 18
spam score = 64
title = ''

distance = 20
spam score = 59
title = ''

distance = 27
spam score = 56
title = ''

distance = 32
spam score = 66
title = ''

distance = 32
spam score = 54
title = ''

distance = 34
spam score = 63
title = ''

distance = 46
spam score = 58
title = ''

distance = 49
spam score = 55
title = ''

distance = 71
spam score = 66
title = ''

distance = 87
spam score = 69
title = ''

distance = 107
spam score = 52
title = ''

distance = 124
spam score = 54
title = ''

distance = 134
spam score = 73
title = ''

distance = 146
spam score = 60
title = ''

distance = 192
spam score = 51
title = ''

distance = 195
spam score = 58
title = ''

distance = 201
spam score = 61
title = ''

distance = 204
spam score = 56
title = ''

distance = 216
spam score = 69
title = ''

distance = 217
spam score = 57
title = ''

distance = 239
spam score = 65
title = ''

distance = 341
spam score = 36
title = ''

distance = 396
spam score = 16
title = ''

distance = 1781
spam score = 53
title = ''

distance = 49
spam score = 75
title = 'api help'

distance = 54
spam score = 77
title = 'api help'

distance = 56
spam score = 81
title = 'api help'

distance = 57
spam score = 80
title = 'api help'

distance = 57
spam score = 75
title = 'api help'

distance = 57
spam score = 70
title = 'api help'

distance = 58
spam score = 73
title = 'api help'

distance = 58
spam score = 89
title = 'api help'

distance = 61
spam score = 69
title = 'api help'

distance = 61
spam score = 83
title = 'api help'

distance = 61
spam score = 78
title = 'api help'

distance = 62
spam score = 88
title = 'api help'

distance = 63
spam score = 76
title = 'api help'

distance = 63
spam score = 82
title = 'api help'

distance = 64
spam score = 76
title = 'api help'

distance = 64
spam score = 76
title = 'api help'

distance = 65
spam score = 88
title = 'api help'

distance = 66
spam score = 74
title = 'api help'

distance = 67
spam score = 66
title = 'api help'

distance = 67
spam score = 77
title = 'api help nls api'

distance = 146
spam score = 84
title = 'api help content repository for java technology api 10'

distance = 146
spam score = 75
title = 'api help'

distance = 146
spam score = 25
title = 'api help hibernate api documentation hibernate 218 api java c'

distance = 146
spam score = 84
title = 'api help javaunidu'

distance = 147
spam score = 72
title = 'api help tomcat manager plugin 072 api'

distance = 147
spam score = 66
title = 'api help winpack 35 documentation'

distance = 147
spam score = 83
title = 'javamail api documentation api help'

distance = 147
spam score = 81
title = 'synapse api api help'

distance = 147
spam score = 73
title = 'api help latka 10dev api'

distance = 147
spam score = 79
title = 'api help huihoo jfoxmq 05dev api'

distance = 166
spam score = 74
title = 'api help fulcrum factory component 103 api'

distance = 166
spam score = 85
title = 'api help'

distance = 166
spam score = 74
title = 'api help gridport job submission portlet 10 api'

distance = 166
spam score = 79
title = 'api help jazz api'

distance = 166
spam score = 69
title = 'api help fsl api documentation'

distance = 166
spam score = 85
title = 'api help'

distance = 166
spam score = 81
title = 'api help'

distance = 166
spam score = 75
title = 'junitpp library 381 api api help'

distance = 166
spam score = 71
title = 'api help'

distance = 167
spam score = 85
title = 'api help jamda framework api'

distance = 186
spam score = 76
title = 'api help micro focus cobol connector class library'

distance = 186
spam score = 70
title = 'api help fulcrum jetty 100snapshot test api'

distance = 186
spam score = 80
title = 'api help csv'

distance = 186
spam score = 79
title = 'api help'

distance = 186
spam score = 76
title = 'api help fulcrum groovy component 101dev api'

distance = 187
spam score = 76
title = 'api help fulcrum intake component 104dev api'

distance = 188
spam score = 85
title = 'api help'

distance = 188
spam score = 85
title = 'api help'

distance = 188
spam score = 78
title = 'api help jtidy servlet r8snapshot api'

distance = 188
spam score = 68
title = 'api help'

distance = 208
spam score = 74
title = 'api help catalina internal api documentation'

distance = 208
spam score = 72
title = 'api help colt 120 api specification'

distance = 208
spam score = 74
title = 'api help'

distance = 208
spam score = 75
title = 'apache struts api documentation api help'

distance = 208
spam score = 81
title = 'api help'

distance = 208
spam score = 66
title = 'api help'

distance = 209
spam score = 80
title = 'api help'

distance = 209
spam score = 85
title = 'api help commons feedparser 05beta api'

distance = 209
spam score = 74
title = 'api help'

distance = 209
spam score = 72
title = 'api help'

distance = 236
spam score = 71
title = 'api help semoa api documentation'

distance = 236
spam score = 71
title = 'api help fractal api'

distance = 236
spam score = 73
title = 'api help dream adl 02 api'

distance = 236
spam score = 85
title = 'api help eclipse platform api specification'

distance = 236
spam score = 85
title = 'api help'

distance = 237
spam score = 74
title = 'api help'

distance = 237
spam score = 81
title = 'api help jucas object orientated pull mvc webframework 06alpha api'

distance = 237
spam score = 23
title = 'api help netbeans actions api netbeans api javadoc 500 java c'

distance = 237
spam score = 70
title = 'xpusp packages api help'

distance = 237
spam score = 23
title = 'api help netbeans text api netbeans api javadoc 500 java c'

distance = 260
spam score = 75
title = 'api help'

distance = 261
spam score = 72
title = 'api help maven dashboard report plugin 100beta1 test api'

distance = 261
spam score = 76
title = 'api help fulcrum localization component 106dev api'

distance = 261
spam score = 76
title = 'api help dwarf server framework api specification'

distance = 261
spam score = 78
title = 'api help xt 20051014 api'

distance = 261
spam score = 81
title = 'api help xt 20051118 api'

distance = 262
spam score = 64
title = 'api help ant xinclude task 02'

distance = 262
spam score = 76
title = 'api help launcher version 11'

distance = 262
spam score = 77
title = 'api help fkache open source 10beta6 api'

distance = 262
spam score = 69
title = 'api help m2k alpha 11 mirex edition'

distance = 288
spam score = 82
title = 'api help sleepycat software inc berkeley db java api'

distance = 289
spam score = 85
title = 'api help java 2 platform se v142'

distance = 289
spam score = 72
title = 'api help'

distance = 289
spam score = 90
title = 'api help slide webdav client javadoc'

distance = 290
spam score = 64
title = 'api help java access to wordnet'

distance = 290
spam score = 78
title = 'api help cadzilla'

distance = 290
spam score = 49
title = 'api help oracle ultra search java api reference'

distance = 293
spam score = 82
title = 'api help primitive collections for java api v12'

distance = 293
spam score = 78
title = 'api help osci transport library by mediakomm esslingen'

distance = 293
spam score = 80
title = 'api help adventnetsnmpv3'

distance = 354
spam score = 84
title = 'extensible data format api api help'

distance = 354
spam score = 76
title = 'api help jdo javadoc'

distance = 357
spam score = 66
title = 'api help javadoc documentation pure java subversion svn client library'

distance = 357
spam score = 70
title = 'api help'

distance = 358
spam score = 64
title = 'api help webcab bonds j2ee edition'

distance = 359
spam score = 68
title = 'api help nextapp echo2 extras api specification'

distance = 361
spam score = 56
title = 'api help oracle business rules java api reference'

distance = 362
spam score = 75
title = 'api help'

distance = 363
spam score = 74
title = 'api help jakartaoro 21dev1 api'

distance = 365
spam score = 45
title = 'api help oracle internet directory api reference'

distance = 1450
spam score = 76
title = 'api help click mock api'

distance = 1456
spam score = 83
title = 'api help click framework api'

distance = 1771
spam score = 38
title = 'treadlayerscom sata ii and sas raid card roundup'

distance = 88
spam score = 66
title = 'eval'

distance = 94
spam score = 64
title = 'eval'

distance = 104
spam score = 67
title = 'compile'

distance = 107
spam score = 66
title = 'compile'

distance = 110
spam score = 69
title = 'funcodepointequal'

distance = 112
spam score = 69
title = 'profile'

distance = 117
spam score = 61
title = 'updatestatistics'

distance = 119
spam score = 64
title = 'updatestatistics'

distance = 121
spam score = 67
title = 'fundatetime'

distance = 122
spam score = 68
title = 'getmoduleloadpath'

distance = 122
spam score = 67
title = 'getindexstatistics'

distance = 124
spam score = 68
title = 'getmoduleloadpath'

distance = 125
spam score = 63
title = 'getindexstatistics'

distance = 126
spam score = 65
title = 'updatestatistics'

distance = 127
spam score = 67
title = 'funcodepointstostring'

distance = 132
spam score = 64
title = 'getindexstatistics'

distance = 132
spam score = 65
title = 'funstringjoin'

distance = 134
spam score = 70
title = 'collations'

distance = 134
spam score = 68
title = 'collations'

distance = 136
spam score = 65
title = 'triggersystemtask'

distance = 152
spam score = 66
title = 'filternested'

distance = 153
spam score = 67
title = 'getmethod'

distance = 153
spam score = 70
title = 'binarydoc'

distance = 153
spam score = 70
title = 'funbaseuri'

distance = 153
spam score = 71
title = 'getexists'

distance = 154
spam score = 71
title = 'getquerystring'

distance = 154
spam score = 69
title = 'kwicdisplay'

distance = 154
spam score = 67
title = 'filternested'

distance = 154
spam score = 65
title = 'geturl'

distance = 155
spam score = 67
title = 'filternested'

distance = 161
spam score = 69
title = 'getexists'

distance = 162
spam score = 66
title = 'validation'

distance = 162
spam score = 68
title = 'validation'

distance = 163
spam score = 68
title = 'matchcount'

distance = 164
spam score = 69
title = 'getheadernames'

distance = 164
spam score = 62
title = 'killrunningxquery'

distance = 165
spam score = 69
title = 'getheadernames'

distance = 165
spam score = 68
title = 'prologfunctions'

distance = 166
spam score = 63
title = 'systemproperty'

distance = 167
spam score = 64
title = 'collectionname'

distance = 175
spam score = 69
title = 'tokenize'

distance = 175
spam score = 67
title = 'killrunningxquery'

distance = 175
spam score = 68
title = 'tokenize'

distance = 176
spam score = 64
title = 'invalidate'

distance = 176
spam score = 69
title = 'getbuild'

distance = 176
spam score = 67
title = 'invalidate'

distance = 178
spam score = 67
title = 'killrunningxquery'

distance = 181
spam score = 71
title = 'getcookievalue'

distance = 183
spam score = 69
title = 'streambinary'

distance = 184
spam score = 68
title = 'getbuild'

distance = 194
spam score = 67
title = 'shutdown'

distance = 198
spam score = 67
title = 'getcookienames'

distance = 198
spam score = 69
title = 'setcurrentuser'

distance = 199
spam score = 68
title = 'fuzzyindexterms'

distance = 199
spam score = 68
title = 'getcookienames'

distance = 199
spam score = 65
title = 'getcookienames'

distance = 199
spam score = 68
title = 'getversion'

distance = 200
spam score = 67
title = 'setcurrentuser'

distance = 204
spam score = 67
title = 'shutdown'

distance = 207
spam score = 70
title = 'getrequestattribute'

distance = 223
spam score = 68
title = 'getparameter'

distance = 224
spam score = 69
title = 'getpathinfo'

distance = 228
spam score = 69
title = 'updatestatistics'

distance = 233
spam score = 72
title = 'grammartooling'

distance = 235
spam score = 71
title = 'filternested'

distance = 237
spam score = 69
title = 'fileread'

distance = 237
spam score = 69
title = 'geturi'

distance = 240
spam score = 66
title = 'getserverport'

distance = 240
spam score = 72
title = 'highlightmatches'

distance = 243
spam score = 72
title = 'kwicdisplay'

distance = 252
spam score = 73
title = 'getuploadedfile'

distance = 254
spam score = 71
title = 'tokenize'

distance = 254
spam score = 67
title = 'getattributenames'

distance = 254
spam score = 67
title = 'gethostname'

distance = 254
spam score = 74
title = 'getquerystring'

distance = 255
spam score = 66
title = 'getattributenames'

distance = 256
spam score = 73
title = 'getheader'

distance = 257
spam score = 69
title = 'fununescapeuri'

distance = 258
spam score = 68
title = 'redirectto'

distance = 259
spam score = 71
title = 'getmethod'

distance = 292
spam score = 74
title = 'grammartooling'

distance = 297
spam score = 72
title = 'getcookienames'

distance = 298
spam score = 72
title = 'getpathinfo'

distance = 303
spam score = 70
title = 'shutdown'

distance = 306
spam score = 72
title = 'encodeurl'

distance = 313
spam score = 71
title = 'getcontextpath'

distance = 328
spam score = 69
title = 'funescapeuri'

distance = 329
spam score = 71
title = 'redirectto'

distance = 331
spam score = 71
title = 'geturi'

distance = 333
spam score = 71
title = 'getattributenames'

distance = 441
spam score = 64
title = 'xmldbsetresourcepermissions'

distance = 441
spam score = 64
title = 'xmldbchmodcollection'

distance = 444
spam score = 62
title = 'xmldbstore'

distance = 448
spam score = 64
title = 'xmldbcollectionexists'

distance = 449
spam score = 65
title = 'xmldbgetchildresources'

distance = 453
spam score = 62
title = 'xmldbchmodresource'

distance = 475
spam score = 68
title = 'xmldbmove'

distance = 476
spam score = 66
title = 'xmldbrename'

distance = 479
spam score = 64
title = 'xmldbhaslock'

distance = 481
spam score = 70
title = 'getmemory'

distance = 1400
spam score = 58
title = 'compiledxquery'

distance = 1403
spam score = 56
title = 'compiledxquery'

distance = 1922
spam score = 12
title = 'izlesene beyaz video beyaz izlesene beyaz izle beyaz videolar1 beyaz video izle beyaz vidyo izle izlesenecom izlesene beyaz indir'

distance = 33
spam score = 70
title = 'api help'

distance = 39
spam score = 77
title = 'api help'

distance = 41
spam score = 72
title = 'api help'

distance = 43
spam score = 78
title = 'api help'

distance = 44
spam score = 69
title = 'api help'

distance = 44
spam score = 74
title = 'api help'

distance = 45
spam score = 77
title = 'api help'

distance = 46
spam score = 69
title = 'api help'

distance = 47
spam score = 77
title = 'api help'

distance = 47
spam score = 79
title = 'api help'

distance = 48
spam score = 88
title = 'api help'

distance = 49
spam score = 71
title = 'api help'

distance = 49
spam score = 74
title = 'api help'

distance = 50
spam score = 68
title = 'api help'

distance = 50
spam score = 69
title = 'api help'

distance = 50
spam score = 65
title = 'api help'

distance = 51
spam score = 81
title = 'api help'

distance = 52
spam score = 78
title = 'api help'

distance = 53
spam score = 68
title = 'api help'

distance = 53
spam score = 78
title = 'api help'

distance = 121
spam score = 69
title = 'api help'

distance = 121
spam score = 67
title = 'api help'

distance = 121
spam score = 73
title = 'api help'

distance = 122
spam score = 86
title = 'httpclient api api help'

distance = 122
spam score = 71
title = 'api help'

distance = 122
spam score = 84
title = 'api help'

distance = 123
spam score = 73
title = 'api help'

distance = 123
spam score = 73
title = 'nrc fuzzyj toolkit fuzzyjess api help'

distance = 123
spam score = 77
title = 'lowlife3d api help'

distance = 124
spam score = 81
title = 'api help'

distance = 136
spam score = 65
title = 'api help'

distance = 136
spam score = 74
title = 'api help'

distance = 136
spam score = 76
title = 'api help'

distance = 136
spam score = 75
title = 'api help'

distance = 136
spam score = 69
title = 'masi media applet synchronization interface api help'

distance = 136
spam score = 76
title = 'api help'

distance = 136
spam score = 81
title = 'api help'

distance = 136
spam score = 72
title = 'api help'

distance = 136
spam score = 74
title = 'api help'

distance = 137
spam score = 83
title = 'api help'

distance = 156
spam score = 90
title = 'api help'

distance = 156
spam score = 81
title = 'api help'

distance = 156
spam score = 72
title = 'api help'

distance = 156
spam score = 75
title = 'api help'

distance = 156
spam score = 85
title = 'api help'

distance = 157
spam score = 74
title = 'api help'

distance = 157
spam score = 67
title = 'api help'

distance = 158
spam score = 82
title = 'api help'

distance = 158
spam score = 68
title = 'memoryallocationmethods api help'

distance = 159
spam score = 86
title = 'api help'

distance = 181
spam score = 74
title = 'devsphere mapping framework api help'

distance = 181
spam score = 76
title = 'api help'

distance = 181
spam score = 63
title = 'junit api api help'

distance = 181
spam score = 70
title = 'api help'

distance = 181
spam score = 69
title = 'api help'

distance = 181
spam score = 76
title = 'api help'

distance = 181
spam score = 73
title = 'api help'

distance = 182
spam score = 62
title = 'api help'

distance = 182
spam score = 70
title = 'api help'

distance = 182
spam score = 69
title = 'api help'

distance = 198
spam score = 66
title = 'jexcelapi23 documentation api help'

distance = 198
spam score = 69
title = 'api help'

distance = 198
spam score = 77
title = 'api help'

distance = 198
spam score = 77
title = 'api help'

distance = 198
spam score = 72
title = 'opencyc api help'

distance = 198
spam score = 80
title = 'api for code from core servlets and javaserver pages api help'

distance = 198
spam score = 70
title = 'api help'

distance = 199
spam score = 85
title = 'api help'

distance = 200
spam score = 83
title = 'api help gap shell api'

distance = 200
spam score = 74
title = 'widgetlib api help'

distance = 227
spam score = 71
title = 'api help chart2d'

distance = 227
spam score = 88
title = 'api help cinvoke java binding'

distance = 228
spam score = 79
title = 'api help simlet api'

distance = 230
spam score = 73
title = 'ibmjcefipsprovider class documentation api help'

distance = 230
spam score = 71
title = 'api help'

distance = 231
spam score = 69
title = 'api help'

distance = 232
spam score = 74
title = 'api help'

distance = 232
spam score = 72
title = 'api help'

distance = 232
spam score = 66
title = 'api help'

distance = 232
spam score = 83
title = 'api help mathematica link api'

distance = 290
spam score = 81
title = 'transactionservice 140 api help'

distance = 291
spam score = 72
title = 'api help'

distance = 293
spam score = 73
title = 'distinct onc rpcxdr toolkit for java version 40 api help'

distance = 296
spam score = 79
title = 'adventnet web nms 5 api specification api help'

distance = 297
spam score = 79
title = 'rim device java library api help'

distance = 298
spam score = 85
title = 'physlets api help'

distance = 298
spam score = 80
title = 'physlets api help'

distance = 299
spam score = 78
title = 'new java pluglet api for mozilla api help'

distance = 301
spam score = 71
title = 'rim device java library api help'

distance = 302
spam score = 81
title = 'physlets api help'

distance = 527
spam score = 61
title = 'api help oracle security developer tools pki sdk ldap java api reference'

distance = 528
spam score = 57
title = 'api help oracle security developer tools pki sdk ocsp java api reference'

distance = 535
spam score = 76
title = 'api help brajucom java printf api specification'

distance = 547
spam score = 68
title = 'api help'

distance = 581
spam score = 67
title = 'api help tinyline utils v182 api specification'

distance = 658
spam score = 67
title = 'api help'

distance = 668
spam score = 75
title = 'api help'

distance = 676
spam score = 52
title = 'api help'

distance = 690
spam score = 53
title = 'api help'

distance = 693
spam score = 67
title = 'api help'

distance = 128
spam score = 49
title = 'jonasmessagedestinationruleset jonas 504 api'

distance = 129
spam score = 49
title = 'anonymoustypeqnameruleset jonas 504 api'

distance = 131
spam score = 51
title = 'securityroleruleset jonas 510m3 api'

distance = 132
spam score = 52
title = 'ejbrefruleset jonas 504 api'

distance = 134
spam score = 48
title = 'ejbrefruleset jonas 510m3 api'

distance = 135
spam score = 49
title = 'securityroleruleset jonas 504 api'

distance = 135
spam score = 50
title = 'relationshipsruleset jonas 504 api'

distance = 135
spam score = 55
title = 'activationconfigpropertyruleset jonas 504 api'

distance = 136
spam score = 63
title = 'methodpermissionruleset jonas 510m2 api'

distance = 136
spam score = 63
title = 'jdbcmappingruleset jonas 510m2 api'

distance = 136
spam score = 62
title = 'jonasresourceenvruleset jonas 510m2 api'

distance = 137
spam score = 54
title = 'containertransactionruleset jonas 504 api'

distance = 138
spam score = 51
title = 'jdbcmappingruleset jonas 504 api'

distance = 138
spam score = 61
title = 'usecalleridentityruleset jonas 510m2 api'

distance = 138
spam score = 51
title = 'securityidentityruleset jonas 504 api'

distance = 139
spam score = 47
title = 'jonassecurityruleset jonas 504 api'

distance = 140
spam score = 51
title = 'wsdlportruleset jonas 510m3 api'

distance = 141
spam score = 62
title = 'excludelistruleset jonas 510m2 api'

distance = 141
spam score = 51
title = 'jonasmessagedestinationrefruleset jonas 504 api'

distance = 142
spam score = 54
title = 'wsdlportruleset jonas 504 api'

distance = 152
spam score = 48
title = 'enterprisebeansruleset jonas 504 api'

distance = 154
spam score = 51
title = 'moduleruleset jonas 510m3 api'

distance = 154
spam score = 50
title = 'enventryruleset jonas 504 api'

distance = 154
spam score = 48
title = 'methodparamsruleset jonas 510m3 api'

distance = 154
spam score = 59
title = 'activationconfigpropertyruleset jonas 510m2 api'

distance = 155
spam score = 52
title = 'jonasenvironmentruleset jonas 510m3 api'

distance = 156
spam score = 47
title = 'jonasentityruleset jonas 504 api'

distance = 156
spam score = 52
title = 'cmpfieldruleset jonas 504 api'

distance = 157
spam score = 55
title = 'roottypeqnameruleset jonas 504 api'

distance = 157
spam score = 61
title = 'jonassecurityruleset jonas 510m2 api'

distance = 163
spam score = 63
title = 'jonasmessagedrivenruleset jonas 510m2 api'

distance = 164
spam score = 52
title = 'queryruleset jonas 504 api'

distance = 164
spam score = 48
title = 'messagedestinationrefruleset jonas 510m3 api'

distance = 164
spam score = 51
title = 'ejblocalrefruleset jonas 510m3 api'

distance = 165
spam score = 48
title = 'ejbrelationruleset jonas 504 api'

distance = 165
spam score = 48
title = 'ejbrelationshiproleruleset jonas 510m3 api'

distance = 167
spam score = 47
title = 'messagedestinationruleset jonas 510m3 api'

distance = 167
spam score = 49
title = 'jonassecurityrolemappingruleset jonas 510m3 api'

distance = 168
spam score = 49
title = 'jonasservletruleset jonas 510m3 api'

distance = 168
spam score = 53
title = 'cmrfieldruleset jonas 510m3 api'

distance = 175
spam score = 53
title = 'servletmappingruleset jonas 504 api'

distance = 175
spam score = 50
title = 'transportconfigruleset jonas 504 api'

distance = 177
spam score = 51
title = 'jonasentityruleset jonas 510m3 api'

distance = 178
spam score = 50
title = 'assemblydescriptorruleset jonas 510m3 api'

distance = 179
spam score = 46
title = 'jonassecuritymappingruleset jonas 510m3 api'

distance = 179
spam score = 64
title = 'adminobjectruleset jonas 510m2 api'

distance = 179
spam score = 55
title = 'activationspecruleset jonas 504 api'

distance = 179
spam score = 51
title = 'distributableruleset jonas 504 api'

distance = 179
spam score = 55
title = 'jonassessionruleset jonas 504 api'

distance = 182
spam score = 51
title = 'messagedrivendestinationruleset jonas 510m3 api'

distance = 190
spam score = 48
title = 'configpropertyruleset jonas 510m3 api'

distance = 192
spam score = 46
title = 'iconruleset jonas 510m3 api'

distance = 194
spam score = 62
title = 'outboundresourceadapterruleset jonas 510m2 api'

distance = 196
spam score = 52
title = 'authconstraintruleset jonas 510m3 api'

distance = 197
spam score = 49
title = 'tmconfigpropertyruleset jonas 510m3 api'

distance = 198
spam score = 44
title = 'licenseruleset jonas 510m3 api'

distance = 199
spam score = 51
title = 'connectiondefinitionruleset jonas 510m3 api'

distance = 200
spam score = 45
title = 'authenticationmechanismruleset jonas 510m3 api'

distance = 200
spam score = 53
title = 'jonaswebservicedescriptionruleset jonas 504 api'

distance = 201
spam score = 63
title = 'webservicesruleset jonas 510m2 api'

distance = 250
spam score = 48
title = 'serverruleset jonas 510m3 api'

distance = 253
spam score = 64
title = 'applicationruleset jonas 510m2 api'

distance = 253
spam score = 44
title = 'jonasapplicationruleset jonas 504 api'

distance = 255
spam score = 45
title = 'clusterdaemonruleset jonas 510m3 api'

distance = 255
spam score = 46
title = 'clusterruleset jonas 504 api'

distance = 256
spam score = 61
title = 'jonasclientruleset jonas 510m2 api'

distance = 263
spam score = 49
title = 'clusterruleset jonas 510m3 api'

distance = 281
spam score = 51
title = 'domainruleset jonas 504 api'

distance = 289
spam score = 49
title = 'discoveryruleset jonas 504 api'

distance = 299
spam score = 45
title = 'clusterarraypropertyruleset jonas 510m3 api'

distance = 338
spam score = 55
title = 'foreignkeyjdbcmappingruleset jonas java documentation'

distance = 338
spam score = 63
title = 'webruleset jonas java documentation'

distance = 340
spam score = 56
title = 'cmrfieldruleset jonas java documentation'

distance = 340
spam score = 62
title = 'moduleruleset jonas java documentation'

distance = 341
spam score = 56
title = 'jonasresourceruleset jonas java documentation'

distance = 341
spam score = 57
title = 'relationshiprolesourceruleset jonas java documentation'

distance = 342
spam score = 60
title = 'entityruleset jonas java documentation'

distance = 342
spam score = 57
title = 'messagedrivenruleset jonas java documentation'

distance = 342
spam score = 54
title = 'cmpfieldjdbcmappingruleset jonas java documentation'

distance = 343
spam score = 58
title = 'jonasmessagedestinationruleset jonas java documentation'

distance = 350
spam score = 59
title = 'securityentryruleset jonas java documentation'

distance = 351
spam score = 58
title = 'resourceadapterruleset jonas java documentation'

distance = 352
spam score = 59
title = 'jonasrunasmappingruleset jonas java documentation'

distance = 353
spam score = 62
title = 'activationspecruleset jonas java documentation'

distance = 353
spam score = 55
title = 'configpropertyruleset jonas java documentation'

distance = 354
spam score = 57
title = 'jonasmessagedrivenruleset jonas java documentation'

distance = 354
spam score = 55
title = 'jonasinitparamruleset jonas java documentation'

distance = 355
spam score = 62
title = 'requiredconfigpropertyruleset jonas java documentation'

distance = 355
spam score = 59
title = 'environmentruleset jonas java documentation'

distance = 356
spam score = 61
title = 'connectiondefinitionruleset jonas java documentation'

distance = 368
spam score = 57
title = 'jdsruleset jonas java documentation'

distance = 368
spam score = 57
title = 'jmemoryruleset jonas java documentation'

distance = 368
spam score = 55
title = 'sascontextruleset jonas java documentation'

distance = 396
spam score = 64
title = 'javawsdlmappingruleset jonas java documentation'

distance = 398
spam score = 60
title = 'applicationclientruleset jonas java documentation'

distance = 402
spam score = 61
title = 'jonasclientruleset jonas java documentation'

distance = 407
spam score = 62
title = 'applicationruleset jonas java documentation'

distance = 416
spam score = 60
title = 'jonasapplicationruleset jonas java documentation'

distance = 418
spam score = 60
title = 'ejbjarruleset jonas java documentation'

distance = 426
spam score = 58
title = 'locationruleset jonas java documentation'

distance = 1199
spam score = 56
title = 'sparsemisosceneruleset'

distance = 1212
spam score = 73
title = 'basetilesetruleset'

distance = 1227
spam score = 60
title = 'objecttilesetruleset'

distance = 1230
spam score = 53
title = 'uniformtilesetruleset'

distance = 1274
spam score = 56
title = 'nestableruleset'

distance = 1407
spam score = 77
title = 'jdigester jonas 504 api'

distance = 196
spam score = 69
title = ''

distance = 198
spam score = 66
title = ''

distance = 200
spam score = 71
title = ''

distance = 201
spam score = 71
title = ''

distance = 202
spam score = 73
title = ''

distance = 209
spam score = 69
title = ''

distance = 209
spam score = 70
title = ''

distance = 209
spam score = 74
title = ''

distance = 216
spam score = 79
title = ''

distance = 225
spam score = 73
title = ''

distance = 227
spam score = 64
title = ''

distance = 231
spam score = 68
title = ''

distance = 234
spam score = 70
title = ''

distance = 237
spam score = 72
title = ''

distance = 237
spam score = 65
title = ''

distance = 240
spam score = 67
title = ''

distance = 240
spam score = 66
title = ''

distance = 250
spam score = 72
title = ''

distance = 251
spam score = 71
title = ''

distance = 251
spam score = 72
title = ''

distance = 254
spam score = 65
title = ''

distance = 254
spam score = 65
title = ''

distance = 257
spam score = 64
title = ''

distance = 257
spam score = 67
title = ''

distance = 258
spam score = 61
title = ''

distance = 262
spam score = 71
title = ''

distance = 264
spam score = 71
title = ''

distance = 264
spam score = 65
title = ''

distance = 266
spam score = 71
title = ''

distance = 267
spam score = 76
title = ''

distance = 268
spam score = 61
title = ''

distance = 269
spam score = 66
title = ''

distance = 272
spam score = 73
title = ''

distance = 273
spam score = 76
title = ''

distance = 274
spam score = 70
title = ''

distance = 276
spam score = 78
title = ''

distance = 278
spam score = 64
title = ''

distance = 279
spam score = 63
title = ''

distance = 282
spam score = 65
title = ''

distance = 283
spam score = 65
title = ''

distance = 283
spam score = 67
title = ''

distance = 283
spam score = 64
title = ''

distance = 283
spam score = 72
title = ''

distance = 284
spam score = 63
title = ''

distance = 289
spam score = 70
title = ''

distance = 292
spam score = 82
title = ''

distance = 297
spam score = 70
title = ''

distance = 298
spam score = 76
title = ''

distance = 298
spam score = 66
title = ''

distance = 300
spam score = 71
title = ''

distance = 301
spam score = 78
title = ''

distance = 305
spam score = 65
title = ''

distance = 306
spam score = 68
title = ''

distance = 307
spam score = 64
title = ''

distance = 307
spam score = 67
title = ''

distance = 307
spam score = 64
title = ''

distance = 308
spam score = 69
title = ''

distance = 314
spam score = 74
title = ''

distance = 317
spam score = 61
title = ''

distance = 319
spam score = 75
title = ''

distance = 320
spam score = 73
title = ''

distance = 322
spam score = 70
title = ''

distance = 322
spam score = 73
title = ''

distance = 323
spam score = 70
title = ''

distance = 324
spam score = 68
title = ''

distance = 325
spam score = 72
title = ''

distance = 325
spam score = 68
title = ''

distance = 326
spam score = 67
title = ''

distance = 331
spam score = 63
title = ''

distance = 333
spam score = 73
title = ''

distance = 337
spam score = 60
title = ''

distance = 339
spam score = 77
title = ''

distance = 341
spam score = 59
title = ''

distance = 343
spam score = 78
title = ''

distance = 344
spam score = 66
title = ''

distance = 367
spam score = 73
title = ''

distance = 370
spam score = 73
title = ''

distance = 371
spam score = 69
title = ''

distance = 372
spam score = 67
title = ''

distance = 379
spam score = 70
title = ''

distance = 380
spam score = 70
title = ''

distance = 380
spam score = 70
title = ''

distance = 381
spam score = 68
title = ''

distance = 381
spam score = 68
title = ''

distance = 395
spam score = 76
title = ''

distance = 398
spam score = 61
title = ''

distance = 437
spam score = 67
title = ''

distance = 439
spam score = 60
title = ''

distance = 443
spam score = 53
title = ''

distance = 450
spam score = 55
title = ''

distance = 456
spam score = 50
title = ''

distance = 461
spam score = 49
title = ''

distance = 468
spam score = 61
title = ''

distance = 486
spam score = 53
title = ''

distance = 576
spam score = 56
title = ''

distance = 615
spam score = 57
title = ''

distance = 615
spam score = 54
title = ''

distance = 629
spam score = 51
title = ''

distance = 647
spam score = 59
title = ''

distance = 1785
spam score = 73
title = ''

distance = 264
spam score = 60
title = ''

distance = 272
spam score = 59
title = ''

distance = 283
spam score = 53
title = ''

distance = 302
spam score = 64
title = ''

distance = 371
spam score = 61
title = ''

distance = 372
spam score = 59
title = ''

distance = 378
spam score = 55
title = ''

distance = 399
spam score = 60
title = ''

distance = 427
spam score = 68
title = ''

distance = 476
spam score = 60
title = ''

distance = 500
spam score = 68
title = ''

distance = 539
spam score = 50
title = ''

distance = 251
spam score = 60
title = ''

distance = 262
spam score = 56
title = ''

distance = 263
spam score = 60
title = ''

distance = 264
spam score = 56
title = ''

distance = 266
spam score = 62
title = ''

distance = 271
spam score = 63
title = ''

distance = 274
spam score = 60
title = ''

distance = 276
spam score = 59
title = ''

distance = 276
spam score = 60
title = ''

distance = 324
spam score = 61
title = ''

distance = 336
spam score = 55
title = ''

distance = 347
spam score = 53
title = ''

distance = 349
spam score = 59
title = ''

distance = 356
spam score = 60
title = ''

distance = 381
spam score = 59
title = ''

distance = 384
spam score = 67
title = ''

distance = 455
spam score = 60
title = ''

distance = 475
spam score = 61
title = ''

distance = 486
spam score = 61
title = ''

distance = 487
spam score = 66
title = ''

distance = 498
spam score = 59
title = ''

distance = 550
spam score = 59
title = ''

distance = 573
spam score = 62
title = ''

distance = 604
spam score = 69
title = ''

distance = 625
spam score = 73
title = ''

distance = 23
spam score = 57
title = ''

distance = 29
spam score = 55
title = ''

distance = 29
spam score = 54
title = ''

distance = 29
spam score = 55
title = ''

distance = 39
spam score = 61
title = ''

distance = 39
spam score = 56
title = ''

distance = 46
spam score = 54
title = ''

distance = 50
spam score = 59
title = ''

distance = 66
spam score = 56
title = ''

distance = 81
spam score = 61
title = ''

distance = 200
spam score = 56
title = ''

distance = 213
spam score = 58
title = ''

distance = 220
spam score = 59
title = ''

distance = 250
spam score = 60
title = ''

distance = 280
spam score = 71
title = ''

distance = 304
spam score = 62
title = ''

distance = 324
spam score = 54
title = ''

distance = 665
spam score = 60
title = ''

distance = 716
spam score = 52
title = ''

distance = 845
spam score = 75
title = ''

distance = 853
spam score = 54
title = ''

distance = 894
spam score = 48
title = ''

distance = 208
spam score = 64
title = ''

distance = 209
spam score = 59
title = ''

distance = 226
spam score = 59
title = ''

distance = 231
spam score = 59
title = ''

distance = 236
spam score = 57
title = ''

distance = 236
spam score = 58
title = ''

distance = 245
spam score = 66
title = ''

distance = 260
spam score = 60
title = ''

distance = 267
spam score = 64
title = ''

distance = 268
spam score = 64
title = ''

distance = 269
spam score = 63
title = ''

distance = 269
spam score = 63
title = ''

distance = 273
spam score = 65
title = ''

distance = 273
spam score = 65
title = ''

distance = 278
spam score = 60
title = ''

distance = 290
spam score = 57
title = ''

distance = 295
spam score = 57
title = ''

distance = 301
spam score = 65
title = ''

distance = 302
spam score = 65
title = ''

distance = 303
spam score = 62
title = ''

distance = 305
spam score = 59
title = ''

distance = 306
spam score = 66
title = ''

distance = 314
spam score = 63
title = ''

distance = 316
spam score = 60
title = ''

distance = 317
spam score = 61
title = ''

distance = 321
spam score = 59
title = ''

distance = 324
spam score = 60
title = ''

distance = 326
spam score = 66
title = ''

distance = 328
spam score = 68
title = ''

distance = 335
spam score = 64
title = ''

distance = 342
spam score = 62
title = ''

distance = 354
spam score = 65
title = ''

distance = 355
spam score = 69
title = ''

distance = 362
spam score = 66
title = ''

distance = 364
spam score = 68
title = ''

distance = 365
spam score = 60
title = ''

distance = 371
spam score = 67
title = ''

distance = 389
spam score = 67
title = ''

distance = 390
spam score = 55
title = ''

distance = 407
spam score = 64
title = ''

distance = 409
spam score = 64
title = ''

distance = 416
spam score = 65
title = ''

distance = 421
spam score = 68
title = ''

distance = 421
spam score = 66
title = ''

distance = 437
spam score = 66
title = ''

distance = 440
spam score = 61
title = ''

distance = 445
spam score = 59
title = ''

distance = 459
spam score = 60
title = ''

distance = 479
spam score = 60
title = ''

distance = 499
spam score = 64
title = ''

distance = 527
spam score = 70
title = ''

distance = 533
spam score = 68
title = ''

distance = 640
spam score = 65
title = ''

distance = 1541
spam score = 64
title = ''

distance = 268
spam score = 47
title = ''

distance = 283
spam score = 43
title = ''

distance = 292
spam score = 46
title = ''

distance = 296
spam score = 45
title = ''

distance = 394
spam score = 42
title = ''

distance = 413
spam score = 44
title = ''

distance = 440
spam score = 36
title = ''

distance = 460
spam score = 50
title = ''

distance = 527
spam score = 46
title = ''

distance = 594
spam score = 46
title = ''

distance = 123
spam score = 61
title = ''

distance = 124
spam score = 62
title = ''

distance = 125
spam score = 56
title = ''

distance = 161
spam score = 61
title = ''

distance = 162
spam score = 62
title = ''

distance = 164
spam score = 49
title = ''

distance = 180
spam score = 59
title = ''

distance = 180
spam score = 56
title = ''

distance = 186
spam score = 53
title = ''

distance = 191
spam score = 53
title = ''

distance = 193
spam score = 51
title = ''

distance = 196
spam score = 51
title = ''

distance = 202
spam score = 54
title = ''

distance = 206
spam score = 56
title = ''

distance = 207
spam score = 55
title = ''

distance = 209
spam score = 56
title = ''

distance = 211
spam score = 64
title = ''

distance = 214
spam score = 57
title = ''

distance = 224
spam score = 62
title = ''

distance = 250
spam score = 55
title = ''

distance = 913
spam score = 64
title = ''

distance = 915
spam score = 70
title = ''

distance = 917
spam score = 72
title = ''

distance = 938
spam score = 83
title = ''

distance = 127
spam score = 72
title = 'xmldatefactory xmlbeans 200 documentation'

distance = 127
spam score = 54
title = 'xmldatefactory xmlbeans 220 documentation'

distance = 129
spam score = 55
title = 'xmldatefactory xmlbeans 210 documentation'

distance = 132
spam score = 64
title = 'xmlgyearfactory xmlbeans 220 documentation'

distance = 133
spam score = 53
title = 'xmlgyearfactory xmlbeans 210 documentation'

distance = 133
spam score = 72
title = 'xmlncnamefactory xmlbeans 220 documentation'

distance = 134
spam score = 75
title = 'xmlncnamefactory xmlbeans 200 documentation'

distance = 136
spam score = 55
title = 'xmlncnamefactory xmlbeans 240 documentation'

distance = 136
spam score = 67
title = 'xmldatetimefactory xmlbeans 200 documentation'

distance = 136
spam score = 53
title = 'xmlncnamefactory xmlbeans 210 documentation'

distance = 136
spam score = 54
title = 'xmlhexbinaryfactory xmlbeans 210 documentation'

distance = 136
spam score = 63
title = 'xmldatefactory xmlbeans 240 documentation'

distance = 137
spam score = 71
title = 'xmldatetimefactory xmlbeans 220 documentation'

distance = 137
spam score = 63
title = 'xmlhexbinaryfactory xmlbeans 220 documentation'

distance = 137
spam score = 71
title = 'xmlintfactory xmlbeans 220 documentation'

distance = 137
spam score = 63
title = 'xmlgyearfactory xmlbeans 240 documentation'

distance = 138
spam score = 58
title = 'xmlunsignedintfactory xmlbeans 200 documentation'

distance = 138
spam score = 52
title = 'xmlidfactory xmlbeans 210 documentation'

distance = 138
spam score = 63
title = 'xmlidfactory xmlbeans 240 documentation'

distance = 139
spam score = 54
title = 'xmldatetimefactory xmlbeans 210 documentation'

distance = 147
spam score = 51
title = 'xmlbooleanfactory xmlbeans 210 documentation'

distance = 147
spam score = 54
title = 'xmlunsignedshortfactory xmlbeans 200 documentation'

distance = 147
spam score = 63
title = 'xmlintegerfactory xmlbeans 240 documentation'

distance = 147
spam score = 74
title = 'xmllanguagefactory xmlbeans 240 documentation'

distance = 147
spam score = 70
title = 'xmlnegativeintegerfactory xmlbeans 220 documentation'

distance = 147
spam score = 69
title = 'xmlnamefactory xmlbeans 240 documentation'

distance = 147
spam score = 71
title = 'xmldatetimefactory xmlbeans 240 documentation'

distance = 147
spam score = 66
title = 'xmlnotationfactory xmlbeans 200 documentation'

distance = 148
spam score = 57
title = 'xmlshortfactory xmlbeans 240 documentation'

distance = 148
spam score = 56
title = 'xmlshortfactory xmlbeans 220 documentation'

distance = 153
spam score = 66
title = 'xmlnmtokenfactory xmlbeans 200 documentation'

distance = 153
spam score = 67
title = 'xmlfloatfactory xmlbeans 240 documentation'

distance = 153
spam score = 63
title = 'xmlentitiesfactory xmlbeans 220 documentation'

distance = 153
spam score = 65
title = 'xmlfloatfactory xmlbeans 200 documentation'

distance = 154
spam score = 56
title = 'xmltimefactory xmlbeans 220 documentation'

distance = 154
spam score = 54
title = 'xmlentitiesfactory xmlbeans 210 documentation'

distance = 154
spam score = 52
title = 'xmltokenfactory xmlbeans 220 documentation'

distance = 154
spam score = 63
title = 'xmldoublefactory xmlbeans 240 documentation'

distance = 154
spam score = 73
title = 'xmldurationfactory xmlbeans 200 documentation'

distance = 154
spam score = 63
title = 'xmlbytefactory xmlbeans 240 documentation'

distance = 164
spam score = 64
title = 'xmlidreffactory xmlbeans 200 documentation'

distance = 165
spam score = 54
title = 'xmlidrefsfactory xmlbeans 220 documentation'

distance = 165
spam score = 73
title = 'xmlentityfactory xmlbeans 200 documentation'

distance = 165
spam score = 67
title = 'xmlanysimpletypefactory xmlbeans 240 documentation'

distance = 166
spam score = 53
title = 'xmlgmonthfactory xmlbeans 210 documentation'

distance = 166
spam score = 75
title = 'xmlgmonthfactory xmlbeans 200 documentation'

distance = 166
spam score = 66
title = 'xmlstringfactory xmlbeans 200 documentation'

distance = 167
spam score = 53
title = 'xmlidreffactory xmlbeans 210 documentation'

distance = 167
spam score = 52
title = 'xmlstringfactory xmlbeans 220 documentation'

distance = 168
spam score = 66
title = 'xmlidreffactory xmlbeans 220 documentation'

distance = 246
spam score = 66
title = 'xmlnormalizedstringfactory xmlbeans 104rc1 documentation'

distance = 247
spam score = 70
title = 'xmlintfactory xmlbeans 104rc1 documentation'

distance = 248
spam score = 57
title = 'xmldatetimefactory xmlbeans 104rc1 documentation'

distance = 248
spam score = 64
title = 'xmlgyearmonthfactory xmlbeans 104rc1 documentation'

distance = 249
spam score = 68
title = 'xmlhexbinaryfactory xmlbeans 104rc1 documentation'

distance = 249
spam score = 68
title = 'xmlbytefactory xmlbeans 104rc1 documentation'

distance = 249
spam score = 70
title = 'xmldoublefactory xmlbeans 104rc1 documentation'

distance = 249
spam score = 63
title = 'xmlbooleanfactory xmlbeans 104rc1 documentation'

distance = 249
spam score = 58
title = 'xmlintegerfactory xmlbeans 104rc1 documentation'

distance = 249
spam score = 72
title = 'xmlidfactory xmlbeans 104rc1 documentation'

distance = 321
spam score = 68
title = 'xmlbase64binaryfactory xmlbeans 104rc1 documentation'

distance = 338
spam score = 54
title = 'xmllongfactory xmlbeans api reference'

distance = 498
spam score = 46
title = 'algorithmtypefactory'

distance = 502
spam score = 48
title = 'assigneetypetypefactory'

distance = 513
spam score = 47
title = 'worksubstituteruletypefactory'

distance = 516
spam score = 47
title = 'assigneelisttypefactory'

distance = 518
spam score = 47
title = 'taskdataxmldocumentfactory'

distance = 519
spam score = 47
title = 'daterangetypefactory'

distance = 521
spam score = 46
title = 'taskinfoxmldocumentfactory'

distance = 525
spam score = 67
title = 'brokeriddocumentfactory naradabrokering documentation release332'

distance = 552
spam score = 53
title = 'bufferedmessageresponsedocumentfactory naradabrokering documentation release332'

distance = 552
spam score = 51
title = 'matchchoicetypefactory naradabrokering documentation release332'

distance = 554
spam score = 47
title = 'relationshipfactory naradabrokering documentation release332'

distance = 554
spam score = 69
title = 'brokerinformationdocumentfactory naradabrokering documentation release332'

distance = 555
spam score = 72
title = 'expirationtypefactory naradabrokering documentation release332'

distance = 555
spam score = 46
title = 'replytodocumentfactory naradabrokering documentation release332'

distance = 556
spam score = 50
title = 'replyaftertypefactory naradabrokering documentation release332'

distance = 556
spam score = 50
title = 'replytodocumentfactory naradabrokering documentation release332'

distance = 556
spam score = 68
title = 'filtertypefactory naradabrokering documentation release332'

distance = 557
spam score = 48
title = 'relationshipfactory naradabrokering documentation release332'

distance = 563
spam score = 51
title = 'policyattachmentdocumentfactory naradabrokering documentation release332'

distance = 563
spam score = 51
title = 'servicenametypefactory naradabrokering documentation release332'

distance = 564
spam score = 47
title = 'headertypefactory naradabrokering documentation release332'

distance = 564
spam score = 49
title = 'todocumentfactory naradabrokering documentation release332'

distance = 564
spam score = 47
title = 'midtypefactory naradabrokering documentation release332'

distance = 565
spam score = 50
title = 'handshaketypefactory naradabrokering documentation release332'

distance = 565
spam score = 48
title = 'handshaketypefactory naradabrokering documentation release332'

distance = 565
spam score = 58
title = 'attributedqnamefactory naradabrokering documentation release332'

distance = 565
spam score = 46
title = 'replyaftertypefactory naradabrokering documentation release332'

distance = 566
spam score = 51
title = 'portreferencetypefactory naradabrokering documentation release332'

distance = 575
spam score = 64
title = 'policyattachmentdocumentfactory naradabrokering documentation release332'

distance = 575
spam score = 54
title = 'referenceparameterstypefactory naradabrokering documentation release332'

distance = 576
spam score = 50
title = 'replyafterdocumentfactory naradabrokering documentation release332'

distance = 576
spam score = 51
title = 'replyafterdocumentfactory naradabrokering documentation release332'

distance = 576
spam score = 53
title = 'referenceparameterstypefactory naradabrokering documentation release332'

distance = 576
spam score = 46
title = 'idattributefactory naradabrokering documentation release332'

distance = 581
spam score = 64
title = 'ackrequestedtypefactory naradabrokering documentation release332'

distance = 582
spam score = 51
title = 'timestamptypefactory naradabrokering documentation release332'

distance = 582
spam score = 52
title = 'timestamptypefactory naradabrokering documentation release332'

distance = 583
spam score = 65
title = 'attributeddatetimefactory naradabrokering documentation release332'

distance = 230
spam score = 67
title = ''

distance = 232
spam score = 65
title = ''

distance = 239
spam score = 69
title = ''

distance = 240
spam score = 64
title = ''

distance = 240
spam score = 68
title = ''

distance = 243
spam score = 68
title = ''

distance = 250
spam score = 66
title = ''

distance = 250
spam score = 69
title = ''

distance = 251
spam score = 69
title = ''

distance = 271
spam score = 71
title = ''

distance = 276
spam score = 72
title = ''

distance = 277
spam score = 70
title = ''

distance = 279
spam score = 70
title = ''

distance = 281
spam score = 68
title = ''

distance = 283
spam score = 69
title = ''

distance = 284
spam score = 69
title = ''

distance = 287
spam score = 67
title = ''

distance = 291
spam score = 71
title = ''

distance = 296
spam score = 68
title = ''

distance = 299
spam score = 71
title = ''

distance = 307
spam score = 65
title = ''

distance = 308
spam score = 67
title = ''

distance = 310
spam score = 67
title = ''

distance = 311
spam score = 74
title = ''

distance = 316
spam score = 68
title = ''

distance = 316
spam score = 73
title = ''

distance = 316
spam score = 71
title = ''

distance = 322
spam score = 68
title = ''

distance = 324
spam score = 72
title = ''

distance = 325
spam score = 70
title = ''

distance = 325
spam score = 66
title = ''

distance = 325
spam score = 67
title = ''

distance = 332
spam score = 75
title = ''

distance = 332
spam score = 72
title = ''

distance = 340
spam score = 58
title = ''

distance = 343
spam score = 70
title = ''

distance = 359
spam score = 55
title = ''

distance = 375
spam score = 55
title = ''

distance = 396
spam score = 52
title = ''

distance = 398
spam score = 51
title = ''

distance = 401
spam score = 52
title = ''

distance = 404
spam score = 61
title = ''

distance = 407
spam score = 50
title = ''

distance = 408
spam score = 52
title = ''

distance = 408
spam score = 61
title = ''

distance = 425
spam score = 47
title = ''

distance = 432
spam score = 74
title = ''

distance = 437
spam score = 55
title = ''

distance = 442
spam score = 53
title = ''

distance = 442
spam score = 68
title = ''

distance = 446
spam score = 75
title = ''

distance = 446
spam score = 44
title = ''

distance = 446
spam score = 71
title = ''

distance = 447
spam score = 74
title = ''

distance = 447
spam score = 68
title = ''

distance = 447
spam score = 60
title = ''

distance = 451
spam score = 75
title = ''

distance = 454
spam score = 81
title = ''

distance = 455
spam score = 73
title = ''

distance = 459
spam score = 74
title = ''

distance = 461
spam score = 61
title = ''

distance = 462
spam score = 73
title = ''

distance = 462
spam score = 68
title = ''

distance = 464
spam score = 85
title = ''

distance = 467
spam score = 52
title = ''

distance = 469
spam score = 73
title = ''

distance = 469
spam score = 62
title = ''

distance = 470
spam score = 73
title = ''

distance = 470
spam score = 74
title = ''

distance = 471
spam score = 77
title = ''

distance = 474
spam score = 71
title = ''

distance = 475
spam score = 74
title = ''

distance = 481
spam score = 77
title = ''

distance = 482
spam score = 53
title = ''

distance = 483
spam score = 48
title = ''

distance = 501
spam score = 85
title = ''

distance = 516
spam score = 60
title = ''

distance = 526
spam score = 72
title = ''

distance = 531
spam score = 49
title = ''

distance = 534
spam score = 55
title = ''

distance = 535
spam score = 75
title = ''

distance = 537
spam score = 79
title = ''

distance = 538
spam score = 77
title = ''

distance = 541
spam score = 78
title = ''

distance = 549
spam score = 74
title = ''

distance = 553
spam score = 76
title = ''

distance = 554
spam score = 75
title = ''

distance = 571
spam score = 72
title = ''

distance = 636
spam score = 63
title = ''

distance = 642
spam score = 57
title = ''

distance = 646
spam score = 56
title = ''

distance = 650
spam score = 56
title = ''

distance = 672
spam score = 75
title = ''

distance = 676
spam score = 63
title = ''

distance = 683
spam score = 51
title = ''

distance = 1216
spam score = 57
title = ''

distance = 1229
spam score = 64
title = ''

distance = 97
spam score = 69
title = 'uses of class weblogicapachehtmldomhtmllinkelementimpl weblogic server 103 api reference'

distance = 99
spam score = 59
title = 'uses of class weblogicapachehtmldomhtmllielementimpl weblogic server 103 api reference'

distance = 103
spam score = 68
title = 'uses of class weblogicapachehtmldomhtmlmenuelementimpl weblogic server 103 api reference'

distance = 108
spam score = 58
title = 'uses of class weblogicapachehtmldomhtmlparamelementimpl weblogic server 103 api reference'

distance = 108
spam score = 61
title = 'uses of class weblogicapachehtmldomhtmldirectoryelementimpl weblogic server 103 api reference'

distance = 110
spam score = 60
title = 'uses of class weblogicapachehtmldomhtmlhtmlelementimpl weblogic server 103 api reference'

distance = 110
spam score = 63
title = 'uses of class weblogicapachehtmldomhtmldlistelementimpl weblogic server 103 api reference'

distance = 111
spam score = 65
title = 'uses of class weblogicapachehtmldomhtmllabelelementimpl weblogic server 103 api reference'

distance = 111
spam score = 63
title = 'uses of class weblogicapachehtmldomhtmlimageelementimpl weblogic server 103 api reference'

distance = 113
spam score = 61
title = 'uses of class weblogicapachehtmldomhtmlfieldsetelementimpl weblogic server 103 api reference'

distance = 114
spam score = 59
title = 'uses of class weblogicapachehtmldomhtmlanchorelementimpl weblogic server 103 api reference'

distance = 115
spam score = 59
title = 'uses of class weblogicapachehtmldomhtmliframeelementimpl weblogic server 103 api reference'

distance = 115
spam score = 68
title = 'uses of class weblogicapachehtmldomhtmlbaseelementimpl weblogic server 103 api reference'

distance = 116
spam score = 67
title = 'uses of class weblogicapachehtmldomhtmlformelementimpl weblogic server 103 api reference'

distance = 118
spam score = 69
title = 'uses of class weblogicapachehtmldomhtmlselectelementimpl weblogic server 103 api reference'

distance = 119
spam score = 59
title = 'uses of class weblogicapachehtmldomhtmlhrelementimpl weblogic server 103 api reference'

distance = 119
spam score = 67
title = 'uses of class weblogicapachehtmldomhtmlappletelementimpl weblogic server 103 api reference'

distance = 119
spam score = 56
title = 'uses of class weblogicapachehtmldomhtmlisindexelementimpl weblogic server 103 api reference'

distance = 120
spam score = 64
title = 'uses of class weblogicapachehtmldomhtmlpreelementimpl weblogic server 103 api reference'

distance = 120
spam score = 63
title = 'uses of class weblogicapachehtmldomhtmlareaelementimpl weblogic server 103 api reference'

distance = 121
spam score = 61
title = 'uses of class weblogicapachehtmldomhtmlobjectelementimpl weblogic server 103 api reference'

distance = 121
spam score = 57
title = 'uses of class weblogicapachehtmldomhtmlquoteelementimpl weblogic server 103 api reference'

distance = 121
spam score = 67
title = 'uses of class weblogicapachehtmldomhtmldivelementimpl weblogic server 103 api reference'

distance = 122
spam score = 65
title = 'uses of class weblogicapachehtmldomhtmlulistelementimpl weblogic server 103 api reference'

distance = 122
spam score = 68
title = 'uses of class weblogicapachehtmldomhtmlheadingelementimpl weblogic server 103 api reference'

distance = 122
spam score = 58
title = 'uses of class weblogicapachehtmldomhtmloptionelementimpl weblogic server 103 api reference'

distance = 123
spam score = 57
title = 'uses of class weblogicapachehtmldomhtmltablerowelementimpl weblogic server 103 api reference'

distance = 123
spam score = 60
title = 'uses of class weblogicapachehtmldomhtmldomimplementationimpl weblogic server 103 api reference'

distance = 124
spam score = 57
title = 'uses of class weblogicapachehtmldomhtmlheadelementimpl weblogic server 103 api reference'

distance = 124
spam score = 64
title = 'uses of class weblogicapachehtmldomhtmlscriptelementimpl weblogic server 103 api reference'

distance = 125
spam score = 66
title = 'uses of class weblogicapachehtmldomhtmlolistelementimpl weblogic server 103 api reference'

distance = 125
spam score = 60
title = 'uses of class weblogicapachehtmldomhtmlbuttonelementimpl weblogic server 103 api reference'

distance = 125
spam score = 61
title = 'uses of class weblogicapachehtmldomhtmlbasefontelementimpl weblogic server 103 api reference'

distance = 126
spam score = 60
title = 'uses of class weblogicapachehtmldomhtmlmodelementimpl weblogic server 103 api reference'

distance = 126
spam score = 59
title = 'uses of class weblogicapachehtmldomhtmltablecaptionelementimpl weblogic server 103 api reference'

distance = 126
spam score = 67
title = 'uses of class weblogicapachehtmldomhtmlparagraphelementimpl weblogic server 103 api reference'

distance = 127
spam score = 64
title = 'uses of class weblogicapachehtmldomhtmltableelementimpl weblogic server 103 api reference'

distance = 128
spam score = 59
title = 'uses of class weblogicapachehtmldomhtmlbrelementimpl weblogic server 103 api reference'

distance = 128
spam score = 58
title = 'uses of class weblogicapachehtmldomhtmlfontelementimpl weblogic server 103 api reference'

distance = 129
spam score = 59
title = 'uses of class weblogicapachehtmldomhtmllegendelementimpl weblogic server 103 api reference'

distance = 130
spam score = 59
title = 'uses of class weblogicapachehtmldomhtmltextareaelementimpl weblogic server 103 api reference'

distance = 133
spam score = 57
title = 'uses of class weblogicapachehtmldomhtmlmapelementimpl weblogic server 103 api reference'

distance = 134
spam score = 60
title = 'uses of class weblogicapachehtmldomhtmlframesetelementimpl weblogic server 103 api reference'

distance = 136
spam score = 60
title = 'uses of class weblogicapachehtmldomhtmlbuilder weblogic server 103 api reference'

distance = 136
spam score = 57
title = 'uses of class weblogicapachehtmldomhtmlstyleelementimpl weblogic server 103 api reference'

distance = 137
spam score = 68
title = 'uses of class weblogicapachehtmldomhtmltablecellelementimpl weblogic server 103 api reference'

distance = 138
spam score = 69
title = 'uses of class weblogicapachehtmldomhtmltitleelementimpl weblogic server 103 api reference'

distance = 141
spam score = 60
title = 'uses of class weblogicapachehtmldomnamenodelistimpl weblogic server 103 api reference'

distance = 223
spam score = 54
title = 'uses of class weblogicapachehtmldomhtmlinputelementimpl weblogic server 103 api reference'

distance = 227
spam score = 56
title = 'uses of class weblogicapachehtmldomhtmlmetaelementimpl weblogic server 103 api reference'

distance = 235
spam score = 55
title = 'uses of class weblogicapachehtmldomhtmloptgroupelementimpl weblogic server 103 api reference'

distance = 238
spam score = 56
title = 'uses of class weblogicapachehtmldomhtmlframeelementimpl weblogic server 103 api reference'

distance = 241
spam score = 55
title = 'uses of class weblogicapachehtmldomhtmltablecolelementimpl weblogic server 103 api reference'

distance = 279
spam score = 48
title = 'uses of class weblogicapachewmldomwmlmetaelementimpl weblogic server 103 api reference'

distance = 279
spam score = 49
title = 'uses of class weblogicapachewmldomwmlimgelementimpl weblogic server 103 api reference'

distance = 283
spam score = 48
title = 'uses of class weblogicapachewmldomwmlgoelementimpl weblogic server 103 api reference'

distance = 302
spam score = 49
title = 'uses of class weblogicapachewmldomwmlselectelementimpl weblogic server 103 api reference'

distance = 304
spam score = 48
title = 'uses of class weblogicapachewmldomwmlfieldsetelementimpl weblogic server 103 api reference'

distance = 405
spam score = 72
title = 'uses of package weblogicapachehtmldom weblogic server 103 api reference'

distance = 459
spam score = 54
title = 'uses of package weblogicapachewmldom weblogic server 103 api reference'

distance = 472
spam score = 50
title = 'uses of interface weblogicapachewmlwmldomimplementation weblogic server 103 api reference'

distance = 473
spam score = 51
title = 'uses of interface weblogicapachewmlwmlstrongelement weblogic server 103 api reference'

distance = 474
spam score = 51
title = 'uses of interface weblogicapachewmlwmltemplateelement weblogic server 103 api reference'

distance = 477
spam score = 52
title = 'uses of interface weblogicapachewmlwmloptionelement weblogic server 103 api reference'

distance = 482
spam score = 53
title = 'uses of interface weblogicapachewmlwmlbrelement weblogic server 103 api reference'

distance = 482
spam score = 50
title = 'uses of interface weblogicapachewmlwmlmetaelement weblogic server 103 api reference'

distance = 482
spam score = 55
title = 'uses of interface weblogicapachewmlwmlrefreshelement weblogic server 103 api reference'

distance = 483
spam score = 50
title = 'uses of interface weblogicapachewmlwmlimgelement weblogic server 103 api reference'

distance = 486
spam score = 52
title = 'uses of interface weblogicapachewmlwmltdelement weblogic server 103 api reference'

distance = 487
spam score = 50
title = 'uses of interface weblogicapachewmlwmlinputelement weblogic server 103 api reference'

distance = 488
spam score = 51
title = 'uses of interface weblogicapachewmlwmltrelement weblogic server 103 api reference'

distance = 488
spam score = 50
title = 'uses of interface weblogicapachewmlwmlgoelement weblogic server 103 api reference'

distance = 491
spam score = 51
title = 'uses of interface weblogicapachewmlwmlanchorelement weblogic server 103 api reference'

distance = 491
spam score = 53
title = 'uses of interface weblogicapachewmlwmlsmallelement weblogic server 103 api reference'

distance = 492
spam score = 55
title = 'uses of interface weblogicapachewmlwmlbigelement weblogic server 103 api reference'

distance = 494
spam score = 53
title = 'uses of interface weblogicapachewmlwmlaelement weblogic server 103 api reference'

distance = 496
spam score = 50
title = 'uses of interface weblogicapachewmlwmldocument weblogic server 103 api reference'

distance = 498
spam score = 50
title = 'uses of interface weblogicapachewmlwmlpelement weblogic server 103 api reference'

distance = 500
spam score = 49
title = 'uses of interface weblogicapachewmlwmloptgroupelement weblogic server 103 api reference'

distance = 502
spam score = 49
title = 'uses of interface weblogicapachewmlwmluelement weblogic server 103 api reference'

distance = 502
spam score = 52
title = 'uses of interface weblogicapachewmlwmlemelement weblogic server 103 api reference'

distance = 503
spam score = 48
title = 'uses of interface weblogicapachewmlwmlnoopelement weblogic server 103 api reference'

distance = 506
spam score = 51
title = 'uses of interface weblogicapachewmlwmlheadelement weblogic server 103 api reference'

distance = 506
spam score = 53
title = 'uses of interface weblogicapachewmlwmltableelement weblogic server 103 api reference'

distance = 508
spam score = 51
title = 'uses of interface weblogicapachewmlwmlselectelement weblogic server 103 api reference'

distance = 509
spam score = 51
title = 'uses of interface weblogicapachewmlwmlcardelement weblogic server 103 api reference'

distance = 510
spam score = 48
title = 'uses of interface weblogicapachewmlwmlwmlelement weblogic server 103 api reference'

distance = 510
spam score = 48
title = 'uses of interface weblogicapachewmlwmlfieldsetelement weblogic server 103 api reference'

distance = 516
spam score = 52
title = 'uses of interface weblogicapachewmlwmlaccesselement weblogic server 103 api reference'

distance = 521
spam score = 54
title = 'uses of interface weblogicapachewmlwmlsetvarelement weblogic server 103 api reference'

distance = 567
spam score = 51
title = 'uses of package weblogicapachewmldom weblogic server 103 api reference'

distance = 647
spam score = 66
title = 'uses of interface weblogicapachehtmldomhtmlformcontrol weblogic server 103 api reference'

distance = 823
spam score = 70
title = 'weblogicapachewml class hierarchy weblogic server 103 api reference'

distance = 828
spam score = 77
title = 'htmlformcontrol weblogic server 103 api reference'

distance = 965
spam score = 64
title = 'wmldomimplementation weblogic server 103 api reference'

distance = 979
spam score = 47
title = 'uses of class weblogicapachewmldomwmldocumentimpl weblogic server 103 api reference'

distance = 1025
spam score = 55
title = 'uses of class weblogicapachehtmldomhtmldocumentimpl weblogic server 103 api reference'

distance = 1154
spam score = 47
title = 'weblogic server 70 api reference package weblogicapachehtmldom'

distance = 1216
spam score = 63
title = 'domserializer weblogic server 103 api reference'

distance = 1281
spam score = 58
title = 'uses of class weblogicapachehtmldomhtmlelementimpl weblogic server 103 api reference'

distance = 1289
spam score = 51
title = 'uses of class weblogicapachewmldomwmlelementimpl weblogic server 103 api reference'

distance = 1325
spam score = 75
title = 'uses of package weblogicapachewml weblogic server 103 api reference'

distance = 1395
spam score = 74
title = 'weblogicapachewml weblogic server 103 api reference'

distance = 430
spam score = 68
title = ''

distance = 430
spam score = 72
title = ''

distance = 471
spam score = 68
title = ''

distance = 523
spam score = 69
title = ''

distance = 523
spam score = 72
title = ''

distance = 548
spam score = 71
title = ''

distance = 122
spam score = 45
title = 'uses of class netclackrouternetutilsnetutils clack v16 api specification'

distance = 122
spam score = 44
title = 'uses of class netclackrouternetutilsnetutils clack v16 api specification'

distance = 123
spam score = 46
title = 'uses of class netclackrouternetutilsnetutils clack v16 api specification'

distance = 142
spam score = 50
title = 'uses of package netclackroutertutorial clack v16 api specification'

distance = 148
spam score = 45
title = 'uses of package netclackroutertutorial clack v16 api specification'

distance = 162
spam score = 42
title = 'uses of class netclackrouterapplicationshow clack v16 api specification'

distance = 167
spam score = 42
title = 'uses of class netclackrouterapplicationshow clack v16 api specification'

distance = 169
spam score = 45
title = 'uses of class netclackrouterapplicationshow clack v16 api specification'

distance = 186
spam score = 49
title = 'uses of class netclackroutererrorerrorutils clack v16 api specification'

distance = 186
spam score = 43
title = 'uses of class netclackrouteractionseditdelete clack v16 api specification'

distance = 186
spam score = 45
title = 'uses of class netclackrouteractionsfileexportpng clack v16 api specification'

distance = 188
spam score = 49
title = 'uses of class netclackrouteractionshelpabout clack v16 api specification'

distance = 188
spam score = 60
title = 'uses of package netclackroutertutorial clack v16 api specification'

distance = 188
spam score = 48
title = 'uses of class netclackrouteractionsabstractactionlistcellcolor clack v16 api specification'

distance = 189
spam score = 53
title = 'uses of class netclackrouteractionshelphomepage clack v16 api specification'

distance = 189
spam score = 44
title = 'uses of class netclackrouteractionsfileexportgif clack v16 api specification'

distance = 190
spam score = 43
title = 'uses of class netclackroutererrorerrorutils clack v16 api specification'

distance = 190
spam score = 51
title = 'uses of class netclackrouteractionseditcut clack v16 api specification'

distance = 190
spam score = 47
title = 'uses of class netclackrouteractionseditcut clack v16 api specification'

distance = 191
spam score = 44
title = 'uses of class netclackrouteractionsfileexportpng clack v16 api specification'

distance = 231
spam score = 45
title = 'uses of class netclackroutertutorialclackassignment clack v16 api specification'

distance = 231
spam score = 47
title = 'uses of class netclackrouteretherealetherealpacket clack v16 api specification'

distance = 232
spam score = 45
title = 'uses of class netclackrouterroutingospfroutingentry clack v16 api specification'

distance = 232
spam score = 45
title = 'uses of class netclackrouterguiclackloader clack v16 api specification'

distance = 232
spam score = 42
title = 'uses of class netclackrouterpacketssshpacket clack v16 api specification'

distance = 233
spam score = 44
title = 'uses of class netclackrouteractionsclackopenassignment clack v16 api specification'

distance = 233
spam score = 45
title = 'uses of package netclackrouterexample clack v16 api specification'

distance = 234
spam score = 46
title = 'uses of class netclackrouterexamplesourcetrackerpopup clack v16 api specification'

distance = 234
spam score = 45
title = 'uses of class netclackrouterpropertyviewriproutingrefpview clack v16 api specification'

distance = 234
spam score = 40
title = 'uses of class netclackrouterpropertyviewiproutelookuppopup clack v16 api specification'

distance = 275
spam score = 46
title = 'uses of class netclackrouteractionsfilesaveallclackfilefilter clack v16 api specification'

distance = 276
spam score = 44
title = 'uses of class netclackroutertopologygraphtopovirtualhostcell clack v16 api specification'

distance = 276
spam score = 47
title = 'uses of class netclackroutertopologycreatectoposerializer clack v16 api specification'

distance = 277
spam score = 48
title = 'uses of class netclackroutertopologycoreautogentopoxml clack v16 api specification'

distance = 278
spam score = 46
title = 'uses of class netclackroutertopologycoretopopopup clack v16 api specification'

distance = 278
spam score = 38
title = 'uses of class netclackroutercomponentextensionudpsource clack v16 api specification'

distance = 278
spam score = 46
title = 'uses of class netclackroutertopologycoretopoparser clack v16 api specification'

distance = 280
spam score = 44
title = 'uses of class netclackrouterprotocolvnsprotocolcharcoder clack v16 api specification'

distance = 280
spam score = 44
title = 'uses of class netclackrouterprotocolcommandsvnsinvalidprotocolcommandexception clack v16 api specification'

distance = 280
spam score = 46
title = 'uses of class netclackrouterprotocolcommandsvnsopenprotocolcommand clack v16 api specification'

distance = 309
spam score = 43
title = 'uses of class netclackroutercomponentsimplerouterarpdemux clack v16 api specification'

distance = 310
spam score = 44
title = 'uses of class netclackroutercomponentsimpleroutericmpdemux clack v16 api specification'

distance = 311
spam score = 43
title = 'uses of class netclackrouterguiutilopenrouterdialog clack v16 api specification'

distance = 311
spam score = 48
title = 'uses of class netclackrouteractionsfilesaveclackfilefilter clack v16 api specification'

distance = 311
spam score = 47
title = 'uses of class netclackroutercomponentsimpleroutericmpportunreach clack v16 api specification'

distance = 311
spam score = 42
title = 'uses of class netclackroutercomponentextensionsipredirector clack v16 api specification'

distance = 311
spam score = 44
title = 'uses of class netclackroutercomponentsimplerouteretherstrip clack v16 api specification'

distance = 311
spam score = 45
title = 'uses of class netclackrouterjgraphutilsbrowserlauncher clack v16 api specification'

distance = 312
spam score = 45
title = 'uses of class netclackroutercomponentsimpleroutericmpecho clack v16 api specification'

distance = 312
spam score = 45
title = 'uses of class netclackrouterguiclackframeworkappcloser clack v16 api specification'

distance = 339
spam score = 43
title = 'uses of class netclackrouteretherealparserdefaultparser clack v16 api specification'

distance = 340
spam score = 39
title = 'uses of class netclackrouteretherealparserlinkstatepacketparser clack v16 api specification'

distance = 341
spam score = 40
title = 'uses of class netclackrouteretherealparseripv4parser clack v16 api specification'

distance = 343
spam score = 40
title = 'uses of class netclackrouteretherealparserripupdateparser clack v16 api specification'

distance = 344
spam score = 47
title = 'uses of class netclackrouterjgraphpadgpattributemap clack v16 api specification'

distance = 345
spam score = 44
title = 'uses of class netclackrouterjgraphpadresourcestranslator clack v16 api specification'

distance = 347
spam score = 47
title = 'uses of class netclackrouteractionsviewscalezoomout clack v16 api specification'

distance = 348
spam score = 44
title = 'uses of class netclackrouterjgraphpadgpattributemap clack v16 api specification'

distance = 348
spam score = 42
title = 'uses of class netclackrouteretherealparserftpparser clack v16 api specification'

distance = 348
spam score = 46
title = 'uses of class netclackrouteractionsfileprint clack v16 api specification'

distance = 420
spam score = 47
title = 'uses of class netclackrouteractionsfileexportjpg clack v16 api specification'

distance = 425
spam score = 50
title = 'uses of class netclackrouteractionsfileexportjpg clack v16 api specification'

distance = 431
spam score = 57
title = 'uses of class netclackrouteractionsabstractactiontoggle clack v16 api specification'

distance = 432
spam score = 62
title = 'uses of class netclackrouteractionsabstractactionlistcell clack v16 api specification'

distance = 436
spam score = 50
title = 'uses of package netclackrouterprotocolcommands clack v16 api specification'

distance = 436
spam score = 38
title = 'uses of class netclackrouteretherealparseripv4parser clack v16 api specification'

distance = 437
spam score = 37
title = 'uses of class netclackrouteretherealparserlinkstatepacketparser clack v16 api specification'

distance = 438
spam score = 50
title = 'uses of package netclackrouterprotocolcommands clack v16 api specification'

distance = 439
spam score = 44
title = 'uses of class netclackrouterpropertyviewdatahandlertablehandlertablemodel clack v16 api specification'

distance = 443
spam score = 51
title = 'uses of class netclackrouteractionsabstractactiontoggle clack v16 api specification'

distance = 552
spam score = 45
title = 'uses of class netclackrouterpacketsvnspacketdepartureevent clack v16 api specification'

distance = 552
spam score = 48
title = 'uses of class netclackrouterpacketsvnspacketdepartureevent clack v16 api specification'

distance = 554
spam score = 46
title = 'uses of class netclackroutercomponenttcpsockbuffer clack v16 api specification'

distance = 557
spam score = 47
title = 'uses of class netclackroutercomponenttcpsockbuffer clack v16 api specification'

distance = 559
spam score = 48
title = 'uses of class netclackrouterjgraphpadgpgraphtools clack v16 api specification'

distance = 560
spam score = 47
title = 'uses of class netclackroutercomponentextensiontcpseqmon clack v16 api specification'

distance = 563
spam score = 62
title = 'netclackroutertutorial clack v16 api specification'

distance = 565
spam score = 52
title = 'uses of class netclackroutercomponentextensiontcpseqmon clack v16 api specification'

distance = 565
spam score = 46
title = 'uses of package netclackroutertopologycreate clack v16 api specification'

distance = 565
spam score = 54
title = 'uses of class netclackrouterpacketslinkstatepacketlink clack v16 api specification'

distance = 629
spam score = 48
title = 'uses of class netclackrouterprotocolcommandsvnsprotocolcommand clack v16 api specification'

distance = 629
spam score = 51
title = 'uses of class netclackroutercomponentextensionclassifierpatternmatcher clack v16 api specification'

distance = 629
spam score = 61
title = 'netclackrouternetutils class hierarchy clack v16 api specification'

distance = 629
spam score = 43
title = 'uses of class netclackrouterprotocolcommandsvnsprotocolcommand clack v16 api specification'

distance = 632
spam score = 67
title = 'netclackrouternetutils class hierarchy clack v16 api specification'

distance = 634
spam score = 58
title = 'uses of class netclackrouterroutergraphsockbufferviewsockbufferrenderer clack v16 api specification'

distance = 636
spam score = 47
title = 'uses of class netclackrouterapplicationapplicationmanager clack v16 api specification'

distance = 638
spam score = 44
title = 'uses of class netclackrouterjgraphutilshtmlpanecustomlinkhandler clack v16 api specification'

distance = 638
spam score = 64
title = 'netclackrouterprotocoldata class hierarchy clack v16 api specification'

distance = 638
spam score = 60
title = 'netclackrouterprotocoldata class hierarchy clack v16 api specification'

distance = 763
spam score = 63
title = 'netclackrouterjgraphpadresources class hierarchy clack v16 api specification'

distance = 766
spam score = 53
title = 'uses of class netclackrouterpacketsdnspacketanswer clack v16 api specification'

distance = 778
spam score = 45
title = 'uses of package netclackrouterethereal clack v16 api specification'

distance = 785
spam score = 51
title = 'uses of class netclackrouterjgraphutilsguilocalechangeadapter clack v16 api specification'

distance = 786
spam score = 46
title = 'uses of class netclackrouterjgraphpadgpbarentry clack v16 api specification'

distance = 787
spam score = 47
title = 'uses of package netclackrouterethereal clack v16 api specification'

distance = 787
spam score = 49
title = 'uses of class netclackrouterjgraphpadgpbarentry clack v16 api specification'

distance = 788
spam score = 57
title = 'netclackrouterprotocolcommands clack v16 api specification'

distance = 788
spam score = 55
title = 'netclackrouterprotocolcommands clack v16 api specification'

distance = 791
spam score = 54
title = 'uses of class netclackrouterjgraphutilsguilocalechangeadapter clack v16 api specification'

distance = 1334
spam score = 44
title = 'overview sara api specification'

distance = 1821
spam score = 12
title = 'mail thread index'

distance = 218
spam score = 74
title = ''

distance = 228
spam score = 73
title = ''

distance = 232
spam score = 75
title = ''

distance = 243
spam score = 78
title = ''

distance = 252
spam score = 75
title = ''

distance = 258
spam score = 78
title = ''

distance = 261
spam score = 73
title = ''

distance = 266
spam score = 75
title = ''

distance = 272
spam score = 68
title = ''

distance = 276
spam score = 74
title = ''

distance = 280
spam score = 74
title = ''

distance = 282
spam score = 77
title = ''

distance = 285
spam score = 76
title = ''

distance = 286
spam score = 74
title = ''

distance = 288
spam score = 77
title = ''

distance = 366
spam score = 73
title = ''

distance = 398
spam score = 84
title = ''

distance = 400
spam score = 74
title = ''

distance = 427
spam score = 84
title = ''

distance = 428
spam score = 73
title = ''

distance = 439
spam score = 82
title = ''

distance = 442
spam score = 81
title = ''

distance = 475
spam score = 75
title = ''

distance = 493
spam score = 67
title = ''

distance = 504
spam score = 77
title = ''

distance = 507
spam score = 75
title = ''

distance = 529
spam score = 76
title = ''

distance = 533
spam score = 77
title = ''

distance = 533
spam score = 80
title = ''

distance = 534
spam score = 76
title = ''

distance = 559
spam score = 77
title = ''

distance = 568
spam score = 76
title = ''

distance = 576
spam score = 72
title = ''

distance = 664
spam score = 71
title = ''

distance = 685
spam score = 85
title = ''

distance = 689
spam score = 76
title = ''

distance = 691
spam score = 77
title = ''

distance = 739
spam score = 79
title = ''

distance = 751
spam score = 76
title = ''

distance = 752
spam score = 79
title = ''

distance = 756
spam score = 86
title = ''

distance = 759
spam score = 74
title = ''

distance = 1052
spam score = 69
title = ''

distance = 150
spam score = 52
title = 'uses of class jpactokushimauedbedbrtf edbjava api specification'

distance = 160
spam score = 50
title = 'uses of class jpactokushimauedbedbcsv edbjava api specification'

distance = 176
spam score = 51
title = 'uses of class jpactokushimauedbedbauthentication edbjava api specification'

distance = 178
spam score = 51
title = 'uses of class jpactokushimauedbedbxml edbjava api specification'

distance = 179
spam score = 50
title = 'uses of class jpactokushimauedbprinthistory edbjava api specification'

distance = 185
spam score = 51
title = 'uses of class jpactokushimauedbprintarticle edbjava api specification'

distance = 194
spam score = 50
title = 'uses of class jpactokushimauedbedbpki edbjava api specification'

distance = 197
spam score = 46
title = 'uses of class jpactokushimauedbprintteaching edbjava api specification'

distance = 199
spam score = 54
title = 'uses of class jpactokushimauedbprintdate edbjava api specification'

distance = 199
spam score = 55
title = 'uses of class jpactokushimauedbprintdate2 edbjava api specification'

distance = 199
spam score = 52
title = 'uses of class jpactokushimauedbedbcandidatecondition edbjava api specification'

distance = 207
spam score = 48
title = 'uses of class jpactokushimauedbtypeedbtypeyear edbjava api specification'

distance = 209
spam score = 50
title = 'uses of class jpactokushimauedbprintitemize edbjava api specification'

distance = 210
spam score = 51
title = 'uses of class jpactokushimauedbprintposthistory edbjava api specification'

distance = 210
spam score = 47
title = 'uses of class jpactokushimauedbprintthesis edbjava api specification'

distance = 216
spam score = 50
title = 'uses of class jpactokushimauedbguiedbcatalogueeditor edbjava api specification'

distance = 216
spam score = 51
title = 'uses of class jpactokushimauedbprintresearchactivity edbjava api specification'

distance = 217
spam score = 48
title = 'uses of class jpactokushimauedbguiedbcertificateregister edbjava api specification'

distance = 218
spam score = 48
title = 'uses of class jpactokushimauedbprintledger edbjava api specification'

distance = 219
spam score = 47
title = 'uses of class jpactokushimauedbtupleedbinethost edbjava api specification'

distance = 253
spam score = 50
title = 'uses of class jpactokushimauedbprintdate2captiony edbjava api specification'

distance = 256
spam score = 50
title = 'uses of class jpactokushimauedbprintpatentcaption edbjava api specification'

distance = 256
spam score = 53
title = 'uses of class jpactokushimauedbprintarticlelatex edbjava api specification'

distance = 257
spam score = 47
title = 'uses of class jpactokushimauedbedbgateresclassify edbjava api specification'

distance = 260
spam score = 50
title = 'uses of class jpactokushimauedbprintcircleassist edbjava api specification'

distance = 263
spam score = 47
title = 'uses of class jpactokushimauedbevalsheetevalsheet2005categoryselectactionclass edbjava api specification'

distance = 265
spam score = 48
title = 'uses of class jpactokushimauedbprintresearchactivitycaption edbjava api specification'

distance = 265
spam score = 48
title = 'uses of class jpactokushimauedbprintsocialactivitystandard edbjava api specification'

distance = 265
spam score = 48
title = 'uses of class jpactokushimauedbguiedbmenuitemcatalogue edbjava api specification'

distance = 267
spam score = 46
title = 'uses of class jpactokushimauedbguiedbgui edbjava api specification'

distance = 277
spam score = 54
title = 'uses of class jpactokushimauedbevalsheetevalsheet2005sectionselectactionclass edbjava api specification'

distance = 278
spam score = 49
title = 'uses of class jpactokushimauedbtypeedbtypephone edbjava api specification'

distance = 278
spam score = 53
title = 'uses of class jpactokushimauedbprintarticlecaption edbjava api specification'

distance = 279
spam score = 52
title = 'uses of class jpactokushimauedbprintcollaborationcaption edbjava api specification'

distance = 281
spam score = 48
title = 'uses of class jpactokushimauedbprintinetstandardinetnetwork edbjava api specification'

distance = 281
spam score = 48
title = 'uses of class jpactokushimauedbprintkeywordstandard edbjava api specification'

distance = 281
spam score = 52
title = 'uses of class jpactokushimauedbprintcircleassiststandard edbjava api specification'

distance = 282
spam score = 50
title = 'uses of class jpactokushimauedbguiedbmenuitemeid edbjava api specification'

distance = 282
spam score = 50
title = 'uses of class jpactokushimauedbtypeedbtypecertificate edbjava api specification'

distance = 283
spam score = 53
title = 'uses of class jpactokushimauedbprintcollaborationstandard edbjava api specification'

distance = 287
spam score = 46
title = 'uses of class jpactokushimauedbtypeedbtypename edbjava api specification'

distance = 288
spam score = 49
title = 'uses of class jpactokushimauedbprintresearchactivitystandard edbjava api specification'

distance = 290
spam score = 56
title = 'uses of class jpactokushimauedbprintdate2captionym edbjava api specification'

distance = 293
spam score = 44
title = 'uses of class jpactokushimauedbprintposthistorystandard edbjava api specification'

distance = 293
spam score = 48
title = 'uses of class jpactokushimauedbtypeedbtypeurl edbjava api specification'

distance = 294
spam score = 47
title = 'uses of class jpactokushimauedbprintsocialactivitycaption edbjava api specification'

distance = 294
spam score = 48
title = 'uses of class jpactokushimauedbprintcataloguecompletedcatalogue edbjava api specification'

distance = 295
spam score = 48
title = 'uses of class jpactokushimauedbguiedbminutepaneminuteeditor edbjava api specification'

distance = 295
spam score = 50
title = 'uses of class jpactokushimauedbprintteachingcaption edbjava api specification'

distance = 297
spam score = 48
title = 'uses of class jpactokushimauedbtypeedbtypepassphrase edbjava api specification'

distance = 309
spam score = 50
title = 'uses of class jpactokushimauedbprintmonetarycaptionmonetary edbjava api specification'

distance = 309
spam score = 46
title = 'uses of class jpactokushimauedbguiedbtextpanetextdroplistener edbjava api specification'

distance = 310
spam score = 54
title = 'uses of class jpactokushimauedbprintacademicsocietyactivitystandard edbjava api specification'

distance = 310
spam score = 52
title = 'uses of class jpactokushimauedbguiedbbrowseropenaction edbjava api specification'

distance = 312
spam score = 55
title = 'uses of class jpactokushimauedbedbmisc edbjava api specification'

distance = 312
spam score = 47
title = 'uses of class jpactokushimauedbtypeedbtypeinetfqdn edbjava api specification'

distance = 313
spam score = 47
title = 'uses of class jpactokushimauedbguiedbbrowserwindowblocker edbjava api specification'

distance = 314
spam score = 45
title = 'uses of class jpactokushimauedbguiedbtablebrowsertablebrowseaction edbjava api specification'

distance = 315
spam score = 48
title = 'uses of class jpactokushimauedbevalsheetsectionitemdiagnosis3 edbjava api specification'

distance = 315
spam score = 47
title = 'uses of class jpactokushimauedbevalsheetsectionitemdiagnosis2 edbjava api specification'

distance = 331
spam score = 48
title = 'uses of class jpactokushimauedbevalsheetsectionitemsocialcontribution6 edbjava api specification'

distance = 332
spam score = 46
title = 'uses of class jpactokushimauedbevalsheetsectionitemmanagement2 edbjava api specification'

distance = 333
spam score = 45
title = 'uses of class jpactokushimauedbevalsheetsectionitemresearch2 edbjava api specification'

distance = 336
spam score = 44
title = 'uses of class jpactokushimauedbprintinetstandardinethost edbjava api specification'

distance = 337
spam score = 45
title = 'uses of class jpactokushimauedbevalsheetsectionitemeducation3 edbjava api specification'

distance = 337
spam score = 51
title = 'uses of class jpactokushimauedbguiedbdatumpaneeiddroplistener edbjava api specification'

distance = 338
spam score = 48
title = 'uses of class jpactokushimauedbevalsheetsectionitemmanagement7 edbjava api specification'

distance = 338
spam score = 46
title = 'uses of class jpactokushimauedbevalsheetsectionitemdiagnosis1 edbjava api specification'

distance = 342
spam score = 47
title = 'uses of class jpactokushimauedbevalsheetescategorytabbedchangelistener edbjava api specification'

distance = 343
spam score = 51
title = 'uses of class jpactokushimauedbguiedbcolumnclassifypanetreetuple edbjava api specification'

distance = 363
spam score = 46
title = 'uses of class jpactokushimauedbguiedbdnsclassifypanednstreetuple edbjava api specification'

distance = 368
spam score = 51
title = 'uses of class jpactokushimauedbevalsheetsectionitemeducation6 edbjava api specification'

distance = 377
spam score = 49
title = 'uses of class jpactokushimauedbtypeedbtypeipv4cidr edbjava api specification'

distance = 378
spam score = 55
title = 'uses of class jpactokushimauedbprintcollaboration edbjava api specification'

distance = 380
spam score = 50
title = 'uses of class jpactokushimauedbguiedbdnsclassifypanecidrtreetuple edbjava api specification'

distance = 384
spam score = 53
title = 'uses of class jpactokushimaudbutlfwriterresourcestatement edbjava api specification'

distance = 387
spam score = 55
title = 'uses of class jpactokushimauedbguiedbdnd edbjava api specification'

distance = 391
spam score = 48
title = 'uses of class jpactokushimauedbprintxml edbjava api specification'

distance = 394
spam score = 53
title = 'uses of class jpactokushimauedbtypeedbtypeparagraph edbjava api specification'

distance = 409
spam score = 69
title = 'uses of class jpactokushimauedbedbfile edbjava api specification'

distance = 450
spam score = 56
title = 'uses of class jpactokushimauedbguiedbdnsbrowseropenaction edbjava api specification'

distance = 452
spam score = 62
title = 'uses of class jpactokushimauedbedbfixedobjectexception edbjava api specification'

distance = 454
spam score = 51
title = 'uses of class jpactokushimauedbguiedborganizationbrowser edbjava api specification'

distance = 457
spam score = 55
title = 'uses of class jpactokushimauedbprintdateplaindate edbjava api specification'

distance = 457
spam score = 54
title = 'uses of class jpactokushimauedbguiedbbrowsertypeselector edbjava api specification'

distance = 464
spam score = 54
title = 'uses of class jpactokushimauedbevalsheetsectionitemtextoperationclass edbjava api specification'

distance = 478
spam score = 50
title = 'uses of class jpactokushimauedbguiedbdatumpanedatumpanel edbjava api specification'

distance = 489
spam score = 69
title = 'uses of class jpactokushimauedbprintacademicsocietyactivity edbjava api specification'

distance = 492
spam score = 45
title = 'uses of class jpactokushimauedbguiedbcataloguepaneeiddroplistener edbjava api specification'

distance = 500
spam score = 51
title = 'uses of class jpactokushimauedbguiedbdatepane edbjava api specification'

distance = 601
spam score = 55
title = 'uses of class jpactokushimauedbtupleedborganization edbjava api specification'

distance = 623
spam score = 50
title = 'uses of class jpactokushimauedbtupleedbperson edbjava api specification'

distance = 684
spam score = 53
title = 'uses of class jpactokushimauedbguiedbdatepanedateeditor edbjava api specification'

distance = 729
spam score = 53
title = 'uses of class jpactokushimauedbguiedbcolumnpane edbjava api specification'

distance = 769
spam score = 49
title = 'uses of interface jpactokushimauedbclientedbipcipclistener edbjava api specification'

distance = 864
spam score = 52
title = 'utlfparserelement edbjava api specification'

distance = 913
spam score = 49
title = 'uses of class jpactokushimauedbevalsheetescategory edbjava api specification'

distance = 937
spam score = 51
title = 'overview prolog cafe v12 api specification'

distance = 988
spam score = 44
title = 'jpackobeucsprologcompiler prolog cafe v12 api specification'

distance = 999
spam score = 73
title = 'overview prolog cafe v12 api specification'

distance = 1520
spam score = 65
title = 'edbtuplespi edbjava api specification'

distance = 1605
spam score = 39
title = 'b88lemmnfijb'

distance = 1628
spam score = 60
title = 'changes wikiwebserverorg'

distance = 1787
spam score = 77
title = 'aap carole 2007'

distance = 165
spam score = 64
title = ''

distance = 165
spam score = 64
title = ''

distance = 180
spam score = 54
title = ''

distance = 186
spam score = 61
title = ''

distance = 194
spam score = 63
title = ''

distance = 200
spam score = 59
title = ''

distance = 201
spam score = 60
title = ''

distance = 202
spam score = 55
title = ''

distance = 204
spam score = 56
title = ''

distance = 205
spam score = 52
title = ''

distance = 217
spam score = 63
title = ''

distance = 231
spam score = 59
title = ''

distance = 241
spam score = 70
title = ''

distance = 249
spam score = 54
title = ''

distance = 255
spam score = 59
title = ''

distance = 263
spam score = 64
title = ''

distance = 265
spam score = 61
title = ''

distance = 269
spam score = 64
title = ''

distance = 270
spam score = 57
title = ''

distance = 275
spam score = 63
title = ''

distance = 280
spam score = 64
title = ''

distance = 284
spam score = 67
title = ''

distance = 285
spam score = 58
title = ''

distance = 292
spam score = 66
title = ''

distance = 294
spam score = 52
title = ''

distance = 298
spam score = 52
title = ''

distance = 373
spam score = 71
title = ''

distance = 386
spam score = 70
title = ''

distance = 395
spam score = 69
title = ''

distance = 402
spam score = 55
title = ''

distance = 546
spam score = 63
title = ''

distance = 551
spam score = 51
title = ''

distance = 560
spam score = 62
title = ''

distance = 561
spam score = 71
title = ''

distance = 569
spam score = 58
title = ''

distance = 570
spam score = 66
title = ''

distance = 574
spam score = 73
title = ''

distance = 577
spam score = 55
title = ''

distance = 582
spam score = 68
title = ''

distance = 603
spam score = 68
title = ''

distance = 603
spam score = 63
title = ''

distance = 605
spam score = 67
title = ''

distance = 606
spam score = 67
title = ''

distance = 613
spam score = 46
title = ''

distance = 678
spam score = 65
title = ''

distance = 688
spam score = 69
title = ''

distance = 732
spam score = 69
title = ''

distance = 734
spam score = 60
title = ''

distance = 941
spam score = 68
title = ''

distance = 953
spam score = 88
title = ''

distance = 1214
spam score = 75
title = ''

distance = 1221
spam score = 81
title = ''

distance = 119
spam score = 72
title = 'setattribute'

distance = 122
spam score = 67
title = 'uuid'

distance = 124
spam score = 71
title = 'setattribute'

distance = 128
spam score = 68
title = 'setattribute'

distance = 129
spam score = 70
title = 'fundocumenturi'

distance = 129
spam score = 74
title = 'funimplicittimezone'

distance = 134
spam score = 76
title = 'setattribute'

distance = 134
spam score = 73
title = 'setattribute'

distance = 135
spam score = 73
title = 'extdoctype'

distance = 135
spam score = 67
title = 'describefunction'

distance = 139
spam score = 68
title = 'funinsertbefore'

distance = 142
spam score = 72
title = 'setattribute'

distance = 142
spam score = 68
title = 'funiritouri'

distance = 145
spam score = 73
title = 'funnodename'

distance = 146
spam score = 71
title = 'describefunction'

distance = 155
spam score = 70
title = 'setstatuscode'

distance = 155
spam score = 70
title = 'callfunction'

distance = 162
spam score = 68
title = 'funlocalname'

distance = 163
spam score = 70
title = 'setstatuscode'

distance = 165
spam score = 67
title = 'setstatuscode'

distance = 169
spam score = 73
title = 'removeattribute'

distance = 170
spam score = 74
title = 'funnumber'

distance = 171
spam score = 73
title = 'funabs'

distance = 174
spam score = 71
title = 'removeattribute'

distance = 177
spam score = 67
title = 'funname'

distance = 179
spam score = 70
title = 'funexactlyone'

distance = 180
spam score = 68
title = 'funavg'

distance = 183
spam score = 66
title = 'funstrlength'

distance = 184
spam score = 67
title = 'funstring'

distance = 188
spam score = 71
title = 'setcookie'

distance = 194
spam score = 68
title = 'setcookie'

distance = 194
spam score = 75
title = 'setattribute'

distance = 194
spam score = 69
title = 'setcookie'

distance = 216
spam score = 71
title = 'setheader'

distance = 220
spam score = 72
title = 'setstatuscode'

distance = 220
spam score = 70
title = 'funsubsequence'

distance = 223
spam score = 74
title = 'funroot'

distance = 224
spam score = 69
title = 'setheader'

distance = 234
spam score = 75
title = 'removeattribute'

distance = 235
spam score = 70
title = 'setheader'

distance = 238
spam score = 71
title = 'getid'

distance = 239
spam score = 68
title = 'getattribute'

distance = 244
spam score = 69
title = 'getid'

distance = 259
spam score = 74
title = 'funmax'

distance = 263
spam score = 70
title = 'funsubstringbefore'

distance = 267
spam score = 71
title = 'funfloor'

distance = 275
spam score = 76
title = 'funround'

distance = 275
spam score = 72
title = 'funceiling'

distance = 288
spam score = 76
title = 'funroundhalftoeven'

distance = 291
spam score = 74
title = 'getid'

distance = 298
spam score = 70
title = 'funcontains'

distance = 301
spam score = 70
title = 'funremove'

distance = 318
spam score = 73
title = 'funendswith'

distance = 325
spam score = 75
title = 'fundistinctvalues'

distance = 389
spam score = 77
title = 'asuser'

distance = 391
spam score = 68
title = 'funtokenize'

distance = 396
spam score = 78
title = 'funcount'

distance = 399
spam score = 71
title = 'asuser'

distance = 402
spam score = 72
title = 'asuser'

distance = 419
spam score = 78
title = 'fununordered'

distance = 435
spam score = 68
title = 'catchfunction'

distance = 436
spam score = 75
title = 'asuser'

distance = 458
spam score = 73
title = 'fundoc'

distance = 473
spam score = 72
title = 'basicfunction'

distance = 480
spam score = 65
title = 'basicfunction'

distance = 483
spam score = 70
title = 'funcurrentdatetime'

distance = 485
spam score = 71
title = 'funreplace'

distance = 493
spam score = 72
title = 'basicfunction'

distance = 508
spam score = 67
title = 'lockfunction'

distance = 529
spam score = 70
title = 'ftindexlookup'

distance = 537
spam score = 75
title = 'ftindexlookup'

distance = 555
spam score = 72
title = 'qnameindexlookup'

distance = 561
spam score = 77
title = 'ftindexlookup'

distance = 611
spam score = 70
title = 'update'

distance = 613
spam score = 69
title = 'update'

distance = 616
spam score = 71
title = 'replace'

distance = 616
spam score = 74
title = 'update'

distance = 618
spam score = 73
title = 'intersection'

distance = 618
spam score = 71
title = 'replace'

distance = 621
spam score = 74
title = 'replace'

distance = 639
spam score = 69
title = 'delete'

distance = 640
spam score = 68
title = 'delete'

distance = 642
spam score = 70
title = 'rename'

distance = 642
spam score = 71
title = 'delete'

distance = 644
spam score = 71
title = 'rename'

distance = 645
spam score = 74
title = 'rename'

distance = 737
spam score = 77
title = 'logicalop'

distance = 739
spam score = 75
title = 'insert'

distance = 744
spam score = 73
title = 'enclosedexpr'

distance = 772
spam score = 71
title = 'commentconstructor'

distance = 866
spam score = 71
title = 'namespaceconstructor'

distance = 878
spam score = 74
title = 'combiningexpression'

distance = 909
spam score = 70
title = 'dynamicpiconstructor'

distance = 921
spam score = 64
title = 'dynamictextconstructor'

distance = 997
spam score = 64
title = 'dynamicattributeconstructor'

distance = 1145
spam score = 72
title = 'letexpr'

distance = 1156
spam score = 68
title = 'locationstep'

distance = 1224
spam score = 65
title = 'forexpr'

distance = 1274
spam score = 68
title = 'modification'

distance = 1278
spam score = 67
title = 'modification'

distance = 130
spam score = 57
title = 'uses of package orgapachemyfacescustomconvertstring sandbox core 118snapshot api'

distance = 137
spam score = 56
title = 'uses of package orgapachemyfacescustomconvertboolean sandbox core 118snapshot api'

distance = 147
spam score = 57
title = 'uses of package orgapachemyfacescustomconvertnumber sandbox core 118snapshot api'

distance = 159
spam score = 61
title = 'uses of package orgapachemyfacescustomisbnvalidator sandbox core 118snapshot api'

distance = 160
spam score = 55
title = 'uses of package orgapachemyfacescustomgraphicimagedynamic sandbox core 118snapshot api'

distance = 173
spam score = 59
title = 'uses of package orgapachemyfacescustomdojoaddresource sandbox core 118snapshot api'

distance = 175
spam score = 55
title = 'uses of class orgapachemyfacescustomloadbundleloadbundle sandbox core 118snapshot api'

distance = 176
spam score = 55
title = 'uses of package orgapachemyfacescustomconvertstringutils sandbox core 118snapshot api'

distance = 177
spam score = 60
title = 'uses of package orgapachemyfacescustomutil sandbox core 118snapshot api'

distance = 179
spam score = 52
title = 'uses of class orgapachemyfacescustomisbnvalidatorisbnvalidator sandbox core 118snapshot api'

distance = 186
spam score = 54
title = 'uses of package orgapachemyfacescustomform sandbox core 118snapshot test api'

distance = 186
spam score = 55
title = 'uses of package orgapachemyfacescustomajaxutil sandbox core 118snapshot api'

distance = 186
spam score = 60
title = 'uses of package orgapachemyfacescustomfocus sandbox core 118snapshot api'

distance = 197
spam score = 51
title = 'uses of package orgapachemyfacescustomexporter sandbox core 118snapshot api'

distance = 201
spam score = 58
title = 'uses of package orgapachemyfacesvalidatorex sandbox core 118snapshot api'

distance = 201
spam score = 55
title = 'uses of package orgapachemyfacescustomaccordion sandbox core 118snapshot test api'

distance = 205
spam score = 55
title = 'uses of package orgapachemyfacescustomgraphicimagedynamic sandbox core 118snapshot test api'

distance = 205
spam score = 54
title = 'orgapachemyfacescustomautoupdatedatatable sandbox core 118snapshot test api'

distance = 209
spam score = 53
title = 'uses of package orgapachemyfacescustompasswordstrength sandbox core 118snapshot test api'

distance = 210
spam score = 52
title = 'orgapachemyfacescustomsuggest sandbox core 118snapshot test api'

distance = 252
spam score = 57
title = 'uses of class orgapachemyfacescustomconvertbooleanconvertbooleantag sandbox core 118snapshot api'

distance = 252
spam score = 64
title = 'uses of package orgapachemyfacescustomtimednotifier sandbox core 118snapshot api'

distance = 254
spam score = 58
title = 'orgapachemyfacescustomconvertnumber sandbox core 118snapshot test api'

distance = 254
spam score = 57
title = 'uses of class orgapachemyfacescustomscopeafterscopephaselistener sandbox core 118snapshot api'

distance = 254
spam score = 53
title = 'uses of class orgapachemyfacescustomimageloophtmlimagelooprenderer sandbox core 118snapshot api'

distance = 256
spam score = 55
title = 'uses of class orgapachemyfacescustomtablesortablecolumntag sandbox core 118snapshot api'

distance = 257
spam score = 54
title = 'uses of class orgapachemyfacescustominputajaxhtmlselectmanycheckboxajax sandbox core 118snapshot api'

distance = 258
spam score = 57
title = 'uses of class orgapachemyfacescustomloadbundleabstractloadbundle sandbox core 118snapshot api'

distance = 260
spam score = 57
title = 'uses of package orgapachemyfacescustomredirecttrackerpolicy sandbox core 118snapshot api'

distance = 260
spam score = 68
title = 'orgapachemyfacescustomajaxutil sandbox core 118snapshot api'

distance = 280
spam score = 65
title = 'orgapachemyfacescustomsecurity sandbox core 118snapshot api'

distance = 282
spam score = 57
title = 'uses of class orgapachemyfacescustomtableabstractfiltertable sandbox core 118snapshot api'

distance = 283
spam score = 55
title = 'uses of class orgapachemyfacescustominputajaxabstracthtmlselectbooleancheckboxajax sandbox core 118snapshot api'

distance = 285
spam score = 62
title = 'uses of package orgapachemyfacescustomcomparetovalidator sandbox core 118snapshot api'

distance = 286
spam score = 64
title = 'orgapachemyfacescustomconvertstring sandbox core 118snapshot api'

distance = 286
spam score = 57
title = 'uses of class orgapachemyfacescustomoutputlinkdynamicabstractoutputlinkdynamic sandbox core 118snapshot api'

distance = 287
spam score = 59
title = 'uses of class orgapachemyfacescustomtoggleabstracttogglepanel sandbox core 118snapshot api'

distance = 288
spam score = 59
title = 'uses of class orgapachemyfacescustomdojolayoutsabstractfloatingpanebase sandbox core 118snapshot api'

distance = 289
spam score = 55
title = 'uses of class orgapachemyfacescustomconvertdatetimedatetimeconverter sandbox core 118snapshot api'

distance = 290
spam score = 52
title = 'uses of class orgapachemyfacescustomdialogmodaldialogrenderer sandbox core 118snapshot api'

distance = 320
spam score = 74
title = 'orgapachemyfacescustomconvertstringutils sandbox core 118snapshot api'

distance = 321
spam score = 54
title = 'uses of class orgapachemyfacescustomclientvalidationvalidationscriptvalidationscripttag sandbox core 118snapshot api'

distance = 325
spam score = 76
title = 'orgapachemyfacescustomaccordion sandbox core 118snapshot api'

distance = 329
spam score = 74
title = 'orgapachemyfacescustomrequestparameterprovider sandbox core 118snapshot api'

distance = 329
spam score = 54
title = 'orgapachemyfacescustomsecurity sandbox core 118snapshot test api'

distance = 329
spam score = 59
title = 'uses of package orgapachemyfacescustomoutputlinkdynamic sandbox core 118snapshot api'

distance = 331
spam score = 72
title = 'orgapachemyfacescustomclientvalidationvalidationscript sandbox core 118snapshot api'

distance = 332
spam score = 70
title = 'orgapachemyfacescustomcsvvalidator sandbox core 118snapshot api'

distance = 337
spam score = 64
title = 'orgapachemyfacescustomcomparetovalidator sandbox core 118snapshot api'

distance = 338
spam score = 71
title = 'orgapachemyfacescustomurlvalidator sandbox core 118snapshot api'

distance = 376
spam score = 64
title = 'orgapachemyfacescustomajax sandbox core 118snapshot api'

distance = 376
spam score = 67
title = 'orgapachemyfacesconvertex sandbox core 118snapshot api'

distance = 382
spam score = 59
title = 'uses of package orgapachemyfacescustomdialog sandbox core 118snapshot api'

distance = 383
spam score = 66
title = 'orgapachemyfacescustomexporter sandbox core 118snapshot api'

distance = 384
spam score = 58
title = 'uses of package orgapachemyfacescustomimageloop sandbox core 118snapshot api'

distance = 395
spam score = 58
title = 'orgapachemyfacescustommediautil class hierarchy sandbox core 118snapshot api'

distance = 399
spam score = 60
title = 'orgapachemyfacescustomdynamicresources class hierarchy sandbox core 118snapshot api'

distance = 403
spam score = 64
title = 'uses of package orgapachemyfacescustomfisheye sandbox core 118snapshot api'

distance = 412
spam score = 62
title = 'orgapachemyfacescustomdojoaddresource class hierarchy sandbox core 118snapshot api'

distance = 413
spam score = 51
title = 'orgapachemyfacescustomhtmltag tomahawk 12 core 118 test api'

distance = 464
spam score = 74
title = 'orgapachemyfacescustomsuggestajaxinputsuggestajax sandbox core 118snapshot api'

distance = 470
spam score = 56
title = 'uses of class orgapachemyfacescustomclientvalidationcommoncvcallsholder sandbox core 118snapshot api'

distance = 472
spam score = 55
title = 'uses of class orgapachemyfacescustominputtexthelphtmltexthelprenderer tomahawk 12 core 118 api'

distance = 472
spam score = 57
title = 'uses of class orgapachemyfacescustompanelstackhtmlpanelstack tomahawk core 118 api'

distance = 474
spam score = 58
title = 'orgapachemyfacescustomsecurity class hierarchy sandbox core 118snapshot api'

distance = 474
spam score = 58
title = 'orgapachemyfacestomahawkutil class hierarchy sandbox core 118snapshot api'

distance = 478
spam score = 56
title = 'uses of class orgapachemyfacescustomtabbedpanehtmltabbedpanerenderer tomahawk core 118 api'

distance = 483
spam score = 57
title = 'orgapachemyfacescustomemailvalidator tomahawk core 118 api'

distance = 483
spam score = 72
title = 'orgapachemyfacescustomconvertnumber sandbox core 118snapshot api'

distance = 487
spam score = 58
title = 'uses of class orgapachemyfacescustomcollapsiblepanelhtmlheaderlinktag tomahawk 12 core 118 api'

distance = 534
spam score = 61
title = 'orgapachemyfacescustomredirecttrackerpolicy class hierarchy sandbox core 118snapshot api'

distance = 538
spam score = 68
title = 'orgapachemyfacescustomdynamicresources sandbox core 118snapshot api'

distance = 540
spam score = 56
title = 'deprecated list myfaces orchestra sandbox 10snapshot api'

distance = 542
spam score = 61
title = 'orgapachemyfacescustomconvertnumber class hierarchy sandbox core 118snapshot test api'

distance = 543
spam score = 54
title = 'orgapachemyfacescustomprototype tomahawk core 118 api'

distance = 544
spam score = 54
title = 'orgapachemyfacescustomsubform tomahawk core 118 api'

distance = 549
spam score = 55
title = 'orgapachemyfacescustomselectonelanguage tomahawk core 118 api'

distance = 552
spam score = 63
title = 'overview sandbox core 118snapshot test api'

distance = 567
spam score = 74
title = 'orgapachemyfacescustomfisheye sandbox core 118snapshot api'

distance = 568
spam score = 76
title = 'orgapachemyfacescustomsuggestajaxtablesuggestajax sandbox core 118snapshot api'

distance = 661
spam score = 56
title = 'orgapachemyfacescustomscope sandbox core 118snapshot api'

distance = 665
spam score = 52
title = 'uses of class orgapachemyfacescustomclientvalidationcommoncvcall sandbox core 118snapshot api'

distance = 669
spam score = 58
title = 'uses of class orgapachemyfacescustompprpartialtriggerparserpartialtrigger sandbox core 118snapshot api'

distance = 674
spam score = 74
title = 'orgapachemyfacescustomsubmitonevent sandbox core 118snapshot api'

distance = 675
spam score = 64
title = 'orgapachemyfacescustommedia class hierarchy sandbox core 118snapshot api'

distance = 677
spam score = 58
title = 'orgapachemyfacescustomifmessage class hierarchy sandbox core 118snapshot api'

distance = 690
spam score = 64
title = 'orgapachemyfacescustomconvertboolean class hierarchy sandbox core 118snapshot api'

distance = 693
spam score = 65
title = 'orgapachemyfacescustomloadbundle class hierarchy sandbox core 118snapshot api'

distance = 694
spam score = 61
title = 'uses of class orgapachemyfacescustomsuggestajaxabstractsuggestajax sandbox core 118snapshot api'

distance = 698
spam score = 62
title = 'orgapachemyfacescustomredirecttracker class hierarchy sandbox core 118snapshot api'

distance = 757
spam score = 78
title = 'orgapachemyfacescustomredirecttracker sandbox core 118snapshot api'

distance = 758
spam score = 64
title = 'orgapachemyfacescustomfocus class hierarchy sandbox core 118snapshot api'

distance = 781
spam score = 64
title = 'orgapachemyfacescustomscope class hierarchy sandbox core 118snapshot api'

distance = 784
spam score = 47
title = 'orgapachemyfacestobagofaceletssandbox class hierarchy apache tobago 110snapshot api'

distance = 785
spam score = 63
title = 'orgapachemyfacescustomnavigation class hierarchy tomahawk core 118 test api'

distance = 785
spam score = 56
title = 'constant field values sandbox core 118snapshot test api'

distance = 815
spam score = 56
title = 'orgapachemyfacescustombuffer class hierarchy tomahawk core 118 api'

distance = 822
spam score = 60
title = 'overview tomahawk core 118 test api'

distance = 848
spam score = 63
title = 'orgapachemyfacescustomsuggest class hierarchy sandbox core 118snapshot api'

distance = 864
spam score = 62
title = 'uses of class orgapachemyfacescomponenthtmlextabstracthtmlselectonemenu tomahawk core 118 api'

distance = 1340
spam score = 60
title = 'uses of package orgapachemyfacessharedtomahawktaglibhtml tomahawk core 118 api'

distance = 80
spam score = 60
title = ''

distance = 83
spam score = 58
title = ''

distance = 87
spam score = 61
title = ''

distance = 97
spam score = 60
title = ''

distance = 201
spam score = 61
title = ''

distance = 205
spam score = 54
title = ''

distance = 207
spam score = 60
title = ''

distance = 303
spam score = 60
title = ''

distance = 1125
spam score = 63
title = ''

distance = 1127
spam score = 63
title = ''

distance = 528
spam score = 68
title = ''

distance = 529
spam score = 63
title = ''

distance = 155
spam score = 56
title = 'addgf1 jhdl api'

distance = 166
spam score = 59
title = 'stages jhdl api'

distance = 168
spam score = 61
title = 'bram4k jhdl api'

distance = 169
spam score = 60
title = 'duplicate jhdl api'

distance = 170
spam score = 59
title = 'spr jhdl api'

distance = 173
spam score = 59
title = 'sport jhdl api'

distance = 173
spam score = 58
title = 'fulladder jhdl api'

distance = 174
spam score = 60
title = 'shiftmuxr jhdl api'

distance = 176
spam score = 59
title = 'bram1k jhdl api'

distance = 179
spam score = 59
title = 'dpsr jhdl api'

distance = 182
spam score = 60
title = 'addfci jhdl api'

distance = 182
spam score = 61
title = 'psr jhdl api'

distance = 183
spam score = 56
title = 'charcomp2 jhdl api'

distance = 192
spam score = 60
title = 'adsuovf16 jhdl api'

distance = 193
spam score = 58
title = 'dspr jhdl api'

distance = 194
spam score = 64
title = 'subg1 jhdl api'

distance = 197
spam score = 58
title = 'leftedge2 jhdl api'

distance = 197
spam score = 62
title = 'testoverflow jhdl api'

distance = 200
spam score = 60
title = 'regfile jhdl api'

distance = 201
spam score = 55
title = 'addsubgf3 jhdl api'

distance = 217
spam score = 62
title = 'dsmultmodule jhdl api'

distance = 220
spam score = 63
title = 'decoder jhdl api'

distance = 220
spam score = 61
title = 'calculator jhdl api'

distance = 221
spam score = 64
title = 'nobufg jhdl api'

distance = 222
spam score = 58
title = 'mod4count2 jhdl api'

distance = 224
spam score = 67
title = 'multaddxc4000 jhdl api'

distance = 226
spam score = 63
title = 'dsfirmodule jhdl api'

distance = 226
spam score = 64
title = 'multsubvirtex jhdl api'

distance = 227
spam score = 65
title = 'multsubgeneric jhdl api'

distance = 228
spam score = 66
title = 'tofloatexample jhdl api'

distance = 241
spam score = 61
title = 'addpassgeneric jhdl api'

distance = 242
spam score = 57
title = 'charfsm2 jhdl api'

distance = 243
spam score = 55
title = 'counter jhdl api'

distance = 245
spam score = 64
title = 'subgf1 jhdl api'

distance = 250
spam score = 60
title = 'addpass jhdl api'

distance = 253
spam score = 60
title = 'scaleback jhdl api'

distance = 255
spam score = 60
title = 'parallelleftshiftreg jhdl api'

distance = 258
spam score = 62
title = 'pipesigs jhdl api'

distance = 262
spam score = 59
title = 'gt jhdl api'

distance = 268
spam score = 62
title = 'frac jhdl api'

distance = 272
spam score = 60
title = 'dbone jhdl api'

distance = 275
spam score = 59
title = 'pipestages jhdl api'

distance = 275
spam score = 61
title = 'deslogic jhdl api'

distance = 278
spam score = 60
title = 'scale jhdl api'

distance = 278
spam score = 63
title = 'zmux jhdl api'

distance = 281
spam score = 60
title = 'specialhandler jhdl api'

distance = 284
spam score = 57
title = 'stage jhdl api'

distance = 284
spam score = 64
title = 'multaddvirtex jhdl api'

distance = 287
spam score = 61
title = 'dscontrol jhdl api'

distance = 295
spam score = 57
title = 'table jhdl api'

distance = 310
spam score = 60
title = 'squareroot jhdl api'

distance = 311
spam score = 60
title = 'cordiclctrl jhdl api'

distance = 313
spam score = 62
title = 'tcmux jhdl api'

distance = 317
spam score = 59
title = 'fpdivradix2 jhdl api'

distance = 318
spam score = 61
title = 'scale jhdl api'

distance = 321
spam score = 64
title = 'shiftregbit jhdl api'

distance = 327
spam score = 58
title = 'fpunpack jhdl api'

distance = 339
spam score = 57
title = 'pipefrac jhdl api'

distance = 341
spam score = 61
title = 'pipescaleback jhdl api'

distance = 348
spam score = 58
title = 'fpdivradix4 jhdl api'

distance = 356
spam score = 58
title = 'specialhandler jhdl api'

distance = 360
spam score = 60
title = 'scaleback jhdl api'

distance = 363
spam score = 58
title = 'specialhandler jhdl api'

distance = 364
spam score = 66
title = 'multicontexttestbench jhdl api'

distance = 369
spam score = 61
title = 'scaleback jhdl api'

distance = 373
spam score = 59
title = 'scale jhdl api'

distance = 374
spam score = 58
title = 'fpdivradix8 jhdl api'

distance = 375
spam score = 58
title = 'decoder8256 jhdl api'

distance = 380
spam score = 59
title = 'fpdivradix2 jhdl api'

distance = 385
spam score = 59
title = 'specialhandler jhdl api'

distance = 391
spam score = 51
title = 'updowncount jhdl api'

distance = 394
spam score = 63
title = 'eq jhdl api'

distance = 413
spam score = 62
title = 'exponent jhdl api'

distance = 415
spam score = 58
title = 'gt jhdl api'

distance = 429
spam score = 64
title = 'logshiftr jhdl api'

distance = 456
spam score = 59
title = 'pipescale jhdl api'

distance = 534
spam score = 65
title = 'uintdivide jhdl api'

distance = 541
spam score = 66
title = 'adsu jhdl api'

distance = 551
spam score = 59
title = 'tbfpdivradix8 jhdl api'

distance = 572
spam score = 57
title = 'tristatestimulator jhdl api'

distance = 849
spam score = 80
title = 'ram32x1slogic'

distance = 849
spam score = 80
title = 'ram32x1s1logic'

distance = 852
spam score = 80
title = 'ram16x1s1logic'

distance = 859
spam score = 80
title = 'allramtest'

distance = 861
spam score = 81
title = 'ram32x4slogic'

distance = 862
spam score = 78
title = 'jhdllogicramtest'

distance = 862
spam score = 75
title = 'jhdlsimpletests'

distance = 864
spam score = 74
title = 'jhdlsimpletest'

distance = 866
spam score = 81
title = 'ram16x1dlogic'

distance = 866
spam score = 80
title = 'srl16e1logic'

distance = 871
spam score = 80
title = 'ram32x1d1logic'

distance = 871
spam score = 81
title = 'ram32x1dlogic'

distance = 872
spam score = 80
title = 'srlc16elogic'

distance = 876
spam score = 75
title = 'jhdlmultiramtest'

distance = 876
spam score = 80
title = 'ram64x1d1logic'

distance = 876
spam score = 81
title = 'ram64x1dlogic'

distance = 879
spam score = 78
title = 'decode7x128'

distance = 879
spam score = 75
title = 'decode6x64'

distance = 883
spam score = 74
title = 'jhdlramtest'

distance = 885
spam score = 80
title = 'ram32x8slogic'

distance = 891
spam score = 78
title = 'allsrltest'

distance = 897
spam score = 80
title = 'ram16x8dlogic'

distance = 909
spam score = 81
title = 'ram16x4dlogic'

distance = 910
spam score = 82
title = 'alllutramtest'

distance = 913
spam score = 80
title = 'jhdlsrltest'

distance = 917
spam score = 77
title = 'simpletestbench'

distance = 950
spam score = 75
title = 'tbjhdlsimples'

distance = 959
spam score = 72
title = 'tbjhdlsimple'

distance = 1469
spam score = 63
title = 'logicgates jhdl api'

distance = 211
spam score = 75
title = ''

distance = 242
spam score = 73
title = ''

distance = 254
spam score = 73
title = ''

distance = 315
spam score = 77
title = ''

distance = 333
spam score = 72
title = ''

distance = 354
spam score = 73
title = ''

distance = 358
spam score = 76
title = ''

distance = 379
spam score = 67
title = ''

distance = 425
spam score = 72
title = ''

distance = 437
spam score = 68
title = ''

distance = 448
spam score = 69
title = ''

distance = 452
spam score = 70
title = ''

distance = 461
spam score = 73
title = ''

distance = 495
spam score = 78
title = ''

distance = 519
spam score = 69
title = ''

distance = 589
spam score = 74
title = ''

distance = 600
spam score = 69
title = ''

distance = 639
spam score = 70
title = ''

distance = 640
spam score = 74
title = ''

distance = 647
spam score = 74
title = ''

distance = 653
spam score = 74
title = ''

distance = 668
spam score = 72
title = ''

distance = 695
spam score = 77
title = ''

distance = 875
spam score = 74
title = ''

distance = 893
spam score = 73
title = ''

distance = 188
spam score = 66
title = 'nosuchmethodexception java 2 platform se 50'

distance = 197
spam score = 67
title = 'nosuchmethodexception java 2 platform se 50'

distance = 210
spam score = 61
title = 'negativearraysizeexception java 2 platform se 50'

distance = 218
spam score = 63
title = 'classcircularityerror java 2 platform se 50'

distance = 219
spam score = 65
title = 'arithmeticexception java 2 platform se 50'

distance = 221
spam score = 66
title = 'nosuchmethodexception java 2 platform se v142'

distance = 224
spam score = 65
title = 'arithmeticexception java 2 platform se 50'

distance = 224
spam score = 58
title = 'negativearraysizeexception java 2 platform se 50'

distance = 228
spam score = 61
title = 'classcircularityerror java 2 platform se 50'

distance = 233
spam score = 56
title = 'internalerror java 2 platform se 50'

distance = 233
spam score = 54
title = 'internalerror java 2 platform se 50'

distance = 233
spam score = 54
title = 'unknownerror java 2 platform se 50'

distance = 234
spam score = 58
title = 'stackoverflowerror java 2 platform se 50'

distance = 236
spam score = 58
title = 'virtualmachineerror java 2 platform se 50'

distance = 237
spam score = 62
title = 'classcircularityerror java 2 platform se 50'

distance = 239
spam score = 74
title = 'nosuchmethodexception java 2 platform se 50'

distance = 239
spam score = 68
title = 'negativearraysizeexception java 2 platform se 50'

distance = 240
spam score = 77
title = 'negativearraysizeexception java 2 platform se 50'

distance = 249
spam score = 62
title = 'virtualmachineerror java 2 platform se 50'

distance = 251
spam score = 69
title = 'negativearraysizeexception java 2 platform se v142'

distance = 356
spam score = 79
title = 'numberformatexception java 2 platform se v142'

distance = 356
spam score = 61
title = 'jarexception java 2 platform se v142'

distance = 356
spam score = 57
title = 'brokenbarrierexception java 2 platform se 50'

distance = 357
spam score = 57
title = 'unknownhostexception java 2 platform se v141'

distance = 357
spam score = 64
title = 'cmmexception java platform se 6'

distance = 357
spam score = 59
title = 'jarexception java platform se 6'

distance = 357
spam score = 65
title = 'malformedurlexception java 2 platform se 50'

distance = 358
spam score = 63
title = 'illegalaccesserror java 2 platform se v142'

distance = 358
spam score = 62
title = 'instantiationerror java 2 platform se 50'

distance = 358
spam score = 61
title = 'illegalaccesserror java 2 platform se v142'

distance = 390
spam score = 64
title = 'dataformatexception java 2 platform se v142'

distance = 391
spam score = 55
title = 'illegalaccesserror java 2 platform se v141'

distance = 391
spam score = 69
title = 'noninvertibletransformexception java 2 platform se 50'

distance = 391
spam score = 59
title = 'jarexception java 2 platform se v142'

distance = 391
spam score = 60
title = 'mimetypeparseexception java 2 platform se v142'

distance = 391
spam score = 56
title = 'mimetypeparseexception java platform se 6'

distance = 392
spam score = 67
title = 'unrecoverablekeyexception java 2 platform se 50'

distance = 392
spam score = 65
title = 'charconversionexception java 2 platform se v142'

distance = 392
spam score = 62
title = 'abstractmethoderror java platform se 6'

distance = 393
spam score = 70
title = 'awtexception java 2 platform se v142'

distance = 424
spam score = 56
title = 'awterror java 2 platform se v141'

distance = 424
spam score = 65
title = 'printerexception java 2 platform se v142'

distance = 424
spam score = 64
title = 'jarexception java 2 platform se v142'

distance = 425
spam score = 66
title = 'illegalcomponentstateexception java 2 platform se v142'

distance = 425
spam score = 62
title = 'illegalpathstateexception java 2 platform se v142'

distance = 425
spam score = 71
title = 'ioexception java 2 platform se 50'

distance = 425
spam score = 77
title = 'illegalmonitorstateexception java 2 platform se 50'

distance = 426
spam score = 63
title = 'unsupportedaudiofileexception java 2 platform se v142'

distance = 426
spam score = 63
title = 'backingstoreexception java 2 platform se 50'

distance = 426
spam score = 67
title = 'printerexception java platform se 6'

distance = 470
spam score = 74
title = 'alreadyboundexception java platform se 6'

distance = 470
spam score = 79
title = 'interruptedexception java 2 platform se 50'

distance = 470
spam score = 66
title = 'introspectionexception java 2 platform se 50'

distance = 471
spam score = 65
title = 'badstringoperationexception java platform se 6'

distance = 471
spam score = 66
title = 'syncfailedexception java 2 platform se 50'

distance = 471
spam score = 66
title = 'midiunavailableexception java 2 platform se v141'

distance = 471
spam score = 67
title = 'listenernotfoundexception java 2 platform se 50'

distance = 472
spam score = 53
title = 'noroutetohostexception java 2 platform se 50'

distance = 472
spam score = 74
title = 'interruptedexception java 2 platform se 50'

distance = 472
spam score = 60
title = 'printerabortexception java 2 platform se v141'

distance = 518
spam score = 67
title = 'invalidkeyexception java 2 platform se 50'

distance = 519
spam score = 65
title = 'printerabortexception java 2 platform se v142'

distance = 519
spam score = 69
title = 'illegalmonitorstateexception java 2 platform se v142'

distance = 519
spam score = 60
title = 'connectexception java 2 platform se 50'

distance = 519
spam score = 76
title = 'jmexception java 2 platform se 50'

distance = 520
spam score = 82
title = 'arrayindexoutofboundsexception java platform se 6'

distance = 520
spam score = 16
title = 'ziperror java platform se 6 jdk 5 documentation v60 java 2 sdk java c'

distance = 520
spam score = 57
title = 'invalidkeyexception java platform se 6'

distance = 521
spam score = 59
title = 'interruptedexception java 2 platform se 50'

distance = 522
spam score = 63
title = 'invalidattributevalueexception java platform se 6'

distance = 568
spam score = 53
title = 'nullpointerexception java 2 platform se v142'

distance = 568
spam score = 65
title = 'invalidtargetobjecttypeexception java 2 platform se 50'

distance = 568
spam score = 65
title = 'stringindexoutofboundsexception java 2 platform se 50'

distance = 568
spam score = 64
title = 'rolenotfoundexception java platform se 6'

distance = 568
spam score = 67
title = 'filerexception java platform se 6'

distance = 568
spam score = 67
title = 'relationservicenotregisteredexception java 2 platform se 50'

distance = 568
spam score = 66
title = 'opendataexception java 2 platform se 50'

distance = 569
spam score = 71
title = 'illegalaccessexception java 2 platform se v142'

distance = 569
spam score = 62
title = 'relationtypenotfoundexception java platform se 6'

distance = 569
spam score = 67
title = 'stringindexoutofboundsexception java 2 platform se v142'

distance = 629
spam score = 55
title = 'outofmemoryerror java platform se 6 b86'

distance = 630
spam score = 62
title = 'saxnotsupportedexception java platform se 6'

distance = 631
spam score = 73
title = 'rmisecurityexception java platform se 6'

distance = 631
spam score = 71
title = 'illegalmonitorstateexception java platform se 7 b44'

distance = 632
spam score = 76
title = 'unknowngroupexception java 2 platform se 50'

distance = 632
spam score = 69
title = 'propertyvetoexception java platform se 6'

distance = 633
spam score = 65
title = 'badkind java 2 platform se 50'

distance = 633
spam score = 72
title = 'unknowngroupexception java 2 platform se 50'

distance = 633
spam score = 58
title = 'dataformatexception java platform se 6 b86'

distance = 634
spam score = 61
title = 'numberformatexception java platform se 6 b86'

distance = 742
spam score = 66
title = 'unknownformatflagsexception java platform se 6'

distance = 743
spam score = 53
title = 'parseexception java platform se 7 b48'

distance = 744
spam score = 69
title = 'unknownobjectexception java platform se 6'

distance = 747
spam score = 50
title = 'java 2 platform se v131 class bounds'

distance = 748
spam score = 75
title = 'unknownobjectexception java 2 platform se v142'

distance = 749
spam score = 82
title = 'eventexception java platform se 6'

distance = 749
spam score = 74
title = 'invalidclassexception java 2 platform se v142'

distance = 749
spam score = 60
title = 'missingresourceexception java 2 platform se v142'

distance = 752
spam score = 59
title = 'duplicateformatflagsexception java 2 platform se 50'

distance = 752
spam score = 65
title = 'invalidclassexception java 2 platform se v141'

distance = 1042
spam score = 69
title = 'persiststore java platform se 6'

distance = 1049
spam score = 69
title = 'objadapter java platform se 6'

distance = 1049
spam score = 75
title = 'objadapter java 2 platform se v142'

distance = 1052
spam score = 69
title = 'objadapter java 2 platform se v142'

distance = 1058
spam score = 73
title = 'marshal java 2 platform se v142'

distance = 1059
spam score = 71
title = 'noimplement java 2 platform se v142'

distance = 1062
spam score = 75
title = 'objectnotexist java 2 platform se v142'

distance = 1062
spam score = 73
title = 'marshal java 2 platform se v142'

distance = 1263
spam score = 69
title = 'sqlexception java 2 platform se 50'

distance = 101
spam score = 17
title = 'station info for ah6ja google maps aprs'

distance = 103
spam score = 19
title = 'station info for ab8cb google maps aprs'

distance = 104
spam score = 13
title = 'station info for w6im1 google maps aprs'

distance = 109
spam score = 18
title = 'station info for gm8bpq11 google maps aprs'

distance = 110
spam score = 19
title = 'station info for aa0ku google maps aprs'

distance = 112
spam score = 19
title = 'station info for k0lds10 google maps aprs'

distance = 112
spam score = 23
title = 'station info for ab8cb10 google maps aprs'

distance = 113
spam score = 17
title = 'station info for g8bpq google maps aprs'

distance = 116
spam score = 17
title = 'station info for gm8bpq10 google maps aprs'

distance = 123
spam score = 13
title = 'station info for wa4pam10 google maps aprs'

distance = 125
spam score = 20
title = 'station info for g8bpq10 google maps aprs'

distance = 125
spam score = 20
title = 'station info for al7bx10 google maps aprs'

distance = 126
spam score = 18
title = 'station info for gm8bpq1 google maps aprs'

distance = 127
spam score = 21
title = 'station info for aa0ku10 google maps aprs'

distance = 129
spam score = 21
title = 'station info for ae5v10 google maps aprs'

distance = 129
spam score = 18
title = 'station info for kg4vub10 google maps aprs'

distance = 130
spam score = 18
title = 'station info for gm8bpq12 google maps aprs'

distance = 130
spam score = 16
title = 'station info for kv7j10 google maps aprs'

distance = 131
spam score = 17
title = 'station info for gm8bpq11 google maps aprs'

distance = 131
spam score = 21
title = 'station info for al7cw10 google maps aprs'

distance = 150
spam score = 14
title = 'station info for n9jn10 google maps aprs'

distance = 150
spam score = 18
title = 'station info for 9y4ng10 google maps aprs'

distance = 150
spam score = 13
title = 'station info for kf6gof10 google maps aprs'

distance = 150
spam score = 22
title = 'station info for ad5ca3 google maps aprs'

distance = 150
spam score = 20
title = 'station info for ae5nl10 google maps aprs'

distance = 151
spam score = 17
title = 'station info for k9cb10 google maps aprs'

distance = 152
spam score = 14
title = 'station info for w6sst10 google maps aprs'

distance = 152
spam score = 16
title = 'station info for kg5oo10 google maps aprs'

distance = 153
spam score = 19
title = 'station info for f5cbp10 google maps aprs'

distance = 154
spam score = 16
title = 'station info for kq4uj10 google maps aprs'

distance = 159
spam score = 19
title = 'station info for 2e0okk10 google maps aprs'

distance = 159
spam score = 16
title = 'station info for n5uig10 google maps aprs'

distance = 160
spam score = 14
title = 'station info for w5tux10 google maps aprs'

distance = 160
spam score = 25
title = 'station info for g7crg10 google maps aprs'

distance = 161
spam score = 15
title = 'station info for n6prw10 google maps aprs'

distance = 161
spam score = 14
title = 'station info for ka5tjw10 google maps aprs'

distance = 162
spam score = 22
title = 'station info for ad5ca google maps aprs'

distance = 162
spam score = 15
title = 'station info for n2pqt10 google maps aprs'

distance = 163
spam score = 15
title = 'station info for wa2gug10 google maps aprs'

distance = 163
spam score = 14
title = 'station info for kb7lnr10 google maps aprs'

distance = 170
spam score = 15
title = 'station info for w3qa10 google maps aprs'

distance = 171
spam score = 14
title = 'station info for w5hcs google maps aprs'

distance = 172
spam score = 20
title = 'station info for ai0w google maps aprs'

distance = 174
spam score = 25
title = 'station info for w5hcs10 google maps aprs'

distance = 175
spam score = 26
title = 'station info for ar4nby10 google maps aprs'

distance = 176
spam score = 15
title = 'station info for kc9czh google maps aprs'

distance = 176
spam score = 16
title = 'station info for kb2faf10 google maps aprs'

distance = 177
spam score = 23
title = 'station info for ae5r10 google maps aprs'

distance = 178
spam score = 16
title = 'station info for k0qed google maps aprs'

distance = 179
spam score = 15
title = 'station info for ws7i10 google maps aprs'

distance = 184
spam score = 18
title = 'station info for wa5kxx google maps aprs'

distance = 184
spam score = 28
title = 'station info for g1gxb10 google maps aprs'

distance = 185
spam score = 18
title = 'station info for da5udi10 google maps aprs'

distance = 185
spam score = 15
title = 'station info for w9yyz10 google maps aprs'

distance = 186
spam score = 25
title = 'station info for g4mqb10 google maps aprs'

distance = 186
spam score = 14
title = 'station info for ve3wwt10 google maps aprs'

distance = 188
spam score = 21
title = 'station info for g4zjh10 google maps aprs'

distance = 188
spam score = 22
title = 'station info for g7crg google maps aprs'

distance = 189
spam score = 14
title = 'station info for n4gmt9 google maps aprs'

distance = 189
spam score = 13
title = 'station info for w5tq10 google maps aprs'

distance = 192
spam score = 20
title = 'station info for iw3brc10 google maps aprs'

distance = 192
spam score = 14
title = 'station info for k3ug10 google maps aprs'

distance = 192
spam score = 16
title = 'station info for wa4bds10 google maps aprs'

distance = 197
spam score = 24
title = 'station info for hb9mm8 google maps aprs'

distance = 200
spam score = 14
title = 'station info for n0obg10 google maps aprs'

distance = 202
spam score = 11
title = 'station info for kc8pfc10 google maps aprs'

distance = 203
spam score = 12
title = 'station info for n5sim10 google maps aprs'

distance = 204
spam score = 21
title = 'station info for g0scv10 google maps aprs'

distance = 205
spam score = 15
title = 'station info for kf4i10 google maps aprs'

distance = 206
spam score = 14
title = 'station info for n5abw google maps aprs'

distance = 211
spam score = 21
title = 'station info for hb9mm5 google maps aprs'

distance = 212
spam score = 21
title = 'station info for aa5qj10 google maps aprs'

distance = 212
spam score = 18
title = 'station info for i3xty10 google maps aprs'

distance = 213
spam score = 13
title = 'station info for oe7xlr13 google maps aprs'

distance = 214
spam score = 12
title = 'station info for va3oce1 google maps aprs'

distance = 214
spam score = 17
title = 'station info for ai4ri google maps aprs'

distance = 214
spam score = 16
title = 'station info for kb0srj10 google maps aprs'

distance = 216
spam score = 15
title = 'station info for n3ppc10 google maps aprs'

distance = 217
spam score = 22
title = 'station info for f1bwt10 google maps aprs'

distance = 217
spam score = 19
title = 'station info for ei7ig10 google maps aprs'

distance = 232
spam score = 13
title = 'station info for kc7oas10 google maps aprs'

distance = 233
spam score = 13
title = 'station info for ve3bqp1 google maps aprs'

distance = 233
spam score = 16
title = 'station info for wb3fpl10 google maps aprs'

distance = 233
spam score = 18
title = 'station info for ai4ri10 google maps aprs'

distance = 234
spam score = 13
title = 'station info for pa3gjm google maps aprs'

distance = 236
spam score = 13
title = 'station info for kb0ola10 google maps aprs'

distance = 240
spam score = 16
title = 'station info for pa3gjm10 google maps aprs'

distance = 240
spam score = 14
title = 'station info for w1eo10 google maps aprs'

distance = 241
spam score = 13
title = 'station info for kh2nc10 google maps aprs'

distance = 241
spam score = 22
title = 'station info for ei3rcw10 google maps aprs'

distance = 266
spam score = 14
title = 'station info for n5mtx11 google maps aprs'

distance = 271
spam score = 22
title = 'station info for sv1uy4 google maps aprs'

distance = 279
spam score = 13
title = 'station info for ke7xo10 google maps aprs'

distance = 298
spam score = 21
title = 'station info for ik2xde10 google maps aprs'

distance = 348
spam score = 13
title = 'informacion de estacion para aa3je10 google maps aprs'

distance = 369
spam score = 12
title = 'informacion de estacion para g7crg10 google maps aprs'

distance = 1622
spam score = 76
title = 'the collegiate championship amateur radio contesting'

distance = 1629
spam score = 43
title = 'dem 2004 der schachjugend partien nachspielen'

distance = 1742
spam score = 51
title = 'mephisto master chess'

distance = 1806
spam score = 27
title = ''

distance = 1911
spam score = 6
title = 'behen ki choot li gaand lene ke baad story'

distance = 1920
spam score = 27
title = 'karaden halk mve halk oyunlarinin elllertitle'

distance = 114
spam score = 46
title = 'kpstemmer lucene 220 api'

distance = 122
spam score = 45
title = 'kpstemmer lucene 200 api'

distance = 124
spam score = 50
title = 'spanishstemmer lucene 200 api'

distance = 127
spam score = 49
title = 'englishstemmer lucene 220 api'

distance = 128
spam score = 51
title = 'porterstemmer lucene 200 api'

distance = 129
spam score = 66
title = 'frenchstemmer lucene 200 api'

distance = 129
spam score = 51
title = 'lovinsstemmer lucene 200 api'

distance = 132
spam score = 46
title = 'finnishstemmer lucene 220 api'

distance = 133
spam score = 50
title = 'englishstemmer lucene 210 api'

distance = 136
spam score = 48
title = 'spanishstemmer lucene 230 api'

distance = 136
spam score = 45
title = 'kpstemmer lucene 232 api'

distance = 136
spam score = 48
title = 'kpstemmer lucene 230 api'

distance = 137
spam score = 54
title = 'kpstemmer lucene 230 api'

distance = 138
spam score = 57
title = 'italianstemmer lucene 230 api'

distance = 138
spam score = 56
title = 'portuguesestemmer lucene 230 api'

distance = 139
spam score = 47
title = 'italianstemmer lucene 232 api'

distance = 140
spam score = 46
title = 'italianstemmer lucene 200 api'

distance = 141
spam score = 50
title = 'danishstemmer lucene 230 api'

distance = 141
spam score = 44
title = 'porterstemmer lucene 230 api'

distance = 142
spam score = 43
title = 'germanstemmer lucene 220 api'

distance = 142
spam score = 44
title = 'norwegianstemmer lucene 220 api'

distance = 143
spam score = 48
title = 'lovinsstemmer lucene 230 api'

distance = 143
spam score = 59
title = 'dutchstemmer lucene 200 api'

distance = 144
spam score = 45
title = 'dutchstemmer lucene 220 api'

distance = 144
spam score = 55
title = 'danishstemmer lucene 220 api'

distance = 146
spam score = 47
title = 'russianstemmer lucene 200 api'

distance = 146
spam score = 59
title = 'spanishstemmer lucene 230 api'

distance = 147
spam score = 46
title = 'portuguesestemmer lucene 200 api'

distance = 148
spam score = 57
title = 'swedishstemmer lucene 230 api'

distance = 149
spam score = 57
title = 'englishstemmer lucene 230 api'

distance = 149
spam score = 48
title = 'dutchstemmer lucene 230 api'

distance = 151
spam score = 57
title = 'danishstemmer lucene 230 api'

distance = 151
spam score = 60
title = 'porterstemmer lucene 230 api'

distance = 151
spam score = 50
title = 'germanstemmer lucene 230 api'

distance = 153
spam score = 62
title = 'danishstemmer lucene 200 api'

distance = 154
spam score = 60
title = 'germanstemmer lucene 230 api'

distance = 154
spam score = 60
title = 'finnishstemmer lucene 230 api'

distance = 154
spam score = 47
title = 'swedishstemmer lucene 200 api'

distance = 155
spam score = 59
title = 'dutchstemmer lucene 230 api'

distance = 155
spam score = 56
title = 'germanstemmer lucene 200 api'

distance = 165
spam score = 57
title = 'finnishstemmer lucene 200 api'

distance = 166
spam score = 46
title = 'norwegianstemmer lucene 200 api'

distance = 167
spam score = 60
title = 'russianstemmer lucene 230 api'

distance = 173
spam score = 46
title = 'germanstemmer lucene 232 api'

distance = 175
spam score = 56
title = 'lovinsstemmer lucene 230 api'

distance = 176
spam score = 42
title = 'spanishstemmer lucene 220 api'

distance = 181
spam score = 42
title = 'porterstemmer lucene 220 api'

distance = 188
spam score = 43
title = 'lovinsstemmer lucene 220 api'

distance = 206
spam score = 46
title = 'german2stemmer lucene 230 api'

distance = 211
spam score = 43
title = 'porterstemmer lucene 232 api'

distance = 213
spam score = 45
title = 'russianstemmer lucene 230 api'

distance = 216
spam score = 58
title = 'german2stemmer lucene 230 api'

distance = 222
spam score = 46
title = 'german2stemmer lucene 232 api'

distance = 225
spam score = 42
title = 'russianstemmer lucene 232 api'

distance = 244
spam score = 42
title = 'german2stemmer lucene 220 api'

distance = 291
spam score = 52
title = 'dutchstemmer lucene 201dev api'

distance = 294
spam score = 48
title = 'porterstemmer lucene 201dev api'

distance = 329
spam score = 33
title = 'kpstemmer lucene 200 api'

distance = 342
spam score = 38
title = 'russianstemmer lucene 200 api'

distance = 344
spam score = 42
title = 'dutchstemmer lucene 200 api'

distance = 415
spam score = 51
title = 'frenchstemmer lucene 240 api'

distance = 418
spam score = 52
title = 'dutchstemmer lucene 240 api'

distance = 419
spam score = 50
title = 'hungarianstemmer lucene 240 api'

distance = 421
spam score = 48
title = 'lovinsstemmer lucene 240 api'

distance = 422
spam score = 49
title = 'kpstemmer lucene 240 api'

distance = 426
spam score = 51
title = 'danishstemmer lucene 240 api'

distance = 427
spam score = 48
title = 'porterstemmer lucene 240 api'

distance = 434
spam score = 48
title = 'portuguesestemmer lucene 240 api'

distance = 458
spam score = 48
title = 'finnishstemmer lucene 240 api'

distance = 551
spam score = 51
title = 'lovinsstemmer lucene 240 api'

distance = 560
spam score = 52
title = 'turkishstemmer lucene 240 api'

distance = 563
spam score = 52
title = 'finnishstemmer lucene 240 api'

distance = 564
spam score = 52
title = 'swedishstemmer lucene 240 api'

distance = 567
spam score = 48
title = 'romanianstemmer lucene 240 api'

distance = 567
spam score = 49
title = 'spanishstemmer lucene 240 api'

distance = 568
spam score = 48
title = 'kpstemmer lucene 240 api'

distance = 573
spam score = 51
title = 'englishstemmer lucene 240 api'

distance = 574
spam score = 49
title = 'italianstemmer lucene 240 api'

distance = 575
spam score = 48
title = 'portuguesestemmer lucene 240 api'

distance = 575
spam score = 51
title = 'germanstemmer lucene 240 api'

distance = 581
spam score = 49
title = 'porterstemmer lucene 240 api'

distance = 585
spam score = 48
title = 'russianstemmer lucene 240 api'

distance = 588
spam score = 50
title = 'frenchstemmer lucene 240 api'

distance = 589
spam score = 48
title = 'danishstemmer lucene 240 api'

distance = 590
spam score = 49
title = 'dutchstemmer lucene 240 api'

distance = 635
spam score = 49
title = 'german2stemmer lucene 240 api'

distance = 1034
spam score = 51
title = 'italianstemmer mg4j 212'

distance = 1040
spam score = 51
title = 'spanishstemmer mg4j 212'

distance = 1041
spam score = 49
title = 'danishstemmer mg4j 212'

distance = 1044
spam score = 51
title = 'lovinsstemmer mg4j 212'

distance = 1050
spam score = 49
title = 'porterstemmer mg4j 212'

distance = 1050
spam score = 49
title = 'kraaijpohlmannstemmer mg4j 212'

distance = 1051
spam score = 50
title = 'dutchstemmer mg4j 212'

distance = 1052
spam score = 45
title = 'hungarianstemmer mg4j 212'

distance = 1058
spam score = 52
title = 'germanstemmer mg4j 212'

distance = 1060
spam score = 47
title = 'frenchstemmer mg4j 212'

distance = 1060
spam score = 47
title = 'portuguesestemmer mg4j 212'

distance = 1060
spam score = 47
title = 'finnishstemmer mg4j 212'

distance = 1061
spam score = 46
title = 'norwegianstemmer mg4j 212'

distance = 1066
spam score = 52
title = 'swedishstemmer mg4j 212'

distance = 1071
spam score = 52
title = 'german2stemmer mg4j 212'

distance = 1249
spam score = 52
title = 'uses of class netsfsnowballsnowballprogram lucene 230 api'

distance = 1257
spam score = 48
title = 'uses of class netsfsnowballsnowballprogram lucene 220 api'

distance = 1445
spam score = 53
title = 'contents'

distance = 125
spam score = 55
title = 'uses of class brcomcaelumstellavalidationieieminasgeraisvalidator stella core 12 api'

distance = 129
spam score = 44
title = 'uses of class brcomcaelumstellavalidationieiesaopaulovalidator stella core 12 api'

distance = 131
spam score = 49
title = 'uses of class brcomcaelumstellavalidationcnpjvalidator stella core 12 api'

distance = 131
spam score = 53
title = 'uses of class brcomcaelumstellavalidationieieconstraints stella core 12 api'

distance = 132
spam score = 56
title = 'uses of class brcomcaelumstellavalidationieiealagoasvalidator stella core 12 api'

distance = 132
spam score = 51
title = 'uses of class brcomcaelumstellavalidationtituloeleitoralvalidator stella core 12 api'

distance = 132
spam score = 50
title = 'uses of class brcomcaelumstellavalidationieieamazonasvalidator stella core 12 api'

distance = 134
spam score = 50
title = 'uses of class brcomcaelumstellavalidationieieparaibavalidator stella core 12 api'

distance = 135
spam score = 49
title = 'uses of class brcomcaelumstellavalidationbasevalidator stella core 12 api'

distance = 137
spam score = 56
title = 'uses of class brcomcaelumstellavalidationcpfvalidator stella core 12 api'

distance = 137
spam score = 44
title = 'uses of class brcomcaelumstellavalidationieiebahiavalidator stella core 12 api'

distance = 139
spam score = 50
title = 'uses of class brcomcaelumstellavalidationieieroraimavalidator stella core 12 api'

distance = 139
spam score = 50
title = 'uses of class brcomcaelumstellavalidationieierondoniavalidator stella core 12 api'

distance = 139
spam score = 57
title = 'uses of class brcomcaelumstellavalidationbasevalidator stella core 12 api'

distance = 139
spam score = 56
title = 'uses of class brcomcaelumstellavalidationieieparaibavalidator stella core 12 api'

distance = 140
spam score = 50
title = 'uses of class brcomcaelumstellavalidationieieparavalidator stella core 12 api'

distance = 140
spam score = 50
title = 'uses of class brcomcaelumstellavalidationieieriograndedosulvalidator stella core 12 api'

distance = 141
spam score = 46
title = 'uses of class brcomcaelumstellavalidationieiemaranhaovalidator stella core 12 api'

distance = 141
spam score = 51
title = 'uses of class brcomcaelumstellavalidationieiegoiasvalidator stella core 12 api'

distance = 141
spam score = 56
title = 'uses of class brcomcaelumstellavalidationieiegoiasvalidator stella core 12 api'

distance = 210
spam score = 57
title = 'uses of class brcomcaelumstellaresourcebundlemessageproducer stella core 12 api'

distance = 210
spam score = 47
title = 'uses of class brcomcaelumstellaresourcebundlemessageproducer stella core 12 api'

distance = 213
spam score = 46
title = 'uses of class brcomcaelumstellasimplevalidationmessage stella core 12 api'

distance = 235
spam score = 53
title = 'uses of package brcomcaelumstellafacesvalidation stella faces 12 api'

distance = 238
spam score = 57
title = 'uses of class brcomcaelumstellasimplemessageproducertest stella core 12 test api'

distance = 240
spam score = 51
title = 'uses of package brcomcaelumstellatinytype stella core 12 api'

distance = 269
spam score = 51
title = 'uses of class brcomcaelumstellafacesvalidationstellatituloeleitoralvalidatortag stella faces 12 api'

distance = 271
spam score = 54
title = 'uses of class brcomcaelumstellafacesvalidationstellanitvalidatortag stella faces 12 api'

distance = 272
spam score = 59
title = 'uses of package brcomcaelumstellafacesvalidation stella faces 12 test api'

distance = 272
spam score = 43
title = 'uses of class brcomcaelumstellaformatbaseformatter stella core 12 api'

distance = 281
spam score = 57
title = 'uses of class brcomcaelumstellafacesvalidationstellaievalidator stella faces 12 api'

distance = 281
spam score = 53
title = 'uses of class brcomcaelumstellafacesvalidationstellacnpjvalidatortag stella faces 12 api'

distance = 282
spam score = 46
title = 'uses of class brcomcaelumstellafacesvalidationstellatituloeleitoralvalidatortaghandler stella faces 12 api'

distance = 282
spam score = 56
title = 'uses of class brcomcaelumstellafacesvalidationresourcebundlefinder stella faces 12 api'

distance = 282
spam score = 57
title = 'uses of class brcomcaelumstellafacesvalidationstellanitvalidator stella faces 12 api'

distance = 283
spam score = 50
title = 'overview stella core 12 api'

distance = 283
spam score = 55
title = 'uses of class brcomcaelumstellafacesvalidationstellacpfvalidatortag stella faces 12 api'

distance = 283
spam score = 47
title = 'overview stella core 12 api'

distance = 284
spam score = 43
title = 'uses of class brcomcaelumstellaformatcpfformatter stella core 12 api'

distance = 284
spam score = 60
title = 'uses of package brcomcaelumstellafacesvalidation stella faces 12 api'

distance = 292
spam score = 50
title = 'uses of class brcomcaelumstellahibernatevalidatorstellanitvalidator stella hibernate validator 12 api'

distance = 292
spam score = 58
title = 'uses of class brcomcaelumstellahibernatevalidatorstellanitvalidator stella hibernate validator 12 api'

distance = 293
spam score = 53
title = 'uses of class brcomcaelumstellahibernatevalidatorstellaievalidator stella hibernate validator 12 api'

distance = 294
spam score = 50
title = 'uses of class brcomcaelumstellafacesvalidationstellacnpjvalidator stella faces 12 api'

distance = 295
spam score = 50
title = 'uses of class brcomcaelumstellahibernatevalidatorstellacnpjvalidator stella hibernate validator 12 api'

distance = 295
spam score = 58
title = 'uses of class brcomcaelumstellahibernatevalidatorstellaievalidator stella hibernate validator 12 api'

distance = 296
spam score = 58
title = 'uses of class brcomcaelumstellainwordsformatodeinteiro stella core 12 api'

distance = 297
spam score = 56
title = 'uses of class brcomcaelumstellainwordsformatodereal stella core 12 api'

distance = 301
spam score = 49
title = 'uses of class brcomcaelumstellahibernatevalidatorstellatituloeleitoralvalidator stella hibernate validator 12 api'

distance = 301
spam score = 44
title = 'uses of class brcomcaelumstellainwordsformatodereal stella core 12 api'

distance = 337
spam score = 49
title = 'uses of class brcomcaelumstellaconstraintcnpjconstraints stella core 11 api'

distance = 344
spam score = 57
title = 'uses of class brcomcaelumstellaboletoboletotest stella boleto 12 test api'

distance = 349
spam score = 49
title = 'uses of class brcomcaelumstellaconstraintnitconstraints stella core 11 api'

distance = 360
spam score = 45
title = 'brcomcaelumstellaexample example stella validator 11 api'

distance = 361
spam score = 47
title = 'uses of class brcomcaelumstellaexampleinwordsformatodesegundoscommilesimos example stella validator 11 api'

distance = 366
spam score = 48
title = 'uses of class brcomcaelumstellaboletobancositau stella boleto 12 api'

distance = 369
spam score = 47
title = 'uses of class brcomcaelumstellaboletobancoscaixa stella boleto 12 api'

distance = 369
spam score = 52
title = 'uses of class brcomcaelumstellahibernatevalidatorie stella hibernate validator 12 api'

distance = 369
spam score = 52
title = 'overview stella boleto 12 api'

distance = 371
spam score = 50
title = 'uses of class brcomcaelumstellaboletotransformerpdfboletowriter stella boleto 12 api'

distance = 423
spam score = 57
title = 'brcomcaelumstellaformat class hierarchy stella core 12 test api'

distance = 425
spam score = 46
title = 'uses of class brcomcaelumstellahibernatevalidatorcnpj stella hibernate validator 12 api'

distance = 426
spam score = 47
title = 'uses of class brcomcaelumstellaexamplevalidatorusuariomanager example validator and vraptor 11 api'

distance = 429
spam score = 53
title = 'brcomcaelumstellaboletotransformer stella boleto 12 test api'

distance = 431
spam score = 57
title = 'uses of class brcomcaelumstellaboletobancosbancodobrasiltest stella boleto 12 test api'

distance = 431
spam score = 44
title = 'brcomcaelumstellaexampleinwords example stella validator 11 api'

distance = 432
spam score = 48
title = 'uses of class brcomcaelumstellahibernatevalidatortituloeleitoral stella hibernate validator 12 api'

distance = 434
spam score = 61
title = 'brcomcaelumstellavalidation class hierarchy stella core 12 test api'

distance = 438
spam score = 51
title = 'uses of class brcomcaelumstellahibernatevalidatornit stella hibernate validator 12 api'

distance = 440
spam score = 58
title = 'uses of class brcomcaelumstellaboletoexampleboletostopdfexample example stella boleto 12 api'

distance = 521
spam score = 56
title = 'brcomcaelumstellaboletoexample example stella boleto 12 api'

distance = 533
spam score = 48
title = 'brcomcaelumstellaexamplevalidator class hierarchy example validator and vraptor 11 api'

distance = 545
spam score = 59
title = 'brcomcaelumstella class hierarchy stella core 12 api'

distance = 546
spam score = 59
title = 'uses of class brcomcaelumstellavalidationrotinaparameters stella core 12 api'

distance = 548
spam score = 52
title = 'brcomcaelumstella class hierarchy stella core 12 api'

distance = 549
spam score = 62
title = 'brcomcaelumstellahibernatevalidator stella hibernate validator 12 test api'

distance = 570
spam score = 59
title = 'brcomcaelumstellainwords class hierarchy stella core 12 test api'

distance = 572
spam score = 46
title = 'brcomcaelumstellatype class hierarchy stella core 12 api'

distance = 590
spam score = 43
title = 'uses of class brcomcaelumstellavalidationerrortituloeleitoralerror stella core 12 api'

distance = 596
spam score = 46
title = 'class hierarchy example stella validator 11 api'

distance = 658
spam score = 48
title = 'brcomcaelumstellaboletobancos class hierarchy stella boleto 12 api'

distance = 661
spam score = 44
title = 'brcomcaelumstellavalidationerror class hierarchy stella core 12 api'

distance = 667
spam score = 54
title = 'uses of interface brcomcaelumstellaformatformatter stella core 12 api'

distance = 687
spam score = 54
title = 'brcomcaelumstellatinytype stella core 12 api'

distance = 688
spam score = 56
title = 'brcomcaelumstellahibernatevalidator class hierarchy stella hibernate validator 12 test api'

distance = 690
spam score = 49
title = 'brcomcaelumstellatinytype stella core 12 api'

distance = 697
spam score = 45
title = 'uses of interface brcomcaelumstellavalidationrotinadedigitoverificador stella core 12 api'

distance = 702
spam score = 55
title = 'brcomcaelumstellaboletotransformer class hierarchy stella boleto 12 api'

distance = 727
spam score = 56
title = 'brcomcaelumstellafacesvalidation stella faces 12 test api'

distance = 741
spam score = 59
title = 'brcomcaelumstellaboleto class hierarchy stella boleto 12 api'

distance = 818
spam score = 51
title = 'brcomcaelumstellaboletobancos stella boleto 12 api'

distance = 832
spam score = 54
title = 'brcomcaelumstellavalidation class hierarchy stella core 12 api'

distance = 833
spam score = 47
title = 'brcomcaelumstellavalidation class hierarchy stella core 12 api'

distance = 921
spam score = 52
title = 'brcomcaelumstellaboletotransformer stella boleto 12 api'

distance = 933
spam score = 50
title = 'brcomcaelumstellaboletotransformer stella boleto 12 api'

distance = 934
spam score = 44
title = 'uses of interface brcomcaelumstellaboletobanco stella boleto 12 api'

distance = 948
spam score = 52
title = 'index stella hibernate validator 12 test api'

distance = 990
spam score = 52
title = 'class hierarchy stella boleto 12 api'

distance = 996
spam score = 51
title = 'class hierarchy stella boleto 12 api'

distance = 1110
spam score = 45
title = 'serialized form stella faces 12 api'

distance = 133
spam score = 55
title = 'uses of package orgapachestrutstilestaglibutil struts 1310 api'

distance = 145
spam score = 57
title = 'uses of package orgapachestrutstilestaglibutil struts tiles 1310 api'

distance = 184
spam score = 55
title = 'uses of package orgapachestrutseltaglibtiles struts 1310 api'

distance = 214
spam score = 56
title = 'uses of package orgapachestrutstilescommands struts tiles 1310 api'

distance = 214
spam score = 58
title = 'uses of class orgapachestrutstilestaglibutiltagutils struts 1310 api'

distance = 219
spam score = 54
title = 'uses of package orgapachestrutstilescommands struts 1310 api'

distance = 226
spam score = 56
title = 'uses of package orgapachestrutstilesdefinition struts 1310 api'

distance = 230
spam score = 58
title = 'uses of package orgapachestrutseltaglibtiles struts el 1310 api'

distance = 238
spam score = 55
title = 'orgapachestrutstilestaglibutil struts tiles 1310 api'

distance = 244
spam score = 55
title = 'uses of class orgapachestrutstilesurlcontroller struts 1310 api'

distance = 253
spam score = 51
title = 'orgapachestrutstilestaglibutil struts tiles 1310 api'

distance = 263
spam score = 59
title = 'uses of class orgapachestrutstilescontrollersupport struts 1310 api'

distance = 264
spam score = 54
title = 'uses of class orgapachestrutseltaglibtileselputlisttag struts 1310 api'

distance = 269
spam score = 64
title = 'orgapachestrutstilestaglibutil struts 1310 api'

distance = 271
spam score = 56
title = 'uses of package orgapachestrutstilesdefinition struts 1310 api'

distance = 281
spam score = 57
title = 'uses of class orgapachestrutstilesdefinitionattribute struts 1310 api'

distance = 283
spam score = 56
title = 'uses of class orgapachestrutstilesactioncontroller struts 1310 api'

distance = 283
spam score = 55
title = 'uses of class orgapachestrutstilescommandstilespreprocessor struts 1310 api'

distance = 287
spam score = 55
title = 'uses of package orgapachestrutstilescommands struts 1310 api'

distance = 289
spam score = 54
title = 'uses of package orgapachestrutseltaglibbean struts 1310 api'

distance = 321
spam score = 54
title = 'orgapachestrutstaglib class hierarchy struts 1310 api'

distance = 322
spam score = 53
title = 'uses of class orgapachestrutseltaglibtileselinitdefinitionstag struts el 1310 api'

distance = 324
spam score = 70
title = 'orgapachestrutstilestaglibutil struts 1310 api'

distance = 325
spam score = 57
title = 'uses of package orgapachestrutstaglib struts taglib 1310 api'

distance = 325
spam score = 56
title = 'uses of class orgapachestrutsfacestaglibwritetag struts faces 1310 api'

distance = 327
spam score = 58
title = 'uses of class orgapachestruts2tilesstrutstilescontainerfactory struts 2 tiles plugin 20112 api'

distance = 327
spam score = 63
title = 'orgapachestrutstaglib struts 1310 api'

distance = 330
spam score = 57
title = 'uses of class orgapachestrutstilesbeanssimplemenuitem struts tiles 1310 api'

distance = 331
spam score = 52
title = 'uses of package orgapachestrutstaglib struts 1310 api'

distance = 331
spam score = 54
title = 'uses of class orgapachestrutstaglibhtmlxhtmltag struts 1310 api'

distance = 347
spam score = 56
title = 'uses of package orgapachestrutseltaglibbean struts el 1310 api'

distance = 348
spam score = 55
title = 'uses of class orgapachestrutstilesactionsviewdefinitionsaction struts 1310 api'

distance = 348
spam score = 54
title = 'orgapachestrutstaglib class hierarchy struts taglib 1310 api'

distance = 348
spam score = 62
title = 'orgapachestrutstaglib class hierarchy struts 1310 api'

distance = 349
spam score = 57
title = 'uses of class orgapachestrutstilestaglibimportattributetag struts 1310 api'

distance = 350
spam score = 54
title = 'uses of class orgapachestrutstaglibbeancookietag struts 1310 api'

distance = 352
spam score = 60
title = 'uses of package orgapachestrutseltaglibutils struts el 1310 api'

distance = 354
spam score = 55
title = 'uses of class orgapachestrutseltaglibutilsevalhelper struts 1310 api'

distance = 356
spam score = 52
title = 'overview struts taglib 1310 test api'

distance = 361
spam score = 52
title = 'uses of class orgapachetilesjsptaglibputlistattributetag tiles 2 207 api'

distance = 365
spam score = 55
title = 'uses of package orgapachestrutseltagliblogic struts el 1310 api'

distance = 367
spam score = 45
title = 'uses of class orgapachetilesjsptaglibinserttemplatetag tiles 2 207 api'

distance = 380
spam score = 57
title = 'uses of package orgapachestrutseltaglibutils struts el 1310 api'

distance = 384
spam score = 54
title = 'uses of class orgapachestrutschainconstants struts 1310 api'

distance = 392
spam score = 53
title = 'uses of class orgapachestrutseltaglibbeanelmessagetagbeaninfo struts el 1310 api'

distance = 393
spam score = 63
title = 'orgapachestrutstilescommands struts 1310 api'

distance = 393
spam score = 53
title = 'uses of interface orgapachestrutstaglibnestednestedparentsupport struts 1310 api'

distance = 394
spam score = 55
title = 'orgapachestrutstilescommands class hierarchy struts tiles 1310 api'

distance = 395
spam score = 56
title = 'uses of class orgapachestrutstaglibbeandefinetei struts 1310 api'

distance = 398
spam score = 45
title = 'uses of class orgapachetilesjsptaglibimportattributetag tiles 2 207 api'

distance = 413
spam score = 59
title = 'uses of class orgapachestrutstilestaglibdefinitiontag struts 1310 api'

distance = 413
spam score = 54
title = 'uses of class orgapachestrutseltagliblogicelmessagesnotpresenttagbeaninfo struts 1310 api'

distance = 418
spam score = 57
title = 'uses of package orgapachestrutsfacestaglib struts 1310 api'

distance = 419
spam score = 56
title = 'uses of class orgapachestrutseltaglibutilsevalhelper struts el 1310 api'

distance = 422
spam score = 59
title = 'uses of package orgapachestrutsfacestaglib struts 1310 api'

distance = 427
spam score = 63
title = 'orgapachestrutstilescommands class hierarchy struts 1310 api'

distance = 428
spam score = 54
title = 'uses of class orgapachetilesjsptaglibuseattributetagtei tiles 2 207 api'

distance = 430
spam score = 53
title = 'uses of class orgapachestrutseltaglibhtmleloptionstag struts el 1310 api'

distance = 430
spam score = 52
title = 'uses of class orgapachestrutseltaglibutilsevalhelper struts el 1310 api'

distance = 430
spam score = 54
title = 'uses of class orgapachetilesjsptaglibinsertdefinitiontag tiles 2 212snapshot api'

distance = 453
spam score = 52
title = 'uses of class orgapachestrutseltagliblogicelmatchtagbeaninfo struts el 1310 api'

distance = 455
spam score = 56
title = 'uses of class orgapachestrutseltaglibbeanelincludetagbeaninfo struts el 1310 api'

distance = 455
spam score = 56
title = 'orgapachestrutstaglibtilesutil apache struts api documentation'

distance = 455
spam score = 73
title = 'orgapachestrutseltaglibutils struts 1310 api'

distance = 457
spam score = 60
title = 'uses of class orgapachestrutstilestilesutilstrutsimpl struts 1310 api'

distance = 461
spam score = 55
title = 'orgapachestrutstilesbeans struts tiles 1310 api'

distance = 463
spam score = 73
title = 'orgapachestrutstilesbeans struts 1310 api'

distance = 466
spam score = 51
title = 'uses of class orgapachestrutseltagliblogicelpresenttag struts el 1310 api'

distance = 467
spam score = 61
title = 'overview struts tiles 1310 api'

distance = 478
spam score = 57
title = 'orgapachestrutseltaglibutils class hierarchy struts 1310 api'

distance = 499
spam score = 73
title = 'overview struts tiles 1310 api'

distance = 513
spam score = 67
title = 'orgapachestrutseltaglibutils struts el 1310 api'

distance = 516
spam score = 69
title = 'orgapachestrutstilesdefinition class hierarchy struts 1310 api'

distance = 520
spam score = 74
title = 'orgapachestrutstilesbeans struts 1310 api'

distance = 523
spam score = 55
title = 'orgapachestrutstilestaglibutil struts 138 api'

distance = 524
spam score = 57
title = 'uses of class orgapacheportalsbridgesstrutstaglibelimagetag struts bridge 104 api'

distance = 524
spam score = 63
title = 'apache struts api documentation orgapachestrutstaglibtilesutil class hierarchy'

distance = 529
spam score = 67
title = 'orgapachestrutstilesdefinition struts 1310 api'

distance = 533
spam score = 52
title = 'orgapachestrutseltaglibutils class hierarchy struts el 1310 api'

distance = 534
spam score = 52
title = 'uses of class orgapachestrutstaglibtagutils struts taglib 1310 api'

distance = 607
spam score = 68
title = 'deprecated list struts taglib 1310 api'

distance = 612
spam score = 59
title = 'deprecated list struts taglib 1310 api'

distance = 630
spam score = 63
title = 'uses of interface orgapachestrutstilestaglibaddtagparent struts 1310 api'

distance = 679
spam score = 57
title = 'orgapachestrutstilesactions struts tiles 1310 api'

distance = 701
spam score = 68
title = 'orgapachestrutstilesactions struts 1310 api'

distance = 707
spam score = 73
title = 'orgapachestrutstilesactions struts 1310 api'

distance = 709
spam score = 59
title = 'uses of package orgapachestrutstilesxmldefinition struts 1310 api'

distance = 712
spam score = 59
title = 'uses of class orgapachestrutstilesxmldefinitionxmlattribute struts 1310 api'

distance = 715
spam score = 56
title = 'orgapachestrutstilestaglibutil class hierarchy struts tiles 135 api'

distance = 725
spam score = 55
title = 'uses of package orgapachestrutstilesxmldefinition struts 1310 api'

distance = 830
spam score = 70
title = 'uses of package orgapachetilesjsptaglibdefinition tiles 2 212snapshot api'

distance = 858
spam score = 57
title = 'apache struts api documentation uses of package orgapachestrutstilesxmldefinition'

distance = 865
spam score = 64
title = 'uses of class orgapachetilesjsptaglibtilestag tiles 2 207 api'

distance = 874
spam score = 59
title = 'orgapachestrutsfacestaglib class hierarchy struts faces 1310 api'

distance = 874
spam score = 66
title = 'orgapachestrutsfacestaglib class hierarchy struts 1310 api'

distance = 881
spam score = 59
title = 'uses of interface orgapachestrutstilestaglibputtagparent struts 1310 api'

distance = 890
spam score = 65
title = 'uses of class orgapachestrutstilestaglibputtag struts 1310 api'

distance = 897
spam score = 59
title = 'orgapachestrutseltaglibbean class hierarchy struts 1310 api'

distance = 916
spam score = 58
title = 'uses of class orgapachetilesjsptaglibaddattributetag tiles 2 207 api'

distance = 917
spam score = 54
title = 'orgapachestrutseltaglibbean class hierarchy struts 1310 api'

distance = 1144
spam score = 65
title = 'deprecated list struts tiles 1310 api'

distance = 1201
spam score = 66
title = 'orgapacheshaletiles shale tiles integration 104 api'

distance = 1222
spam score = 68
title = 'apache struts api documentation uses of interface orgapachestrutstilescontroller'

distance = 1224
spam score = 84
title = 'deprecated list struts 1310 api'

distance = 1227
spam score = 81
title = 'deprecated list struts 1310 api'

distance = 1258
spam score = 68
title = 'deprecated list struts tiles 135 api'

distance = 1335
spam score = 68
title = 'uses of class orgapachestrutstilescomponentcontext struts 1310 api'

distance = 218
spam score = 63
title = 'ellinktagbeaninfo struts 1310 api'

distance = 221
spam score = 63
title = 'elbuttontagbeaninfo struts el 1310 api'

distance = 221
spam score = 68
title = 'elbuttontagbeaninfo struts 1310 api'

distance = 223
spam score = 65
title = 'elbuttontagbeaninfo struts el 1310 api'

distance = 223
spam score = 65
title = 'ellinktagbeaninfo struts el 1310 api'

distance = 223
spam score = 65
title = 'elframetagbeaninfo struts 1310 api'

distance = 227
spam score = 60
title = 'eltexttagbeaninfo struts 1310 api'

distance = 228
spam score = 63
title = 'ellinktagbeaninfo struts el 1310 api'

distance = 229
spam score = 66
title = 'elradiotagbeaninfo struts 1310 api'

distance = 230
spam score = 59
title = 'eltexttagbeaninfo struts el 1310 api'

distance = 230
spam score = 64
title = 'elframetagbeaninfo struts el 1310 api'

distance = 230
spam score = 64
title = 'elpasswordtagbeaninfo struts 1310 api'

distance = 230
spam score = 65
title = 'eltexttagbeaninfo struts 1310 api'

distance = 231
spam score = 63
title = 'elsizetagbeaninfo struts el 1310 api'

distance = 232
spam score = 65
title = 'eloptiontagbeaninfo struts el 1310 api'

distance = 232
spam score = 66
title = 'elsizetagbeaninfo struts 1310 api'

distance = 233
spam score = 67
title = 'eltexttagbeaninfo struts el 1310 api'

distance = 234
spam score = 60
title = 'elpasswordtagbeaninfo struts 1310 api'

distance = 235
spam score = 65
title = 'elincludetagbeaninfo struts el 1310 api'

distance = 235
spam score = 66
title = 'elradiotagbeaninfo struts el 1310 api'

distance = 249
spam score = 58
title = 'elmessagestagbeaninfo struts el 1310 api'

distance = 249
spam score = 63
title = 'eloptionscollectiontagbeaninfo struts el 1310 api'

distance = 250
spam score = 64
title = 'elincludetagbeaninfo struts el 1310 api'

distance = 251
spam score = 64
title = 'elsubmittagbeaninfo struts el 1310 api'

distance = 251
spam score = 64
title = 'eliteratetagbeaninfo struts 1310 api'

distance = 252
spam score = 65
title = 'elmessagesnotpresenttagbeaninfo struts 1310 api'

distance = 252
spam score = 62
title = 'elmessagestagbeaninfo struts el 1310 api'

distance = 252
spam score = 60
title = 'elpagetagbeaninfo struts 1310 api'

distance = 253
spam score = 62
title = 'elpasswordtagbeaninfo struts el 1310 api'

distance = 253
spam score = 63
title = 'elredirecttagbeaninfo struts 1310 api'

distance = 256
spam score = 59
title = 'elmessagetagbeaninfo struts el 1310 api'

distance = 257
spam score = 61
title = 'elmessagespresenttagbeaninfo struts 1310 api'

distance = 257
spam score = 61
title = 'elmatchtagbeaninfo struts el 1310 api'

distance = 258
spam score = 58
title = 'elmessagetagbeaninfo struts 1310 api'

distance = 258
spam score = 59
title = 'elpagetagbeaninfo struts 1310 api'

distance = 259
spam score = 65
title = 'elmatchtagbeaninfo struts el 1310 api'

distance = 260
spam score = 58
title = 'elformtagbeaninfo struts 1310 api'

distance = 260
spam score = 65
title = 'elnotmatchtagbeaninfo struts el 1310 api'

distance = 261
spam score = 69
title = 'elforwardtagbeaninfo struts el 1310 api'

distance = 262
spam score = 60
title = 'elmessagetagbeaninfo struts el 1310 api'

distance = 266
spam score = 59
title = 'elstrutstagbeaninfo struts el 1310 api'

distance = 268
spam score = 62
title = 'elgettagbeaninfo struts el 1310 api'

distance = 268
spam score = 61
title = 'elgettagbeaninfo struts el 1310 api'

distance = 269
spam score = 65
title = 'elnotpresenttagbeaninfo struts el 1310 api'

distance = 269
spam score = 62
title = 'elredirecttagbeaninfo struts el 1310 api'

distance = 269
spam score = 66
title = 'elpresenttagbeaninfo struts 1310 api'

distance = 269
spam score = 53
title = 'elerrorstagbeaninfo struts 1310 api'

distance = 270
spam score = 59
title = 'elinitdefinitionstagbeaninfo struts el 1310 api'

distance = 270
spam score = 64
title = 'elnotpresenttagbeaninfo struts el 1310 api'

distance = 270
spam score = 61
title = 'elgettagbeaninfo struts 1310 api'

distance = 276
spam score = 63
title = 'elputlisttagbeaninfo struts el 1310 api'

distance = 276
spam score = 62
title = 'eltextareatagbeaninfo struts 1310 api'

distance = 277
spam score = 59
title = 'elstrutstagbeaninfo struts 1310 api'

distance = 278
spam score = 65
title = 'elpresenttagbeaninfo struts 1310 api'

distance = 279
spam score = 59
title = 'elinserttagbeaninfo struts 1310 api'

distance = 279
spam score = 61
title = 'elinitdefinitionstagbeaninfo struts 1310 api'

distance = 279
spam score = 61
title = 'eluseattributetagbeaninfo struts el 1310 api'

distance = 280
spam score = 63
title = 'elinserttagbeaninfo struts el 1310 api'

distance = 281
spam score = 62
title = 'elcheckboxtagbeaninfo struts el 1310 api'

distance = 282
spam score = 61
title = 'eluseattributetagbeaninfo struts 1310 api'

distance = 289
spam score = 57
title = 'elstrutstagbeaninfo struts 1310 api'

distance = 290
spam score = 67
title = 'elcanceltagbeaninfo struts el 1310 api'

distance = 290
spam score = 61
title = 'elimportattributetagbeaninfo struts 1310 api'

distance = 290
spam score = 57
title = 'elerrorstagbeaninfo struts el 1310 api'

distance = 291
spam score = 68
title = 'elmultiboxtagbeaninfo struts 1310 api'

distance = 291
spam score = 61
title = 'elimportattributetagbeaninfo struts 1310 api'

distance = 292
spam score = 62
title = 'elputtagbeaninfo struts 1310 api'

distance = 292
spam score = 61
title = 'elgetattributetagbeaninfo struts 1310 api'

distance = 293
spam score = 59
title = 'elgetattributetagbeaninfo struts el 1310 api'

distance = 294
spam score = 74
title = 'elincludetagbeaninfo struts 138 api'

distance = 328
spam score = 74
title = 'elstrutstagbeaninfo struts el 136 api'

distance = 337
spam score = 66
title = 'elmultiboxtagbeaninfo struts el 1310 api'

distance = 373
spam score = 64
title = 'elnotmatchtagbeaninfo struts 138 api'

distance = 379
spam score = 63
title = 'eliteratetagbeaninfo struts 138 api'

distance = 394
spam score = 62
title = 'elgettagbeaninfo struts 138 api'

distance = 410
spam score = 61
title = 'eluseattributetagbeaninfo struts 138 api'

distance = 415
spam score = 61
title = 'elinitdefinitionstagbeaninfo struts 138 api'

distance = 600
spam score = 72
title = 'generatorbeaninfo apache chainsaw 1990 api'

distance = 608
spam score = 72
title = 'multicastreceiverbeaninfo apache receivers companion for log4j 12 10snapshot api'

distance = 614
spam score = 71
title = 'jmsreceiverbeaninfo apache receivers companion for log4j 12 10snapshot api'

distance = 999
spam score = 52
title = 'pinstripepainterbeaninfo swinglabs javadoc'

distance = 1000
spam score = 53
title = 'alphapainterbeaninfo swinglabs javadoc'

distance = 1001
spam score = 47
title = 'jxtablebeaninfo swinglabs javadoc'

distance = 1001
spam score = 51
title = 'dropshadowborderbeaninfo swinglabs javadoc'

distance = 1002
spam score = 60
title = 'jxtitledseparatorbeaninfo swinglabs javadoc'

distance = 1002
spam score = 47
title = 'verticallayoutbeaninfo swinglabs javadoc'

distance = 1004
spam score = 51
title = 'jxfindpanelbeaninfo swinglabs javadoc'

distance = 1005
spam score = 53
title = 'jxtreetablebeaninfo swinglabs javadoc'

distance = 1005
spam score = 53
title = 'jxradiogroupbeaninfo swinglabs javadoc'

distance = 1005
spam score = 55
title = 'jxdialogbeaninfo swinglabs javadoc'

distance = 1021
spam score = 53
title = 'jxmultisplitpanebeaninfo swinglabs javadoc'

distance = 1023
spam score = 53
title = 'jxdialogbeaninfo swinglabs javadoc'

distance = 1024
spam score = 53
title = 'jxpanelbeaninfo swinglabs javadoc'

distance = 1026
spam score = 51
title = 'jxfindbarbeaninfo swinglabs javadoc'

distance = 1028
spam score = 49
title = 'textpainterbeaninfo swinglabs javadoc'

distance = 1028
spam score = 57
title = 'compoundpainterbeaninfo swinglabs javadoc'

distance = 1028
spam score = 52
title = 'jxgraphbeaninfo swinglabs javadoc'

distance = 1029
spam score = 53
title = 'jximageviewbeaninfo swinglabs javadoc'

distance = 1029
spam score = 51
title = 'jxbusylabelbeaninfo swinglabs javadoc'

distance = 1030
spam score = 53
title = 'jxtaskpanecontainerbeaninfo swinglabs javadoc'

distance = 1340
spam score = 70
title = 'vehiclepgimpldq'

distance = 181
spam score = 47
title = 'deprecated list geotechnical software services api specification'

distance = 181
spam score = 49
title = 'deprecated list geotechnical software services api specification'

distance = 181
spam score = 47
title = 'deprecated list geotechnical software services api specification'

distance = 181
spam score = 47
title = 'deprecated list geotechnical software services api specification'

distance = 185
spam score = 37
title = 'nindex geotechnical software services api specification'

distance = 187
spam score = 45
title = 'deprecated list geotechnical software services api specification'

distance = 195
spam score = 47
title = 'deprecated list geotechnical software services api specification'

distance = 203
spam score = 47
title = 'deprecated list geotechnical software services api specification'

distance = 206
spam score = 48
title = 'deprecated list geotechnical software services api specification'

distance = 208
spam score = 40
title = 'nindex geotechnical software services api specification'

distance = 211
spam score = 36
title = 'nindex geotechnical software services api specification'

distance = 212
spam score = 44
title = 'nindex geotechnical software services api specification'

distance = 216
spam score = 46
title = 'deprecated list geotechnical software services api specification'

distance = 217
spam score = 40
title = 'nindex geotechnical software services api specification'

distance = 219
spam score = 44
title = 'deprecated list geotechnical software services api specification'

distance = 225
spam score = 39
title = 'rindex geotechnical software services api specification'

distance = 225
spam score = 42
title = 'mindex geotechnical software services api specification'

distance = 226
spam score = 40
title = 'mindex geotechnical software services api specification'

distance = 231
spam score = 39
title = 'nindex geotechnical software services api specification'

distance = 234
spam score = 47
title = 'nindex geotechnical software services api specification'

distance = 283
spam score = 45
title = 'aindex geotechnical software services api specification'

distance = 284
spam score = 52
title = 'uses of package nogeosoftccutil geotechnical software services api specification'

distance = 284
spam score = 39
title = 'sindex geotechnical software services api specification'

distance = 288
spam score = 45
title = 'deprecated list geotechnical software services api specification'

distance = 289
spam score = 43
title = 'class hierarchy geotechnical software services api specification'

distance = 289
spam score = 45
title = 'gindex geotechnical software services api specification'

distance = 290
spam score = 34
title = 'tindex geotechnical software services api specification'

distance = 294
spam score = 36
title = 'aindex geotechnical software services api specification'

distance = 295
spam score = 45
title = 'nogeosoftccio class hierarchy geotechnical software services api specification'

distance = 296
spam score = 41
title = 'rindex geotechnical software services api specification'

distance = 323
spam score = 44
title = 'aindex geotechnical software services api specification'

distance = 323
spam score = 52
title = 'uses of package nogeosoftccutil geotechnical software services api specification'

distance = 323
spam score = 52
title = 'uses of package nogeosoftccgeometryspline geotechnical software services api specification'

distance = 325
spam score = 46
title = 'nogeosoftccutil class hierarchy geotechnical software services api specification'

distance = 326
spam score = 46
title = 'uses of class nogeosoftcciofilemonitor geotechnical software services api specification'

distance = 327
spam score = 43
title = 'uses of class nogeosoftccdirectoryfilesystemmodel geotechnical software services api specification'

distance = 331
spam score = 46
title = 'class hierarchy geotechnical software services api specification'

distance = 332
spam score = 49
title = 'uses of class nogeosoftcciogifencoder geotechnical software services api specification'

distance = 341
spam score = 34
title = 'mindex geotechnical software services api specification'

distance = 343
spam score = 43
title = 'eindex geotechnical software services api specification'

distance = 365
spam score = 44
title = 'vindex geotechnical software services api specification'

distance = 366
spam score = 45
title = 'nogeosoftcccountry class hierarchy geotechnical software services api specification'

distance = 368
spam score = 42
title = 'class hierarchy geotechnical software services api specification'

distance = 368
spam score = 59
title = 'deprecated list geotechnical software services api specification'

distance = 369
spam score = 45
title = 'nogeosoftccgeometryspline class hierarchy geotechnical software services api specification'

distance = 370
spam score = 47
title = 'uses of class nogeosoftccgeometrysplinesplinefactory geotechnical software services api specification'

distance = 372
spam score = 42
title = 'class hierarchy geotechnical software services api specification'

distance = 375
spam score = 53
title = 'nogeosoftccdirectory geotechnical software services api specification'

distance = 375
spam score = 43
title = 'nindex geotechnical software services api specification'

distance = 375
spam score = 41
title = 'aindex geotechnical software services api specification'

distance = 403
spam score = 48
title = 'uses of class nogeosoftcclocaletimezonemanager geotechnical software services api specification'

distance = 405
spam score = 48
title = 'nogeosoftcclocale class hierarchy geotechnical software services api specification'

distance = 409
spam score = 55
title = 'nogeosoftccgeometry geotechnical software services api specification'

distance = 414
spam score = 47
title = 'sindex geotechnical software services api specification'

distance = 415
spam score = 40
title = 'uses of class nogeosoftcceventeventmanager geotechnical software services api specification'

distance = 419
spam score = 42
title = 'nogeosoftccio geotechnical software services api specification'

distance = 419
spam score = 48
title = 'uindex geotechnical software services api specification'

distance = 420
spam score = 47
title = 'uses of class nogeosoftccutilbyteswapper geotechnical software services api specification'

distance = 424
spam score = 47
title = 'class hierarchy geotechnical software services api specification'

distance = 431
spam score = 59
title = 'nogeosoftccevent geotechnical software services api specification'

distance = 472
spam score = 53
title = 'nogeosoftccutil geotechnical software services api specification'

distance = 473
spam score = 38
title = 'nindex geotechnical software services api specification'

distance = 480
spam score = 50
title = 'uses of package nogeosoftcccurrency geotechnical software services api specification'

distance = 483
spam score = 45
title = 'nogeosoftccio class hierarchy geotechnical software services api specification'

distance = 485
spam score = 57
title = 'nogeosoftcccountry geotechnical software services api specification'

distance = 487
spam score = 44
title = 'uses of class nogeosoftcccountrycountrymanager geotechnical software services api specification'

distance = 490
spam score = 36
title = 'tindex geotechnical software services api specification'

distance = 492
spam score = 51
title = 'class hierarchy geotechnical software services api specification'

distance = 500
spam score = 38
title = 'pindex geotechnical software services api specification'

distance = 504
spam score = 35
title = 'gindex geotechnical software services api specification'

distance = 552
spam score = 42
title = 'eindex geotechnical software services api specification'

distance = 561
spam score = 47
title = 'uses of package nogeosoftccgeometry geotechnical software services api specification'

distance = 563
spam score = 48
title = 'uses of class nogeosoftccgraphicsgworldextent geotechnical software services api specification'

distance = 563
spam score = 59
title = 'nogeosoftccgeometry geotechnical software services api specification'

distance = 563
spam score = 44
title = 'constant field values geotechnical software services api specification'

distance = 567
spam score = 48
title = 'uses of package nogeosoftccutil geotechnical software services api specification'

distance = 573
spam score = 39
title = 'cindex geotechnical software services api specification'

distance = 575
spam score = 40
title = 'gindex geotechnical software services api specification'

distance = 577
spam score = 45
title = 'gindex geotechnical software services api specification'

distance = 580
spam score = 62
title = 'nogeosoftccutil geotechnical software services api specification'

distance = 725
spam score = 54
title = 'uses of class nogeosoftccgraphicsgtransformer geotechnical software services api specification'

distance = 726
spam score = 36
title = 'lindex geotechnical software services api specification'

distance = 729
spam score = 49
title = 'uses of class nogeosoftccgraphicsgcomponent geotechnical software services api specification'

distance = 730
spam score = 59
title = 'uses of package nogeosoftccgeometry geotechnical software services api specification'

distance = 731
spam score = 49
title = 'uses of class nogeosoftcccountrycountry geotechnical software services api specification'

distance = 731
spam score = 44
title = 'uses of interface nogeosoftcclocalelocalelistener geotechnical software services api specification'

distance = 738
spam score = 48
title = 'bindex geotechnical software services api specification'

distance = 741
spam score = 48
title = 'uses of interface nogeosoftccgraphicsginteraction geotechnical software services api specification'

distance = 743
spam score = 47
title = 'uses of class nogeosoftccutiltime geotechnical software services api specification'

distance = 746
spam score = 42
title = 'uses of interface nogeosoftcclocaletimezonelistener geotechnical software services api specification'

distance = 870
spam score = 41
title = 'mindex geotechnical software services api specification'

distance = 872
spam score = 44
title = 'iindex geotechnical software services api specification'

distance = 872
spam score = 55
title = 'uses of class nogeosoftccgraphicsgimage geotechnical software services api specification'

distance = 878
spam score = 66
title = 'nogeosoftccgraphics class hierarchy geotechnical software services api specification'

distance = 883
spam score = 45
title = 'windex geotechnical software services api specification'

distance = 886
spam score = 42
title = 'iindex geotechnical software services api specification'

distance = 906
spam score = 46
title = 'uses of class nogeosoftccgeometryvector4 geotechnical software services api specification'

distance = 908
spam score = 43
title = 'zindex geotechnical software services api specification'

distance = 909
spam score = 41
title = 'sindex geotechnical software services api specification'

distance = 915
spam score = 49
title = 'dindex geotechnical software services api specification'

distance = 1126
spam score = 50
title = 'gindex geotechnical software services api specification'

distance = 1191
spam score = 49
title = 'gindex geotechnical software services api specification'

distance = 1191
spam score = 47
title = 'rindex geotechnical software services api specification'

distance = 1201
spam score = 48
title = 'uses of class nogeosoftccgraphicsgsegment geotechnical software services api specification'

distance = 1322
spam score = 46
title = 'uses of class nogeosoftccdirectorydirectoryentry geotechnical software services api specification'

distance = 1372
spam score = 45
title = 'cindex geotechnical software services api specification'

distance = 1811
spam score = 15
title = 'weapons index b'

distance = 156
spam score = 46
title = 'uses of package govnasajploodtcasfilemgrsystem catalog and archive file management component 172 api'

distance = 164
spam score = 47
title = 'uses of package govnasajploodtcasfilemgrcatalog catalog and archive file management component 172 test api'

distance = 168
spam score = 48
title = 'uses of package govnasajploodtcasfilemgrvalidation catalog and archive file management component 172 test api'

distance = 169
spam score = 46
title = 'uses of package govnasajploodtcasfilemgrtools catalog and archive file management component 172 test api'

distance = 177
spam score = 46
title = 'uses of package govnasajploodtcasfilemgrutil catalog and archive file management component 172 test api'

distance = 179
spam score = 48
title = 'govnasajploodtcasfilemgrmetadata catalog and archive file management component 172 api'

distance = 179
spam score = 50
title = 'uses of package govnasajploodtcasfilemgrutil catalog and archive file management component 172 api'

distance = 179
spam score = 48
title = 'govnasajploodtcasfilemgrvalidation catalog and archive file management component 172 test api'

distance = 179
spam score = 48
title = 'govnasajploodtcasfilemgrrepository catalog and archive file management component 172 test api'

distance = 184
spam score = 50
title = 'govnasajploodtcasfilemgrsystem catalog and archive file management component 172 api'

distance = 185
spam score = 50
title = 'uses of package govnasajploodtcasfilemgrstructs catalog and archive file management component 172 test api'

distance = 189
spam score = 45
title = 'govnasajploodtcasfilemgrsystem catalog and archive file management component 172 test api'

distance = 199
spam score = 48
title = 'govnasajploodtcasfilemgrcatalog catalog and archive file management component 172 test api'

distance = 218
spam score = 47
title = 'govnasajploodtcasfilemgrstructs catalog and archive file management component 172 test api'

distance = 221
spam score = 45
title = 'govnasajploodtcasfilemgrtools catalog and archive file management component 172 test api'

distance = 222
spam score = 48
title = 'uses of package govnasajploodtcasfilemgrstructstype catalog and archive file management component 172 test api'

distance = 227
spam score = 45
title = 'govnasajploodtcasfilemgrdatatransfer catalog and archive file management component 172 test api'

distance = 234
spam score = 45
title = 'govnasajploodtcasfilemgrmetadata class hierarchy catalog and archive file management component 172 api'

distance = 236
spam score = 50
title = 'govnasajploodtcasfilemgrstructstype catalog and archive file management component 172 test api'

distance = 240
spam score = 49
title = 'govnasajploodtcasfilemgrutil catalog and archive file management component 172 test api'

distance = 278
spam score = 45
title = 'uses of class govnasajploodtcasfilemgrdatatransfertestinplacedatatransferer catalog and archive file management component 172 test api'

distance = 280
spam score = 50
title = 'uses of class govnasajploodtcasfilemgrstructstestproduct catalog and archive file management component 172 test api'

distance = 281
spam score = 45
title = 'govnasajploodtcasfilemgringest catalog and archive file management component 172 test api'

distance = 282
spam score = 44
title = 'uses of class govnasajploodtcasfilemgringestteststdingester catalog and archive file management component 172 test api'

distance = 286
spam score = 43
title = 'uses of package govnasajploodtcasfilemgrdatatransfer catalog and archive file management component 172 api'

distance = 286
spam score = 52
title = 'govnasajploodtcasfilemgrsystem class hierarchy catalog and archive file management component 172 api'

distance = 289
spam score = 46
title = 'uses of class govnasajploodtcasfilemgringesttestrmicache catalog and archive file management component 172 test api'

distance = 295
spam score = 44
title = 'govnasajploodtcasfilemgrmetadataextractors catalog and archive file management component 172 test api'

distance = 300
spam score = 47
title = 'govnasajploodtcasfilemgrmetadataextractorsexamples catalog and archive file management component 172 api'

distance = 305
spam score = 42
title = 'govnasajploodtcasfilemgrvalidation catalog and archive file management component 172 api'

distance = 347
spam score = 51
title = 'govnasajploodtcasfilemgrmetadataextractors catalog and archive file management component 172 api'

distance = 349
spam score = 49
title = 'govnasajploodtcasfilemgrcatalog catalog and archive file management component 172 api'

distance = 356
spam score = 46
title = 'uses of package govnasajploodtcasfilemgrcatalog catalog and archive file management component 172 api'

distance = 356
spam score = 53
title = 'govnasajploodtcasfilemgrstructsqueryfilter catalog and archive file management component 172 api'

distance = 365
spam score = 51
title = 'govnasajploodtcasfilemgrversioningexamples class hierarchy catalog and archive file management component 172 api'

distance = 368
spam score = 50
title = 'govnasajploodtcasfilemgrstructsqueryconv catalog and archive file management component 172 api'

distance = 376
spam score = 45
title = 'uses of package govnasajploodtcasfilemgringest catalog and archive file management component 172 api'

distance = 377
spam score = 48
title = 'govnasajploodtcasresourceutil catalog and archive resource management component 131 test api'

distance = 379
spam score = 47
title = 'uses of class govnasajploodtcasfilemgrmetadataextractorsexamplesmimetypeextractor catalog and archive file management component 172 api'

distance = 383
spam score = 50
title = 'uses of package govnasajploodtcasfilemgrstructsqueryconv catalog and archive file management component 172 api'

distance = 424
spam score = 46
title = 'govnasajploodtcasworkflowmetadata catalog and archive workflow management component 151 api'

distance = 425
spam score = 46
title = 'govnasajploodtcasworkflowengine catalog and archive workflow management component 151 test api'

distance = 428
spam score = 44
title = 'govnasajploodtcasworkflowexamples catalog and archive workflow management component 151 test api'

distance = 433
spam score = 54
title = 'govnasajploodtcasfilemgrrepository class hierarchy catalog and archive file management component 172 test api'

distance = 435
spam score = 50
title = 'overview catalog and archive resource management component 131 test api'

distance = 437
spam score = 49
title = 'uses of package govnasajploodtcasfilemgrmetadataextractors catalog and archive file management component 172 api'

distance = 440
spam score = 48
title = 'govnasajploodtcasworkflowrepository catalog and archive workflow management component 151 test api'

distance = 442
spam score = 49
title = 'uses of class govnasajploodtcasresourcemonitortestassignmentmonitor catalog and archive resource management component 131 test api'

distance = 442
spam score = 52
title = 'govnasajploodtcasfilemgrstructsmime catalog and archive file management component 172 api'

distance = 442
spam score = 57
title = 'govnasajploodtcasfilemgrstructs class hierarchy catalog and archive file management component 172 test api'

distance = 454
spam score = 54
title = 'govnasajploodtcasfilemgrsystem class hierarchy catalog and archive file management component 172 test api'

distance = 458
spam score = 50
title = 'overview catalog and archive workflow management component 151 test api'

distance = 464
spam score = 58
title = 'govnasajploodtcasfilemgrcatalog class hierarchy catalog and archive file management component 172 test api'

distance = 467
spam score = 48
title = 'uses of class govnasajploodtcasresourceutiljobbuilder catalog and archive resource management component 131 api'

distance = 469
spam score = 48
title = 'govnasajploodtcasresourcescheduler catalog and archive resource management component 131 api'

distance = 471
spam score = 48
title = 'uses of package govnasajploodtcasfilemgrstructsmime catalog and archive file management component 172 api'

distance = 471
spam score = 48
title = 'uses of class govnasajploodtcasresourcejobqueuetestjobstack catalog and archive resource management component 131 test api'

distance = 471
spam score = 53
title = 'govnasajploodtcasfilemgrtools class hierarchy catalog and archive file management component 172 test api'

distance = 476
spam score = 46
title = 'govnasajploodtcasresourcejobqueue catalog and archive resource management component 131 api'

distance = 477
spam score = 49
title = 'govnasajploodtcasfilemgrstructstypeexamples catalog and archive file management component 172 api'

distance = 503
spam score = 50
title = 'govnasajploodtcasfilemgrstructs class hierarchy catalog and archive file management component 172 api'

distance = 505
spam score = 51
title = 'govnasajploodtcasfilemgrrepository class hierarchy catalog and archive file management component 172 api'

distance = 511
spam score = 53
title = 'govnasajploodtcasfilemgringest class hierarchy catalog and archive file management component 172 test api'

distance = 512
spam score = 55
title = 'govnasajploodtcasfilemgrversioning class hierarchy catalog and archive file management component 172 test api'

distance = 517
spam score = 47
title = 'govnasajploodtcasresourcebatchmgr catalog and archive resource management component 131 api'

distance = 517
spam score = 49
title = 'govnasajploodtcasresourcestructs catalog and archive resource management component 131 api'

distance = 525
spam score = 55
title = 'govnasajploodtcasworkflowsystem class hierarchy catalog and archive workflow management component 151 api'

distance = 527
spam score = 57
title = 'overview catalog and archive workflow management component 151 api'

distance = 534
spam score = 59
title = 'deprecated list catalog and archive file management component 172 test api'

distance = 542
spam score = 45
title = 'govnasajploodtcascrawlcomparator catalog and archive crawling framework 221 api'

distance = 572
spam score = 55
title = 'overview catalog and archive resource management component 131 api'

distance = 572
spam score = 48
title = 'govnasajploodtcasmetadatautil catalog and archive service generic multivalued metadata container 161 test api'

distance = 576
spam score = 54
title = 'deprecated list catalog and archive file management component 172 api'

distance = 577
spam score = 54
title = 'govnasajploodtcasfilemgrmetadataextractors class hierarchy catalog and archive file management component 172 test api'

distance = 581
spam score = 52
title = 'uses of package govnasajploodtcascrawloption catalog and archive crawling framework 221 test api'

distance = 583
spam score = 69
title = 'overview catalog and archive file management component 172 api'

distance = 588
spam score = 49
title = 'uses of class govnasajploodtcasmetadatatestmetadata catalog and archive service generic multivalued metadata container 161 test api'

distance = 607
spam score = 54
title = 'govnasajploodtcascrawloption catalog and archive crawling framework 221 test api'

distance = 609
spam score = 48
title = 'uses of class govnasajploodtcascrawloptioncmdlineoptionjavaprophandler catalog and archive crawling framework 221 api'

distance = 614
spam score = 51
title = 'overview catalog and archive service generic multivalued metadata container 161 api'

distance = 644
spam score = 48
title = 'uses of class govnasajploodtcasmetadatautilgenericmetadataobjectfactory catalog and archive service generic multivalued metadata container 161 api'

distance = 654
spam score = 48
title = 'govnasajploodtcasworkflowstructs catalog and archive workflow management component 151 api'

distance = 654
spam score = 53
title = 'uses of class govnasajploodtcascrawlconfigproductcrawlerbean catalog and archive crawling framework 221 api'

distance = 659
spam score = 50
title = 'deprecated list catalog and archive resource management component 131 test api'

distance = 666
spam score = 49
title = 'uses of class govnasajploodtcascrawltypedetectionmimeextractorrepo catalog and archive crawling framework 221 api'

distance = 675
spam score = 51
title = 'index catalog and archive crawling framework 221 test api'

distance = 683
spam score = 51
title = 'uses of interface govnasajploodtcasmetadatapreconditionspreconditionoperatormetkeys catalog and archive service generic multivalued metadata container 161 api'

distance = 687
spam score = 52
title = 'govnasajploodtcasmetadatautil class hierarchy catalog and archive service generic multivalued metadata container 161 api'

distance = 692
spam score = 47
title = 'govnasajploodtcasmetadatapreconditions catalog and archive service generic multivalued metadata container 161 api'

distance = 701
spam score = 50
title = 'constant field values catalog and archive file management component 172 test api'

distance = 780
spam score = 47
title = 'uses of class govnasajploodtserverremote remote control 102 api'

distance = 781
spam score = 51
title = 'govnasajploodtserver remote control 102 api'

distance = 782
spam score = 45
title = 'uses of class govnasajploodtxmlrpcproxyxmlrpcserver xmlrpc proxy 101 api'

distance = 787
spam score = 55
title = 'govnasajploodtcasworkflowinstrepo class hierarchy catalog and archive workflow management component 151 api'

distance = 787
spam score = 49
title = 'uses of class govnasajploodtrmirmiregistry rmi registry 100 api'

distance = 793
spam score = 50
title = 'govnasajploodtxmlrpc class hierarchy xmlrpc proxy 101 api'

distance = 800
spam score = 51
title = 'govnasajploodtserver class hierarchy remote control 102 api'

distance = 819
spam score = 55
title = 'govnasajploodtxmlrpc xmlrpc proxy 101 api'

distance = 830
spam score = 51
title = 'class hierarchy catalog and archive workflow management component 151 test api'

distance = 855
spam score = 43
title = 'govnasajploodtedrnresources edrn resource search 000 api'

distance = 1171
spam score = 54
title = 'filemgrmetextractor catalog and archive file management component 172 api'

distance = 1224
spam score = 50
title = 'jpledaarchive catalog and archive service 202 api'

distance = 1236
spam score = 58
title = 'govnasajploodtgrid web grid 120 api'

distance = 1354
spam score = 57
title = 'stdproductcrawler catalog and archive crawling framework 221 api'

distance = 1405
spam score = 51
title = 'autodetectproductcrawler catalog and archive crawling framework 221 api'

distance = 1563
spam score = 52
title = 'deprecated list scheduler api'

distance = 141
spam score = 64
title = ''

distance = 148
spam score = 66
title = ''

distance = 180
spam score = 60
title = ''

distance = 185
spam score = 72
title = ''

distance = 191
spam score = 68
title = ''

distance = 207
spam score = 62
title = ''

distance = 208
spam score = 65
title = ''

distance = 215
spam score = 60
title = ''

distance = 223
spam score = 59
title = ''

distance = 229
spam score = 58
title = ''

distance = 236
spam score = 59
title = ''

distance = 239
spam score = 63
title = ''

distance = 240
spam score = 70
title = ''

distance = 240
spam score = 68
title = ''

distance = 242
spam score = 67
title = ''

distance = 247
spam score = 61
title = ''

distance = 248
spam score = 63
title = ''

distance = 248
spam score = 60
title = ''

distance = 252
spam score = 57
title = ''

distance = 256
spam score = 68
title = ''

distance = 260
spam score = 59
title = ''

distance = 263
spam score = 63
title = ''

distance = 264
spam score = 57
title = ''

distance = 266
spam score = 59
title = ''

distance = 270
spam score = 59
title = ''

distance = 273
spam score = 71
title = ''

distance = 274
spam score = 65
title = ''

distance = 279
spam score = 63
title = ''

distance = 284
spam score = 59
title = ''

distance = 297
spam score = 65
title = ''

distance = 299
spam score = 63
title = ''

distance = 302
spam score = 66
title = ''

distance = 304
spam score = 57
title = ''

distance = 308
spam score = 71
title = ''

distance = 311
spam score = 67
title = ''

distance = 314
spam score = 59
title = ''

distance = 314
spam score = 68
title = ''

distance = 317
spam score = 63
title = ''

distance = 332
spam score = 65
title = ''

distance = 334
spam score = 61
title = ''

distance = 338
spam score = 58
title = ''

distance = 341
spam score = 72
title = ''

distance = 346
spam score = 64
title = ''

distance = 352
spam score = 63
title = ''

distance = 352
spam score = 67
title = ''

distance = 353
spam score = 66
title = ''

distance = 362
spam score = 67
title = ''

distance = 363
spam score = 61
title = ''

distance = 364
spam score = 59
title = ''

distance = 367
spam score = 69
title = ''

distance = 367
spam score = 65
title = ''

distance = 370
spam score = 68
title = ''

distance = 381
spam score = 62
title = ''

distance = 383
spam score = 75
title = ''

distance = 385
spam score = 65
title = ''

distance = 392
spam score = 71
title = ''

distance = 400
spam score = 69
title = ''

distance = 404
spam score = 71
title = ''

distance = 404
spam score = 70
title = ''

distance = 413
spam score = 60
title = ''

distance = 421
spam score = 74
title = ''

distance = 423
spam score = 62
title = ''

distance = 425
spam score = 68
title = ''

distance = 427
spam score = 56
title = ''

distance = 429
spam score = 63
title = ''

distance = 444
spam score = 66
title = ''

distance = 461
spam score = 72
title = ''

distance = 461
spam score = 63
title = ''

distance = 466
spam score = 63
title = ''

distance = 466
spam score = 71
title = ''

distance = 488
spam score = 59
title = ''

distance = 493
spam score = 62
title = ''

distance = 494
spam score = 73
title = ''

distance = 503
spam score = 71
title = ''

distance = 524
spam score = 65
title = ''

distance = 559
spam score = 60
title = ''

distance = 569
spam score = 68
title = ''

distance = 586
spam score = 69
title = ''

distance = 587
spam score = 61
title = ''

distance = 587
spam score = 68
title = ''

distance = 603
spam score = 72
title = ''

distance = 659
spam score = 59
title = ''

distance = 666
spam score = 78
title = ''

distance = 701
spam score = 59
title = ''

distance = 760
spam score = 67
title = ''

distance = 799
spam score = 74
title = ''

distance = 836
spam score = 66
title = ''

distance = 847
spam score = 75
title = ''

distance = 914
spam score = 62
title = ''

distance = 915
spam score = 64
title = ''

distance = 933
spam score = 53
title = ''

distance = 1032
spam score = 62
title = ''

distance = 1134
spam score = 65
title = ''

distance = 1206
spam score = 57
title = ''

distance = 1222
spam score = 52
title = ''

distance = 1232
spam score = 67
title = ''

distance = 1239
spam score = 70
title = ''

distance = 1440
spam score = 61
title = ''

distance = 1466
spam score = 68
title = ''

distance = 1845
spam score = 5
title = ''

distance = 117
spam score = 68
title = 'scarabmodulemapbuilder scarab 10b21dev api'

distance = 119
spam score = 70
title = 'rattributeattributegroupmapbuilder scarab 10b21dev api'

distance = 120
spam score = 70
title = 'rattributeattributegroupmapbuilder scarab 10b21dev api'

distance = 121
spam score = 66
title = 'uservotemapbuilder scarab 10b21dev api'

distance = 123
spam score = 71
title = 'issuevotemapbuilder scarab 10b21dev api'

distance = 124
spam score = 69
title = 'attachmenttypemapbuilder scarab 10b21dev api'

distance = 125
spam score = 69
title = 'activitysettypemapbuilder scarab 10b21dev api'

distance = 126
spam score = 68
title = 'issuevotemapbuilder scarab 10b21dev api'

distance = 126
spam score = 68
title = 'dependmapbuilder scarab 10b21dev api'

distance = 128
spam score = 70
title = 'mitlistmapbuilder scarab 10b21dev api'

distance = 128
spam score = 73
title = 'activitysettypemapbuilder scarab 10b21dev api'

distance = 129
spam score = 70
title = 'modificationmapbuilder scarab 10b21dev api'

distance = 129
spam score = 70
title = 'querymapbuilder scarab 10b21dev api'

distance = 129
spam score = 69
title = 'scopemapbuilder scarab 10b21dev api'

distance = 129
spam score = 66
title = 'notificationdefaultfiltermapbuilder scarab 10b21dev api'

distance = 130
spam score = 72
title = 'querymapbuilder scarab 10b21dev api'

distance = 130
spam score = 72
title = 'reportmapbuilder scarab 10b21dev api'

distance = 130
spam score = 71
title = 'modificationmapbuilder scarab 10b21dev api'

distance = 132
spam score = 66
title = 'notificationdefaultfiltermapbuilder scarab 10b21dev api'

distance = 133
spam score = 69
title = 'dependtypemapbuilder scarab 10b21dev api'

distance = 136
spam score = 66
title = 'rqueryusermapbuilder scarab 10b21dev api'

distance = 136
spam score = 70
title = 'rissuetypeoptionmapbuilder scarab 10b21dev api'

distance = 136
spam score = 66
title = 'issuetemplateinfomapbuilder scarab 10b21dev api'

distance = 136
spam score = 69
title = 'issuetemplateinfomapbuilder scarab 10b21dev api'

distance = 136
spam score = 72
title = 'rmoduleattributemapbuilder scarab 10b21dev api'

distance = 136
spam score = 70
title = 'attributegroupmapbuilder scarab 10b21dev api'

distance = 137
spam score = 70
title = 'rmoduleuserattributemapbuilder scarab 10b21dev api'

distance = 138
spam score = 68
title = 'mitlistitemmapbuilder scarab 10b21dev api'

distance = 138
spam score = 68
title = 'activitysetmapbuilder scarab 10b21dev api'

distance = 139
spam score = 68
title = 'attachmentmapbuilder scarab 10b21dev api'

distance = 140
spam score = 74
title = 'activitysetmapbuilder scarab 10b21dev api'

distance = 141
spam score = 74
title = 'attachmentmapbuilder scarab 10b21dev api'

distance = 141
spam score = 67
title = 'rmoduleuserattributemapbuilder scarab 10b21dev api'

distance = 141
spam score = 79
title = 'attributegroupmapbuilder scarab 10b21dev api'

distance = 141
spam score = 69
title = 'transitionmapbuilder scarab 10b21dev api'

distance = 141
spam score = 69
title = 'transitionmapbuilder scarab 10b21dev api'

distance = 141
spam score = 66
title = 'notificationstatusmapbuilder scarab 10b21dev api'

distance = 143
spam score = 68
title = 'conditionmapbuilder scarab 10b21dev api'

distance = 143
spam score = 71
title = 'optionrelationshipmapbuilder scarab 10b21dev api'

distance = 144
spam score = 71
title = 'rmoduleoptionmapbuilder scarab 10b21dev api'

distance = 147
spam score = 66
title = 'dependmapbuilder scarab 10b21dev api'

distance = 148
spam score = 65
title = 'activitymapbuilder scarab 10b21dev api'

distance = 150
spam score = 66
title = 'rissuetypeattributemapbuilder scarab 10b21dev api'

distance = 152
spam score = 67
title = 'rmoduleissuetypemapbuilder scarab 10b21dev api'

distance = 152
spam score = 66
title = 'rqueryusermapbuilder scarab 10b21dev api'

distance = 152
spam score = 72
title = 'rmoduleissuetypemapbuilder scarab 10b21dev api'

distance = 152
spam score = 70
title = 'attributemapbuilder scarab 10b21dev api'

distance = 154
spam score = 76
title = 'attributetypemapbuilder scarab 10b21dev api'

distance = 155
spam score = 66
title = 'frequencymapbuilder scarab 10b21dev api'

distance = 160
spam score = 66
title = 'optionrelationshipmapbuilder scarab 10b21dev api'

distance = 318
spam score = 65
title = 'turbinerolepermissionmapbuilder turbine2 233 api'

distance = 329
spam score = 63
title = 'turbinerolepermissionmapbuilder jakartaturbine2 232 api'

distance = 331
spam score = 64
title = 'turbinepermissionmapbuilder jakartaturbine2 231 api'

distance = 334
spam score = 66
title = 'turbinepermissionmapbuilder jakartaturbine2 232 api'

distance = 339
spam score = 70
title = 'turbinepermissionmapbuilder turbine2 233 api'

distance = 341
spam score = 72
title = 'turbinegroupmapbuilder turbine2 233 api'

distance = 348
spam score = 66
title = 'turbinegroupmapbuilder jakartaturbine2 231 api'

distance = 351
spam score = 62
title = 'turbinegroupmapbuilder jakartaturbine2 232 api'

distance = 361
spam score = 75
title = 'jobentrymapbuilder turbine2 233 api'

distance = 370
spam score = 69
title = 'jobentrymapbuilder jakartaturbine2 232 api'

distance = 728
spam score = 56
title = 'temailprocessedmapbuilder issue tracking with track api documentation'

distance = 729
spam score = 52
title = 'trolefieldmapbuilder issue tracking with track api documentation'

distance = 729
spam score = 57
title = 'tscreenfieldmapbuilder issue tracking with track api documentation'

distance = 729
spam score = 51
title = 'tfieldconfigmapbuilder issue tracking with track api documentation'

distance = 730
spam score = 51
title = 'tclassmapbuilder issue tracking with track api documentation'

distance = 732
spam score = 55
title = 'tprivatereportrepositorymapbuilder issue tracking with track api documentation'

distance = 734
spam score = 53
title = 'tinitstatemapbuilder issue tracking with track api documentation'

distance = 735
spam score = 50
title = 'taccountmapbuilder issue tracking with track api documentation'

distance = 736
spam score = 55
title = 'tnotifysettingsmapbuilder issue tracking with track api documentation'

distance = 736
spam score = 57
title = 'tsitemapbuilder issue tracking with track api documentation'

distance = 739
spam score = 57
title = 'tlistmapbuilder issue tracking with track api documentation'

distance = 740
spam score = 53
title = 'tdashboardparametermapbuilder issue tracking with track api documentation'

distance = 741
spam score = 53
title = 'tscreenconfigmapbuilder issue tracking with track api documentation'

distance = 741
spam score = 52
title = 'tgeneralsettingsmapbuilder issue tracking with track api documentation'

distance = 742
spam score = 52
title = 'tconfigoptionsrolemapbuilder issue tracking with track api documentation'

distance = 743
spam score = 51
title = 'tscreenmapbuilder issue tracking with track api documentation'

distance = 745
spam score = 51
title = 'tefforttypemapbuilder issue tracking with track api documentation'

distance = 745
spam score = 52
title = 'tbaselinemapbuilder issue tracking with track api documentation'

distance = 746
spam score = 51
title = 'tfieldmapbuilder issue tracking with track api documentation'

distance = 747
spam score = 53
title = 'tpseveritymapbuilder issue tracking with track api documentation'

distance = 750
spam score = 56
title = 'tmotdmapbuilder issue tracking with track api documentation'

distance = 751
spam score = 51
title = 'tcomputedvaluesmapbuilder issue tracking with track api documentation'

distance = 751
spam score = 52
title = 'tstatechangemapbuilder issue tracking with track api documentation'

distance = 752
spam score = 52
title = 'tattributeoptionmapbuilder issue tracking with track api documentation'

distance = 754
spam score = 49
title = 'tclobmapbuilder issue tracking with track api documentation'

distance = 756
spam score = 54
title = 'tworkitemmapbuilder issue tracking with track api documentation'

distance = 757
spam score = 52
title = 'tprojecttypemapbuilder issue tracking with track api documentation'

distance = 758
spam score = 53
title = 'tseveritymapbuilder issue tracking with track api documentation'

distance = 758
spam score = 51
title = 'tdocstatemapbuilder issue tracking with track api documentation'

distance = 903
spam score = 78
title = 'xpusp packages class disciplinetypemapbuilder'

distance = 951
spam score = 61
title = 'xpusp packages class periodmapbuilder'

distance = 966
spam score = 64
title = 'xpusp packages class professormapbuilder'

distance = 969
spam score = 63
title = 'xpusp packages class professorperiodmapbuilder'

distance = 970
spam score = 64
title = 'xpusp packages class studentelectivemapbuilder'

distance = 986
spam score = 65
title = 'xpusp packages class requiredpoolmapbuilder'

distance = 996
spam score = 62
title = 'xpusp packages class unitmapbuilder'

distance = 1029
spam score = 75
title = 'xpusp packages class electivepoolmapbuilder'

distance = 1031
spam score = 76
title = 'xpusp packages class departmentmapbuilder'

distance = 1034
spam score = 63
title = 'xpusp packages class professorcapablemapbuilder'

distance = 1037
spam score = 63
title = 'xpusp packages class schedulemapbuilder'

distance = 1117
spam score = 68
title = 'xpusp packages class studentmapbuilder'

distance = 1124
spam score = 77
title = 'xpusp packages class disciplinemapbuilder'

distance = 1569
spam score = 62
title = 'deprecated list torque 33 api'

distance = 144
spam score = 58
title = ''

distance = 152
spam score = 56
title = ''

distance = 163
spam score = 57
title = ''

distance = 165
spam score = 55
title = ''

distance = 166
spam score = 56
title = ''

distance = 171
spam score = 56
title = ''

distance = 180
spam score = 53
title = ''

distance = 181
spam score = 54
title = ''

distance = 183
spam score = 55
title = ''

distance = 183
spam score = 55
title = ''

distance = 188
spam score = 56
title = ''

distance = 190
spam score = 59
title = ''

distance = 190
spam score = 57
title = ''

distance = 201
spam score = 55
title = ''

distance = 229
spam score = 59
title = ''

distance = 241
spam score = 51
title = ''

distance = 245
spam score = 57
title = ''

distance = 246
spam score = 53
title = ''

distance = 247
spam score = 52
title = ''

distance = 252
spam score = 58
title = ''

distance = 254
spam score = 56
title = ''

distance = 270
spam score = 60
title = ''

distance = 283
spam score = 55
title = ''

distance = 295
spam score = 59
title = ''

distance = 347
spam score = 54
title = ''

distance = 367
spam score = 50
title = ''

distance = 370
spam score = 53
title = ''

distance = 373
spam score = 60
title = ''

distance = 381
spam score = 59
title = ''

distance = 382
spam score = 51
title = ''

distance = 434
spam score = 57
title = ''

distance = 438
spam score = 53
title = ''

distance = 440
spam score = 55
title = ''

distance = 460
spam score = 53
title = ''

distance = 471
spam score = 60
title = ''

distance = 473
spam score = 49
title = ''

distance = 485
spam score = 54
title = ''

distance = 486
spam score = 55
title = ''

distance = 490
spam score = 55
title = ''

distance = 512
spam score = 56
title = ''

distance = 537
spam score = 52
title = ''

distance = 717
spam score = 54
title = ''

distance = 980
spam score = 49
title = ''

distance = 990
spam score = 52
title = ''

distance = 997
spam score = 50
title = ''

distance = 1012
spam score = 54
title = ''

distance = 1028
spam score = 55
title = ''

distance = 1033
spam score = 47
title = ''

distance = 1038
spam score = 55
title = ''

distance = 1042
spam score = 58
title = ''

distance = 1052
spam score = 53
title = ''

distance = 1096
spam score = 57
title = ''

distance = 1124
spam score = 50
title = ''

distance = 1162
spam score = 51
title = ''

distance = 135
spam score = 60
title = 'uses of package orgtigrisscarabactions scarab 10b21dev api'

distance = 142
spam score = 54
title = 'uses of package orgtigrisscarabpipeline scarab 10b21dev api'

distance = 148
spam score = 57
title = 'uses of package orgtigrisscarabpipeline scarab 10b21dev api'

distance = 161
spam score = 57
title = 'uses of package orgtigrisscarabcomponents scarab 10b21dev api'

distance = 167
spam score = 59
title = 'uses of package orgtigrisscarabcactus scarab 10b21dev api'

distance = 168
spam score = 61
title = 'uses of package orgtigrisscarabcomponents scarab 10b21dev api'

distance = 171
spam score = 60
title = 'uses of package orgtigrisscarabcactus scarab 10b21dev api'

distance = 172
spam score = 57
title = 'uses of package orgtigrisscarabfeeds scarab 10b21dev api'

distance = 173
spam score = 57
title = 'uses of package orgtigrisscarabxmlrpc scarab 10b21dev api'

distance = 183
spam score = 54
title = 'uses of package orgtigrisscarabfeeds scarab 10b21dev api'

distance = 188
spam score = 57
title = 'uses of package orgtigrisscarabutilcomparators scarab 10b21dev api'

distance = 191
spam score = 57
title = 'uses of package orgtigrisscarabutilexport scarab 10b21dev api'

distance = 197
spam score = 58
title = 'uses of package orgtigrisscarabactionssetup scarab 10b21dev api'

distance = 203
spam score = 58
title = 'uses of package orgtigrisscarabutilexport scarab 10b21dev api'

distance = 207
spam score = 59
title = 'uses of package orgtigrisscarabactionssetup scarab 10b21dev api'

distance = 207
spam score = 56
title = 'uses of package orgtigrisscarabactionsadmin scarab 10b21dev api'

distance = 212
spam score = 58
title = 'uses of package orgtigrisscarabscreenshome scarab 10b21dev api'

distance = 215
spam score = 58
title = 'uses of package orgtigrisscarabscreenshome scarab 10b21dev api'

distance = 218
spam score = 59
title = 'uses of class orgtigrisscarabactionsreportissue scarab 10b21dev api'

distance = 219
spam score = 51
title = 'uses of class orgtigrisscarabutilsnippetrenderer scarab 10b21dev api'

distance = 290
spam score = 52
title = 'uses of class orgtigrisscarabutilwordlucenesearchindex scarab 10b21dev api'

distance = 291
spam score = 57
title = 'uses of class orgtigrisscarabactionsadminglobalartifacttypecreate scarab 10b21dev api'

distance = 292
spam score = 53
title = 'uses of class orgtigrisscarabutilbuildantschemafix scarab 10b21dev api'

distance = 293
spam score = 50
title = 'uses of class orgtigrisscarabscreensregister scarab 10b21dev api'

distance = 293
spam score = 54
title = 'uses of class orgtigrisscarabommapactivitysetmapbuilder scarab 10b21dev api'

distance = 293
spam score = 58
title = 'uses of class orgtigrisscarabservicescachedefaultscarabcacheservice scarab 10b21dev api'

distance = 293
spam score = 50
title = 'uses of class orgtigrisscarabomabstractscarabuser scarab 10b21dev api'

distance = 293
spam score = 60
title = 'orgtigrisscarabcomponents scarab 10b21dev api'

distance = 295
spam score = 48
title = 'uses of class orgtigrisscarabutilanonymoususerutil scarab 10b21dev api'

distance = 299
spam score = 58
title = 'uses of class orgtigrisscarabactionssetupantrunner scarab 10b21dev api'

distance = 321
spam score = 56
title = 'uses of class orgtigrisscarabscreenshomexmodulelist scarab 10b21dev api'

distance = 321
spam score = 57
title = 'uses of package orgtigrisscarabservicessecurity scarab 10b21dev api'

distance = 321
spam score = 48
title = 'uses of class orgtigrisscarabpipelineanonymousloginvalve scarab 10b21dev api'

distance = 322
spam score = 58
title = 'uses of class orgtigrisscarabscreensadminviewxmlexportsettings scarab 10b21dev api'

distance = 323
spam score = 57
title = 'uses of package orgtigrisscarabutilbuildl10ncheckerissues scarab 10b21dev api'

distance = 323
spam score = 50
title = 'uses of class orgtigrisscarabfeedsissuefeed scarab 10b21dev api'

distance = 324
spam score = 55
title = 'uses of class orgtigrisscarabscreensadminxmlimportissuesresults scarab 10b21dev api'

distance = 326
spam score = 57
title = 'uses of class orgtigrisscarabservicescachescarabcachekey scarab 10b21dev api'

distance = 326
spam score = 50
title = 'uses of class orgtigrisscarabpipelinefreshenuservalve scarab 10b21dev api'

distance = 327
spam score = 59
title = 'uses of class orgtigrisscarabscreensmoveissue scarab 10b21dev api'

distance = 355
spam score = 48
title = 'uses of class orgtigrisscarabutilbuildantpropertyfilegenerator scarab 10b21dev api'

distance = 358
spam score = 55
title = 'orgtigrisscarabscreensnotifications scarab 10b21dev api'

distance = 358
spam score = 57
title = 'uses of class orgtigrisscarabutilwordlucenesearchindexupdatethread scarab 10b21dev api'

distance = 360
spam score = 56
title = 'uses of class orgtigrisscarabtoolsradeoxscarabrenderengine scarab 10b21dev api'

distance = 361
spam score = 52
title = 'orgtigrisscarabutilcomparators scarab 10b21dev api'

distance = 362
spam score = 61
title = 'orgtigrisscarabutilexport scarab 10b21dev api'

distance = 362
spam score = 62
title = 'orgtigrisscarabactionssetup class hierarchy scarab 10b21dev api'

distance = 362
spam score = 55
title = 'uses of class orgtigrisscarabombaseattributepeer scarab 10b21dev api'

distance = 365
spam score = 61
title = 'orgtigrisscarabxmlrpc class hierarchy scarab 10b21dev api'

distance = 365
spam score = 54
title = 'uses of class orgtigrisscarabutiltablemodel scarab 10b21dev api'

distance = 414
spam score = 59
title = 'uses of class orgtigrisscarabombaseattributeclassmanager scarab 10b21dev api'

distance = 414
spam score = 57
title = 'uses of class orgtigrisscarabomattributeoptionmanager scarab 10b21dev api'

distance = 418
spam score = 51
title = 'uses of package orgtigrisscarabda scarab 10b21dev api'

distance = 418
spam score = 52
title = 'uses of class orgtigrisscarabutilwindowiterator scarab 10b21dev api'

distance = 419
spam score = 57
title = 'uses of class orgtigrisscarabomattachmentmanager scarab 10b21dev api'

distance = 421
spam score = 56
title = 'uses of class orgtigrisscarabombaseattributegroup scarab 10b21dev api'

distance = 421
spam score = 51
title = 'uses of class orgtigrisscarabomattributevaluepeer scarab 10b21dev api'

distance = 425
spam score = 53
title = 'uses of class orgtigrisscarabombaseactivityset scarab 10b21dev api'

distance = 426
spam score = 62
title = 'uses of class orgtigrisscarabomattributemanager scarab 10b21dev api'

distance = 428
spam score = 53
title = 'uses of class orgtigrisscarabscreensentrywizard1 scarab 10b21dev api'

distance = 457
spam score = 52
title = 'uses of class orgtigrisscarabomactivitysettypemanager scarab 10b21dev api'

distance = 459
spam score = 58
title = 'orgtigrisscarabworkflow class hierarchy scarab 10b21dev api'

distance = 462
spam score = 58
title = 'orgtigrisscarabxmlrpc scarab 10b21dev api'

distance = 463
spam score = 67
title = 'orgtigrisscarabservicessecurity scarab 10b21dev api'

distance = 467
spam score = 52
title = 'uses of class orgtigrisscarabutilbuildl10ncheckerissuestranslationrequiredissue scarab 10b21dev api'

distance = 469
spam score = 60
title = 'orgtigrisscarabfeeds class hierarchy scarab 10b21dev api'

distance = 469
spam score = 62
title = 'orgtigrisscarabfeeds class hierarchy scarab 10b21dev api'

distance = 472
spam score = 65
title = 'orgtigrisscarabfeeds scarab 10b21dev api'

distance = 472
spam score = 51
title = 'uses of package orgtigrisscarabservicesemail scarab 10b21dev api'

distance = 474
spam score = 60
title = 'orgtigrisscarabservices class hierarchy scarab 10b21dev api'

distance = 574
spam score = 55
title = 'uses of class orgtigrisscarabutilbuildantl10analysistaskmessage scarab 10b21dev api'

distance = 588
spam score = 59
title = 'orgtigrisscarabtoolsradeox class hierarchy scarab 10b21dev api'

distance = 588
spam score = 58
title = 'orgtigrisscarabtoolsradeox class hierarchy scarab 10b21dev api'

distance = 588
spam score = 52
title = 'uses of class orgtigrisscarabtoolslocalizationl10nkey scarab 10b21dev api'

distance = 589
spam score = 56
title = 'uses of class orgtigrisscarabscreensdataexport scarab 10b21dev api'

distance = 591
spam score = 52
title = 'uses of class orgtigrisscarabutilxmlissuesenddate scarab 10b21dev api'

distance = 614
spam score = 55
title = 'uses of class orgtigrisscarabutilxmlissuesdependency scarab 10b21dev api'

distance = 620
spam score = 64
title = 'orgtigrisscarabscreenshome class hierarchy scarab 10b21dev api'

distance = 620
spam score = 65
title = 'orgtigrisscarabscreenshome class hierarchy scarab 10b21dev api'

distance = 621
spam score = 62
title = 'orgtigrisscarabscreensnotifications class hierarchy scarab 10b21dev api'

distance = 744
spam score = 55
title = 'orgtigrisscarabreports scarab 10b21dev api'

distance = 750
spam score = 53
title = 'uses of interface orgtigrisscarabservicescachescarabcacheservice scarab 10b21dev api'

distance = 757
spam score = 64
title = 'orgtigrisscarabreports scarab 10b21dev api'

distance = 760
spam score = 61
title = 'orgtigrisscarabutilbuild class hierarchy scarab 10b21dev api'

distance = 760
spam score = 57
title = 'uses of interface orgtigrisscarabservicescachescarabcacheservice scarab 10b21dev api'

distance = 766
spam score = 51
title = 'uses of class orgtigrisscarabreportsreportuserattribute scarab 10b21dev api'

distance = 774
spam score = 61
title = 'orgtigrisscarabommap scarab 10b21dev api'

distance = 786
spam score = 73
title = 'orgtigrisscarabommap scarab 10b21dev api'

distance = 788
spam score = 51
title = 'orgtigrisscarabnotification scarab 10b21dev api'

distance = 792
spam score = 64
title = 'orgtigrisscarabnotification scarab 10b21dev api'

distance = 897
spam score = 61
title = 'orgtigrisscarabactions class hierarchy scarab 10b21dev api'

distance = 908
spam score = 68
title = 'orgtigrisscarabactions class hierarchy scarab 10b21dev api'

distance = 925
spam score = 68
title = 'orgtigrisscarabactionsadmin class hierarchy scarab 10b21dev api'

distance = 930
spam score = 60
title = 'uses of class orgtigrisscarabutilwordmaxconcurrentsearchexception scarab 10b21dev api'

distance = 931
spam score = 66
title = 'orgtigrisscarabactionsadmin class hierarchy scarab 10b21dev api'

distance = 932
spam score = 68
title = 'uses of package orgtigrisscarabtools scarab 10b21dev api'

distance = 935
spam score = 62
title = 'uses of package orgtigrisscarabreports scarab 10b21dev api'

distance = 937
spam score = 61
title = 'uses of package orgtigrisscarabtools scarab 10b21dev api'

distance = 942
spam score = 68
title = 'uses of package orgtigrisscarabscreens scarab 10b21dev api'

distance = 947
spam score = 65
title = 'uses of package orgtigrisscarabscreens scarab 10b21dev api'

distance = 1429
spam score = 65
title = 'deprecated list scarab 10b21dev api'

distance = 12
spam score = 76
title = ''

distance = 12
spam score = 77
title = ''

distance = 12
spam score = 80
title = ''

distance = 14
spam score = 75
title = ''

distance = 15
spam score = 79
title = ''

distance = 15
spam score = 78
title = ''

distance = 16
spam score = 74
title = ''

distance = 16
spam score = 77
title = ''

distance = 16
spam score = 78
title = ''

distance = 19
spam score = 76
title = ''

distance = 20
spam score = 80
title = ''

distance = 24
spam score = 79
title = ''

distance = 33
spam score = 78
title = ''

distance = 37
spam score = 82
title = ''

distance = 37
spam score = 73
title = ''

distance = 43
spam score = 73
title = ''

distance = 45
spam score = 87
title = ''

distance = 75
spam score = 88
title = ''

distance = 90
spam score = 80
title = ''

distance = 95
spam score = 87
title = ''

distance = 105
spam score = 84
title = ''

distance = 112
spam score = 73
title = ''

distance = 123
spam score = 74
title = ''

distance = 126
spam score = 85
title = ''

distance = 142
spam score = 78
title = ''

distance = 155
spam score = 81
title = ''

distance = 168
spam score = 75
title = ''

distance = 211
spam score = 70
title = ''

distance = 218
spam score = 84
title = ''

distance = 221
spam score = 73
title = ''

distance = 337
spam score = 32
title = ''

distance = 355
spam score = 45
title = ''

distance = 365
spam score = 44
title = ''

distance = 512
spam score = 71
title = ''

distance = 966
spam score = 61
title = ''

distance = 1012
spam score = 72
title = ''

distance = 1052
spam score = 64
title = ''

distance = 1052
spam score = 72
title = ''

distance = 1112
spam score = 54
title = ''

distance = 1115
spam score = 67
title = ''

distance = 1116
spam score = 66
title = ''

distance = 1158
spam score = 86
title = ''

distance = 1179
spam score = 63
title = ''

distance = 1182
spam score = 67
title = ''

distance = 1183
spam score = 64
title = ''

distance = 1197
spam score = 67
title = ''

distance = 213
spam score = 77
title = 'connectexception java 2 platform se 50'

distance = 216
spam score = 74
title = 'unknownhostexception java 2 platform se 50'

distance = 224
spam score = 59
title = 'unknownhostexception java 2 platform se v142'

distance = 226
spam score = 71
title = 'connectexception java 2 platform se 50'

distance = 229
spam score = 66
title = 'connectexception java 2 platform se 50'

distance = 230
spam score = 63
title = 'unknownhostexception java 2 platform se v142'

distance = 231
spam score = 62
title = 'unknownhostexception java 2 platform se v142'

distance = 233
spam score = 64
title = 'unknownhostexception java 2 platform se 50'

distance = 234
spam score = 64
title = 'connectexception java 2 platform se 50'

distance = 234
spam score = 67
title = 'serverexception java 2 platform se 50'

distance = 236
spam score = 63
title = 'serverexception java 2 platform se 50'

distance = 237
spam score = 62
title = 'unknownhostexception java 2 platform se 50'

distance = 238
spam score = 63
title = 'unknownhostexception java 2 platform se 50'

distance = 239
spam score = 64
title = 'serverexception java 2 platform se v142'

distance = 239
spam score = 72
title = 'connectexception java 2 platform se v142'

distance = 246
spam score = 59
title = 'serverexception java 2 platform se 50'

distance = 248
spam score = 67
title = 'connectioexception java 2 platform se 50'

distance = 251
spam score = 65
title = 'connectexception java 2 platform se v142'

distance = 251
spam score = 70
title = 'connectioexception java 2 platform se 50'

distance = 251
spam score = 66
title = 'connectexception java 2 platform se v142'

distance = 310
spam score = 65
title = 'unexpectedexception java 2 platform se v142'

distance = 310
spam score = 65
title = 'connectioexception java 2 platform se v142'

distance = 311
spam score = 78
title = 'activatefailedexception java 2 platform se v142'

distance = 311
spam score = 63
title = 'stubnotfoundexception java 2 platform se 50'

distance = 314
spam score = 78
title = 'activatefailedexception java 2 platform se v142'

distance = 314
spam score = 79
title = 'activatefailedexception java platform se 6'

distance = 315
spam score = 67
title = 'skeletonnotfoundexception java 2 platform se 50'

distance = 316
spam score = 65
title = 'stubnotfoundexception java 2 platform se 50'

distance = 318
spam score = 79
title = 'stubnotfoundexception java 2 platform se 50'

distance = 319
spam score = 63
title = 'activatefailedexception java platform se 6'

distance = 337
spam score = 67
title = 'stubnotfoundexception java 2 platform se v142'

distance = 337
spam score = 80
title = 'accessexception java platform se 6'

distance = 340
spam score = 64
title = 'stubnotfoundexception java 2 platform se v142'

distance = 340
spam score = 69
title = 'accessexception java platform se 6'

distance = 341
spam score = 61
title = 'socketsecurityexception java 2 platform se 50'

distance = 342
spam score = 64
title = 'skeletonnotfoundexception java platform se 6'

distance = 343
spam score = 77
title = 'skeletonnotfoundexception java platform se 6'

distance = 343
spam score = 71
title = 'accessexception java 2 platform se v141'

distance = 344
spam score = 60
title = 'stubnotfoundexception java 2 platform se v141'

distance = 344
spam score = 70
title = 'skeletonnotfoundexception java platform se 6'

distance = 371
spam score = 71
title = 'marshalexception java 2 platform se v142'

distance = 373
spam score = 48
title = 'java 2 platform se v131 class unexpectedexception'

distance = 375
spam score = 63
title = 'accessexception java 2 platform se v142'

distance = 375
spam score = 62
title = 'marshalexception java 2 platform se v141'

distance = 376
spam score = 66
title = 'accessexception java platform se 6'

distance = 378
spam score = 72
title = 'marshalexception java 2 platform se v142'

distance = 381
spam score = 49
title = 'java 2 platform se v131 class unexpectedexception'

distance = 388
spam score = 58
title = 'marshalexception java platform se 6'

distance = 399
spam score = 69
title = 'marshalexception java 2 platform se v142'

distance = 403
spam score = 64
title = 'socketsecurityexception java 2 platform se v142'

distance = 445
spam score = 53
title = 'servererror java 2 platform se v141'

distance = 447
spam score = 62
title = 'socketsecurityexception java 2 platform se v142'

distance = 448
spam score = 53
title = 'javatm 2 platform standard edition v122 api specification class serverexception'

distance = 448
spam score = 50
title = 'java 2 platform se v131 class exportexception'

distance = 448
spam score = 63
title = 'servererror java 2 platform se v142'

distance = 448
spam score = 59
title = 'servererror java 2 platform se v142'

distance = 450
spam score = 54
title = 'java 2 platform se v131 class activatefailedexception'

distance = 451
spam score = 55
title = 'java 2 platform se v131 class marshalexception'

distance = 452
spam score = 54
title = 'activatefailedexception java platform se 7 b48'

distance = 455
spam score = 56
title = 'javatm 2 platform standard edition v122 api specification class connectexception'

distance = 494
spam score = 42
title = 'java platform 12 api specification class unexpectedexception'

distance = 495
spam score = 63
title = 'unmarshalexception java 2 platform se v142'

distance = 495
spam score = 57
title = 'unmarshalexception java platform se 6'

distance = 495
spam score = 59
title = 'unmarshalexception java platform se 6'

distance = 496
spam score = 55
title = 'javatm 2 platform standard edition v122 api specification class activatefailedexception'

distance = 500
spam score = 44
title = 'java platform 12 api specification class connectioexception'

distance = 501
spam score = 60
title = 'unmarshalexception java 2 platform se v141'

distance = 501
spam score = 67
title = 'serverruntimeexception java 2 platform se 50'

distance = 502
spam score = 59
title = 'java 2 platform se v13 class socketsecurityexception'

distance = 503
spam score = 41
title = 'java platform 12 api specification class activatefailedexception'

distance = 527
spam score = 66
title = 'serverruntimeexception java platform se 6'

distance = 528
spam score = 63
title = 'skeletonmismatchexception java 2 platform se v141'

distance = 536
spam score = 53
title = 'javatm 2 platform standard edition v122 api specification class marshalexception'

distance = 536
spam score = 74
title = 'skeletonmismatchexception java platform se 6'

distance = 536
spam score = 68
title = 'skeletonmismatchexception java platform se 6'

distance = 539
spam score = 65
title = 'serverruntimeexception java 2 platform se v142'

distance = 543
spam score = 81
title = 'skeletonmismatchexception java platform se 6'

distance = 544
spam score = 48
title = 'javatm 2 platform standard edition v122 api specification class marshalexception'

distance = 544
spam score = 55
title = 'javatm 2 platform standard edition v122 api specification class marshalexception'

distance = 544
spam score = 57
title = 'javatm 2 platform standard edition v122 api specification class exportexception'

distance = 611
spam score = 65
title = 'nosuchobjectexception java 2 platform se v142'

distance = 614
spam score = 48
title = 'java platform 12 api specification class socketsecurityexception'

distance = 620
spam score = 70
title = 'java 2 platform se v131 class skeletonmismatchexception'

distance = 625
spam score = 41
title = 'javatm 2 platform standard edition v122 api specification class servererror'

distance = 628
spam score = 63
title = 'nosuchobjectexception java 2 platform se v142'

distance = 628
spam score = 55
title = 'java platform 12 api specification class skeletonnotfoundexception'

distance = 629
spam score = 53
title = 'servererror java platform se 6 b86'

distance = 630
spam score = 44
title = 'javatm 2 platform standard edition v122 api specification class servererror'

distance = 630
spam score = 36
title = 'java platform 12 api specification class servererror'

distance = 632
spam score = 39
title = 'javatm 2 platform standard edition v122 api specification class servererror'

distance = 740
spam score = 47
title = 'java 2 platform se v131 class transactionrolledbackexception'

distance = 775
spam score = 47
title = 'javatm 2 platform standard edition v122 api specification class nosuchobjectexception'

distance = 778
spam score = 51
title = 'javatm 2 platform standard edition v122 api specification class nosuchobjectexception'

distance = 790
spam score = 40
title = 'java platform 12 api specification class nosuchobjectexception'

distance = 791
spam score = 50
title = 'java 2 platform se v131 class unknowngroupexception'

distance = 851
spam score = 51
title = 'java 2 platform se v131 class unknownobjectexception'

distance = 863
spam score = 63
title = 'remoteexception weblogic server 103 api reference'

distance = 1066
spam score = 68
title = 'remotestub java 2 platform se v142'

distance = 1069
spam score = 71
title = 'remotestub java 2 platform se v142'

distance = 1082
spam score = 48
title = 'skeletonnotfoundexception gnu classpath 095 documentation'

distance = 1544
spam score = 71
title = 'aerologicaldisplayuppertemperatureaxislabels unidata idv api v26u1'

distance = 1552
spam score = 69
title = 'aerologicaldisplaytemperatureaxislabels unidata idv api v26u1'

distance = 1574
spam score = 69
title = 'aerologicaldisplayrightpressureaxislabels unidata idv api v26u1'

distance = 1577
spam score = 68
title = 'aerologicaldisplayleftpressureaxislabels unidata idv api v26u1'

distance = 1589
spam score = 57
title = 'iscmappsoap'

distance = 1685
spam score = 38
title = 'running rmi legacy java answers forum'

distance = 199
spam score = 74
title = 'namenotfoundexception java 2 platform se 50'

distance = 204
spam score = 69
title = 'namenotfoundexception java 2 platform se 50'

distance = 208
spam score = 70
title = 'nosuchattributeexception java 2 platform se 50'

distance = 212
spam score = 75
title = 'namenotfoundexception java 2 platform se v142'

distance = 214
spam score = 68
title = 'nosuchattributeexception java 2 platform se 50'

distance = 215
spam score = 66
title = 'nosuchattributeexception java 2 platform se v142'

distance = 215
spam score = 68
title = 'nosuchattributeexception java 2 platform se v142'

distance = 224
spam score = 72
title = 'namenotfoundexception java 2 platform se v142'

distance = 225
spam score = 61
title = 'nosuchattributeexception java 2 platform se v142'

distance = 225
spam score = 67
title = 'namenotfoundexception java 2 platform se 50'

distance = 227
spam score = 71
title = 'attributeinuseexception java 2 platform se 50'

distance = 230
spam score = 70
title = 'attributeinuseexception java 2 platform se 50'

distance = 232
spam score = 70
title = 'namenotfoundexception java 2 platform se v141'

distance = 234
spam score = 65
title = 'nosuchattributeexception java platform se 6'

distance = 238
spam score = 65
title = 'namenotfoundexception java platform se 6'

distance = 239
spam score = 64
title = 'nosuchattributeexception java platform se 6'

distance = 240
spam score = 65
title = 'nosuchattributeexception java platform se 6'

distance = 241
spam score = 61
title = 'nosuchattributeexception java 2 platform se v141'

distance = 242
spam score = 67
title = 'nosuchattributeexception java platform se 6'

distance = 242
spam score = 72
title = 'attributeinuseexception java 2 platform se v142'

distance = 317
spam score = 75
title = 'contextnotemptyexception java 2 platform se v142'

distance = 318
spam score = 71
title = 'attributeinuseexception java 2 platform se v142'

distance = 318
spam score = 66
title = 'nopermissionexception java 2 platform se v142'

distance = 320
spam score = 63
title = 'nopermissionexception java 2 platform se v142'

distance = 320
spam score = 72
title = 'nopermissionexception java 2 platform se 50'

distance = 322
spam score = 68
title = 'limitexceededexception java 2 platform se 50'

distance = 322
spam score = 70
title = 'limitexceededexception java 2 platform se v142'

distance = 323
spam score = 75
title = 'configurationexception java 2 platform se 50'

distance = 325
spam score = 73
title = 'invalidnameexception java 2 platform se v142'

distance = 325
spam score = 60
title = 'nopermissionexception java 2 platform se 50'

distance = 344
spam score = 75
title = 'configurationexception java 2 platform se v142'

distance = 344
spam score = 72
title = 'invalidattributeidentifierexception java 2 platform se v142'

distance = 345
spam score = 75
title = 'configurationexception java 2 platform se v142'

distance = 345
spam score = 68
title = 'operationnotsupportedexception java 2 platform se v142'

distance = 345
spam score = 72
title = 'insufficientresourcesexception java 2 platform se 50'

distance = 346
spam score = 70
title = 'limitexceededexception java platform se 6'

distance = 347
spam score = 65
title = 'invalidsearchfilterexception java 2 platform se v142'

distance = 347
spam score = 68
title = 'invalidsearchfilterexception java 2 platform se 50'

distance = 349
spam score = 83
title = 'invalidnameexception java platform se 6'

distance = 350
spam score = 66
title = 'configurationexception java platform se 6'

distance = 374
spam score = 77
title = 'notcontextexception java 2 platform se 50'

distance = 374
spam score = 68
title = 'timelimitexceededexception java 2 platform se v142'

distance = 374
spam score = 76
title = 'sizelimitexceededexception java 2 platform se 50'

distance = 375
spam score = 70
title = 'invalidattributesexception java 2 platform se 50'

distance = 376
spam score = 64
title = 'insufficientresourcesexception java 2 platform se v142'

distance = 377
spam score = 77
title = 'notcontextexception java 2 platform se 50'

distance = 377
spam score = 65
title = 'partialresultexception java 2 platform se 50'

distance = 378
spam score = 66
title = 'sizelimitexceededexception java 2 platform se 50'

distance = 378
spam score = 72
title = 'contextnotemptyexception java 2 platform se v142'

distance = 380
spam score = 72
title = 'invalidattributesexception java 2 platform se v142'

distance = 395
spam score = 63
title = 'linkloopexception java 2 platform se v142'

distance = 395
spam score = 70
title = 'invalidattributesexception java platform se 6'

distance = 397
spam score = 68
title = 'linkloopexception java 2 platform se 50'

distance = 397
spam score = 66
title = 'linkloopexception java 2 platform se v142'

distance = 398
spam score = 70
title = 'interruptednamingexception java 2 platform se v142'

distance = 398
spam score = 77
title = 'linkloopexception java 2 platform se 50'

distance = 398
spam score = 71
title = 'notcontextexception java platform se 6'

distance = 398
spam score = 68
title = 'invalidattributevalueexception java 2 platform se 50'

distance = 399
spam score = 78
title = 'authenticationexception java 2 platform se 50'

distance = 399
spam score = 74
title = 'invalidattributesexception java 2 platform se v142'

distance = 446
spam score = 73
title = 'java 2 platform se v131 class namingsecurityexception'

distance = 448
spam score = 69
title = 'partialresultexception java 2 platform se v142'

distance = 454
spam score = 71
title = 'authenticationnotsupportedexception java 2 platform se 50'

distance = 456
spam score = 78
title = 'namealreadyboundexception java 2 platform se 50'

distance = 458
spam score = 76
title = 'authenticationnotsupportedexception java 2 platform se 50'

distance = 461
spam score = 74
title = 'invalidattributevalueexception java 2 platform se v142'

distance = 463
spam score = 71
title = 'authenticationnotsupportedexception java 2 platform se 50'

distance = 464
spam score = 76
title = 'namealreadyboundexception java 2 platform se v142'

distance = 466
spam score = 73
title = 'namealreadyboundexception java 2 platform se v142'

distance = 471
spam score = 66
title = 'noinitialcontextexception java 2 platform se 50'

distance = 515
spam score = 66
title = 'java 2 platform se v131 class communicationexception'

distance = 516
spam score = 61
title = 'class attributeinuseexception'

distance = 517
spam score = 63
title = 'malformedlinkexception java 2 platform se 50'

distance = 517
spam score = 68
title = 'java 2 platform se v131 class insufficientresourcesexception'

distance = 520
spam score = 76
title = 'malformedlinkexception java 2 platform se v142'

distance = 523
spam score = 71
title = 'contextnotemptyexception java platform se 6 b86'

distance = 526
spam score = 73
title = 'java 2 platform se v131 class linkloopexception'

distance = 529
spam score = 60
title = 'insufficientresourcesexception java platform se 6 b86'

distance = 531
spam score = 54
title = 'class attributeinuseexception'

distance = 532
spam score = 52
title = 'nosuchattributeexception'

distance = 647
spam score = 54
title = 'partialresultexception'

distance = 650
spam score = 49
title = 'linkloopexception'

distance = 652
spam score = 57
title = 'notcontextexception'

distance = 655
spam score = 63
title = 'class authenticationexception'

distance = 658
spam score = 48
title = 'interruptednamingexception'

distance = 660
spam score = 51
title = 'invalidattributevalueexception'

distance = 664
spam score = 44
title = 'authenticationexception'

distance = 668
spam score = 51
title = 'sizelimitexceededexception'

distance = 681
spam score = 53
title = 'invalidsearchcontrolsexception'

distance = 689
spam score = 42
title = 'noinitialcontextexception'

distance = 1102
spam score = 76
title = 'linkref java 2 platform se 50'

distance = 1111
spam score = 67
title = 'linkref java 2 platform se v142'

distance = 1111
spam score = 71
title = 'linkref java 2 platform se v142'

distance = 1113
spam score = 68
title = 'linkref java 2 platform se v142'

distance = 1116
spam score = 79
title = 'linkref java 2 platform se v142'

distance = 1119
spam score = 56
title = 'attributemodificationexception'

distance = 1123
spam score = 61
title = 'invalidnameexception gnu classpath 095 documentation'

distance = 1127
spam score = 64
title = 'linkref java 2 platform se v141'

distance = 1143
spam score = 69
title = 'typemismatchnamingexception spring framework api 25'

distance = 1145
spam score = 57
title = 'nosuchattributeexception gnu classpath 095 documentation'

distance = 1304
spam score = 65
title = 'ldapreferralexception'

distance = 1326
spam score = 52
title = 'referralexception'

distance = 1462
spam score = 60
title = 'timed synchronization'

distance = 162
spam score = 53
title = ''

distance = 600
spam score = 57
title = ''

distance = 620
spam score = 66
title = ''

distance = 810
spam score = 62
title = ''

distance = 293
spam score = 53
title = 'findaction actions apis'

distance = 295
spam score = 51
title = 'findaction actions apis'

distance = 295
spam score = 54
title = 'findaction actions apis'

distance = 298
spam score = 61
title = 'nexttabaction actions apis'

distance = 302
spam score = 61
title = 'nexttabaction actions apis'

distance = 312
spam score = 63
title = 'previoustabaction actions apis'

distance = 317
spam score = 75
title = 'pagesetupaction actions apis'

distance = 321
spam score = 68
title = 'popupaction actions apis'

distance = 322
spam score = 74
title = 'pagesetupaction actions apis'

distance = 324
spam score = 65
title = 'popupaction actions apis'

distance = 324
spam score = 58
title = 'replaceaction actions apis'

distance = 325
spam score = 63
title = 'gotoaction actions apis'

distance = 335
spam score = 66
title = 'popupaction actions apis'

distance = 339
spam score = 59
title = 'undoaction actions apis'

distance = 344
spam score = 61
title = 'redoaction actions apis'

distance = 351
spam score = 62
title = 'garbagecollectaction actions apis'

distance = 353
spam score = 62
title = 'openlocalexploreraction actions apis'

distance = 354
spam score = 58
title = 'openlocalexploreraction actions apis'

distance = 357
spam score = 59
title = 'garbagecollectaction actions apis'

distance = 359
spam score = 63
title = 'openlocalexploreraction actions apis'

distance = 361
spam score = 61
title = 'closeviewaction actions apis'

distance = 362
spam score = 63
title = 'undockaction actions apis'

distance = 363
spam score = 65
title = 'closeviewaction actions apis'

distance = 363
spam score = 63
title = 'undockaction actions apis'

distance = 365
spam score = 62
title = 'customizeaction actions apis'

distance = 366
spam score = 64
title = 'openlocalexploreraction actions apis'

distance = 366
spam score = 11
title = 'findaction netbeans actions api netbeans api javadoc 550 java c'

distance = 369
spam score = 11
title = 'findaction actions apis netbeans api javadoc current development version java c'

distance = 374
spam score = 12
title = 'pagesetupaction netbeans actions api netbeans api javadoc 550 java c'

distance = 375
spam score = 65
title = 'cloneviewaction actions apis'

distance = 378
spam score = 66
title = 'customizeaction actions apis'

distance = 380
spam score = 62
title = 'moveupaction actions apis'

distance = 381
spam score = 63
title = 'deleteaction actions apis'

distance = 381
spam score = 14
title = 'nexttabaction actions apis netbeans api javadoc current development version java c'

distance = 382
spam score = 60
title = 'cutaction actions apis'

distance = 384
spam score = 56
title = 'movedownaction actions apis'

distance = 386
spam score = 14
title = 'pagesetupaction actions apis netbeans api javadoc current development version java c'

distance = 388
spam score = 60
title = 'printaction actions apis'

distance = 389
spam score = 58
title = 'saveaction actions apis'

distance = 391
spam score = 13
title = 'popupaction netbeans actions api netbeans api javadoc 550 java c'

distance = 406
spam score = 11
title = 'garbagecollectaction netbeans actions api netbeans api javadoc 551 java c'

distance = 407
spam score = 11
title = 'garbagecollectaction netbeans actions api netbeans api javadoc 550 java c'

distance = 408
spam score = 60
title = 'renameaction actions apis'

distance = 410
spam score = 12
title = 'undoaction actions apis netbeans api javadoc current development version java c'

distance = 413
spam score = 12
title = 'garbagecollectaction actions apis netbeans api javadoc current development version java c'

distance = 418
spam score = 13
title = 'redoaction actions apis netbeans api javadoc current development version java c'

distance = 419
spam score = 12
title = 'openlocalexploreraction netbeans actions api netbeans api javadoc 550 java c'

distance = 425
spam score = 64
title = 'copyaction actions apis'

distance = 427
spam score = 13
title = 'customizeaction actions apis netbeans api javadoc current development version java c'

distance = 428
spam score = 56
title = 'editaction actions apis'

distance = 429
spam score = 54
title = 'reorderaction actions apis'

distance = 429
spam score = 12
title = 'closeviewaction netbeans actions api netbeans api javadoc 551 java c'

distance = 430
spam score = 58
title = 'viewaction actions apis'

distance = 434
spam score = 12
title = 'saveaction actions apis netbeans api javadoc current development version java c'

distance = 435
spam score = 13
title = 'cloneviewaction netbeans actions api netbeans api javadoc 550 java c'

distance = 436
spam score = 11
title = 'printaction netbeans actions api netbeans api javadoc 550 java c'

distance = 438
spam score = 11
title = 'printaction netbeans actions api netbeans api javadoc 551 java c'

distance = 443
spam score = 13
title = 'undockaction actions apis netbeans api javadoc current development version java c'

distance = 447
spam score = 12
title = 'cutaction netbeans actions api netbeans api javadoc 551 java c'

distance = 455
spam score = 11
title = 'movedownaction netbeans actions api netbeans api javadoc 550 java c'

distance = 468
spam score = 12
title = 'viewaction netbeans actions api netbeans api javadoc 551 java c'

distance = 468
spam score = 63
title = 'propertiesaction actions apis'

distance = 468
spam score = 12
title = 'viewaction netbeans actions api netbeans api javadoc 550 java c'

distance = 469
spam score = 62
title = 'propertiesaction actions apis'

distance = 469
spam score = 11
title = 'editaction netbeans actions api netbeans api javadoc 551 java c'

distance = 470
spam score = 11
title = 'editaction netbeans actions api netbeans api javadoc 550 java c'

distance = 471
spam score = 12
title = 'editaction actions apis netbeans api javadoc current development version java c'

distance = 474
spam score = 11
title = 'reorderaction netbeans actions api netbeans api javadoc 550 java c'

distance = 474
spam score = 11
title = 'reorderaction netbeans actions api netbeans api javadoc 551 java c'

distance = 478
spam score = 14
title = 'copyaction actions apis netbeans api javadoc current development version java c'

distance = 493
spam score = 66
title = 'gestperifericheaction'

distance = 501
spam score = 65
title = 'workspaceswitchaction actions apis'

distance = 513
spam score = 58
title = 'exporthtmlaction editor module'

distance = 517
spam score = 67
title = 'newaction actions apis'

distance = 654
spam score = 61
title = 'instantiateaction datasystems api'

distance = 697
spam score = 67
title = 'assemblaaction'

distance = 700
spam score = 62
title = 'filesystemaction datasystems api'

distance = 767
spam score = 79
title = 'toolsaction actions apis'

distance = 769
spam score = 72
title = 'toolsaction actions apis'

distance = 773
spam score = 77
title = 'toolsaction actions apis'

distance = 841
spam score = 74
title = 'callablesystemaction utilities api'

distance = 843
spam score = 71
title = 'pasteaction actions apis'

distance = 845
spam score = 84
title = 'callablesystemaction utilities api'

distance = 845
spam score = 81
title = 'callablesystemaction utilities api'

distance = 846
spam score = 75
title = 'pasteaction actions apis'

distance = 847
spam score = 72
title = 'pasteaction actions apis'

distance = 860
spam score = 19
title = 'pasteaction actions apis netbeans api javadoc current development version java c'

distance = 933
spam score = 74
title = 'booleanstateaction utilities api'

distance = 936
spam score = 73
title = 'booleanstateaction utilities api'

distance = 936
spam score = 71
title = 'booleanstateaction utilities api'

distance = 937
spam score = 83
title = 'booleanstateaction utilities api'

distance = 938
spam score = 82
title = 'booleanstateaction utilities api'

distance = 938
spam score = 73
title = 'booleanstateaction utilities api'

distance = 939
spam score = 82
title = 'booleanstateaction utilities api'

distance = 985
spam score = 62
title = 'cookieaction nodes api'

distance = 996
spam score = 66
title = 'callbacksystemaction utilities api'

distance = 999
spam score = 62
title = 'callbacksystemaction utilities api'

distance = 999
spam score = 75
title = 'cookieaction nodes api'

distance = 999
spam score = 73
title = 'callbacksystemaction utilities api'

distance = 1000
spam score = 62
title = 'callbacksystemaction utilities api'

distance = 1031
spam score = 69
title = 'nodeaction nodes api'

distance = 1034
spam score = 76
title = 'presenter utilities api'

distance = 1037
spam score = 75
title = 'presenter utilities api'

distance = 1248
spam score = 62
title = 'annotationtypesnode editor module'

distance = 173
spam score = 55
title = 'uses of package orgapachenutchindexermore nutch 081 api'

distance = 187
spam score = 55
title = 'uses of package orgapachenutchhtml nutch 081 api'

distance = 190
spam score = 62
title = 'uses of package orgapachenutchindexermore nutch 09 api'

distance = 205
spam score = 57
title = 'uses of package orgapachenutchservlet nutch 081 api'

distance = 207
spam score = 60
title = 'uses of package orgapachenutchhtml nutch 09 api'

distance = 221
spam score = 56
title = 'uses of package orgapachenutchservlet nutch 09 api'

distance = 230
spam score = 63
title = 'uses of package orgapachenutchhtml nutch 09 api'

distance = 235
spam score = 64
title = 'orgapachenutchhtml nutch 081 api'

distance = 238
spam score = 55
title = 'uses of package orgapachenutchsummarylucene nutch 081 api'

distance = 238
spam score = 58
title = 'uses of package orgapachenutchindexerbasic nutch 09 api'

distance = 240
spam score = 73
title = 'orgapachenutchhtml nutch 09 api'

distance = 243
spam score = 58
title = 'uses of package orgcreativecommonsnutch nutch 081 api'

distance = 247
spam score = 66
title = 'uses of package orgapachenutchfetcher nutch 09 api'

distance = 258
spam score = 58
title = 'uses of package orgapachenutchprotocolhttp nutch 081 api'

distance = 259
spam score = 55
title = 'uses of package orgapachenutchparsetext nutch 081 api'

distance = 261
spam score = 55
title = 'uses of package orgapachenutchparsemsexcel nutch 081 api'

distance = 261
spam score = 56
title = 'uses of package orgapachenutchfetcher nutch 081 api'

distance = 261
spam score = 52
title = 'uses of class orgapachenutchfetcherfetcher nutch 09 api'

distance = 261
spam score = 52
title = 'uses of class orgapachenutchfetcherfetcher2 nutch 09 api'

distance = 262
spam score = 55
title = 'uses of package orgapachenutchparsehtml nutch 09 api'

distance = 357
spam score = 62
title = 'uses of class orgapachenutchfetcherfetcher2inputformat nutch 09 api'

distance = 358
spam score = 66
title = 'orgapachenutchparserss nutch 09 api'

distance = 361
spam score = 59
title = 'uses of package orgapachenutchparserssstructs nutch 081 api'

distance = 362
spam score = 61
title = 'orgapachenutchparserss nutch 09 api'

distance = 363
spam score = 63
title = 'uses of package orgapachenutchparserssstructs nutch 09 api'

distance = 364
spam score = 63
title = 'orgapachenutchontology nutch 081 api'

distance = 365
spam score = 54
title = 'uses of class orgapachenutchsearchermoredatequeryfilter nutch 081 api'

distance = 365
spam score = 66
title = 'orgapachenutchservlet nutch 09 api'

distance = 366
spam score = 58
title = 'uses of class orgcreativecommonsnutchccqueryfilter nutch 081 api'

distance = 367
spam score = 53
title = 'orgapachenutchindexermore class hierarchy nutch 081 api'

distance = 411
spam score = 57
title = 'uses of class orgapachenutchparsemspowerpointfilteredstringwriter nutch 09 api'

distance = 411
spam score = 68
title = 'orgapachenutchsearcherbasic nutch 081 api'

distance = 412
spam score = 68
title = 'orgapachenutchindexerbasic nutch 09 api'

distance = 412
spam score = 56
title = 'uses of class orgapachenutchcrawlcrawldbreadercrawldbstatcombiner nutch 09 api'

distance = 412
spam score = 63
title = 'uses of class orgapachenutchprotocolfilefileresponse nutch 09 api'

distance = 412
spam score = 51
title = 'uses of class orgapachenutchscoringopicopicscoringfilter nutch 081 api'

distance = 412
spam score = 56
title = 'uses of package orgapachenutchtools nutch 09 api'

distance = 412
spam score = 53
title = 'uses of class orgapachenutchsearcherbasicbasicqueryfilter nutch 09 api'

distance = 413
spam score = 61
title = 'uses of class orgapachenutchparseextextparser nutch 09 api'

distance = 413
spam score = 64
title = 'orgapachenutchparsejs nutch 09 api'

distance = 456
spam score = 52
title = 'uses of class orgapachenutchcrawlcrawldbreadercrawldbstatcombiner nutch 081 api'

distance = 457
spam score = 60
title = 'uses of class orgcreativecommonsnutchccparsefilterwalker nutch 09 api'

distance = 457
spam score = 56
title = 'orgapachenutchparsepdf class hierarchy nutch 081 api'

distance = 457
spam score = 50
title = 'uses of class orgapachenutchclusteringcarrot2nutchdocument nutch 081 api'

distance = 459
spam score = 55
title = 'orgapachenutchparseswf class hierarchy nutch 081 api'

distance = 461
spam score = 71
title = 'orgapachenutchtoolscompat nutch 09 api'

distance = 461
spam score = 70
title = 'orgapachenutchsearcherurl nutch 09 api'

distance = 462
spam score = 53
title = 'uses of class orgapachenutchparsezipzipparser nutch 09 api'

distance = 463
spam score = 55
title = 'orgapachenutchparseswf class hierarchy nutch 09 api'

distance = 464
spam score = 50
title = 'uses of class orgapachenutchcrawlgeneratordecreasingfloatcomparator nutch 09 api'

distance = 504
spam score = 58
title = 'orgapachenutchparsems class hierarchy nutch 09 api'

distance = 504
spam score = 73
title = 'uses of package orgapachenutchanalysis nutch 09 api'

distance = 506
spam score = 62
title = 'orgapachenutchsearcherurl nutch 09 api'

distance = 506
spam score = 63
title = 'orgapachenutchparsemswordchp nutch 09 api'

distance = 506
spam score = 57
title = 'orgapachenutchparsemswordchp class hierarchy nutch 09 api'

distance = 507
spam score = 62
title = 'uses of package orgapachenutchanalysislang nutch 09 api'

distance = 507
spam score = 59
title = 'orgapachenutchsearchersite class hierarchy nutch 09 api'

distance = 508
spam score = 51
title = 'orgapachenutchparsemswordchp class hierarchy nutch 081 api'

distance = 508
spam score = 61
title = 'orgapachenutchurlfilterregex class hierarchy nutch 09 api'

distance = 509
spam score = 57
title = 'orgapachenutchurlfilterautomaton class hierarchy nutch 081 api'

distance = 572
spam score = 64
title = 'orgapachenutchscoring nutch 09 api'

distance = 573
spam score = 72
title = 'orgapachenutchurlfilterregex nutch 09 api'

distance = 573
spam score = 56
title = 'orgapachenutchlinkdb nutch 072 api'

distance = 573
spam score = 45
title = 'uses of class orgapachenutchsearchernutchbean nutch 09 api'

distance = 574
spam score = 67
title = 'orgapachenutchsummarylucene nutch 09 api'

distance = 575
spam score = 71
title = 'orgapachenutchscoring nutch 081 api'

distance = 578
spam score = 59
title = 'uses of package orgapachenutchnetprotocols nutch 081 api'

distance = 578
spam score = 67
title = 'orgapachenutchnetprotocols nutch 09 api'

distance = 579
spam score = 51
title = 'uses of interface orgapachenutchsearcherdistributedsearchprotocol nutch 09 api'

distance = 580
spam score = 71
title = 'orgapachenutchscoringopic nutch 081 api'

distance = 659
spam score = 55
title = 'orgapachenutchparsetext nutch 10dev api'

distance = 660
spam score = 72
title = 'orgapachenutchparsemsword nutch 081 api'

distance = 662
spam score = 73
title = 'orgapachenutchsearchermore nutch 09 api'

distance = 669
spam score = 58
title = 'orgapachenutchparsejs nutch 082dev api'

distance = 670
spam score = 62
title = 'orgapachenutchparsemsword nutch 09 api'

distance = 670
spam score = 52
title = 'orgapachenutchparsetext nutch 082dev api'

distance = 670
spam score = 57
title = 'orgapachenutchindexerbasic nutch 09 api'

distance = 671
spam score = 58
title = 'orgapachenutchtoolscompat nutch 10dev api'

distance = 672
spam score = 72
title = 'orgapachenutchsearchermore nutch 081 api'

distance = 673
spam score = 55
title = 'uses of class orgapachenutchprotocolfilefileexception nutch 09 api'

distance = 761
spam score = 71
title = 'orgapachenutchnet nutch 09 api'

distance = 761
spam score = 59
title = 'orgapachenutchparsepdf nutch 10dev api'

distance = 762
spam score = 57
title = 'uses of class orgapachenutchutilmimemimetypeexception nutch 09 api'

distance = 763
spam score = 58
title = 'orgapachenutchparsepdf nutch 082dev api'

distance = 763
spam score = 51
title = 'orgapachenutchclustering nutch 072 api'

distance = 765
spam score = 74
title = 'orgapachenutchsegment nutch 09 api'

distance = 769
spam score = 56
title = 'orgapachenutchscoring nutch 10dev api'

distance = 771
spam score = 52
title = 'orgapachenutchparserssstructs nutch 10dev api'

distance = 772
spam score = 59
title = 'uses of class orgapachenutchpluginextension nutch 09 api'

distance = 773
spam score = 53
title = 'orgapachenutchparsems nutch 09 api'

distance = 872
spam score = 48
title = 'uses of class orgapachenutchpluginpluginruntimeexception nutch 081 api'

distance = 874
spam score = 53
title = 'orgapachenutchsearchermore nutch 072 api'

distance = 878
spam score = 55
title = 'orgapachenutchprotocol nutch 072 api'

distance = 884
spam score = 68
title = 'orgapachenutchmetadata nutch 09 api'

distance = 886
spam score = 74
title = 'orgapachenutchmetadata nutch 09 api'

distance = 889
spam score = 72
title = 'orgapachenutchparsemspowerpoint nutch 081 api'

distance = 891
spam score = 54
title = 'orgapachenutchsearchermore nutch 10dev api'

distance = 894
spam score = 74
title = 'orgapachenutchparsemspowerpoint nutch 09 api'

distance = 894
spam score = 69
title = 'orgapachenutchtools nutch 09 api'

distance = 895
spam score = 63
title = 'orgapachenutchsegment nutch 09 api'

distance = 253
spam score = 54
title = 'uses of package orgjbossseamuihandler seam jsf controls 203cr1 api'

distance = 259
spam score = 43
title = 'orgjbossseamuiresource seam jsf controls 210sp1 api'

distance = 262
spam score = 51
title = 'uses of package orgjbossseamuihandler seam jsf controls 200ga api'

distance = 268
spam score = 51
title = 'uses of package orgjbossseamuifacelet seam jsf controls 200ga api'

distance = 270
spam score = 48
title = 'uses of class orgjbossseamuijpaentityloader seam jsf controls 210sp1 api'

distance = 270
spam score = 52
title = 'uses of package orgjbossseamuivalidator seam jsf controls 200ga api'

distance = 272
spam score = 52
title = 'uses of package orgjbossseamuihandler seam jsf controls 202sp1 api'

distance = 274
spam score = 47
title = 'uses of package orgjbossseamuifilter seam jsf controls 211ga api'

distance = 275
spam score = 48
title = 'uses of package orgjbossseamuiresource seam jsf controls 210sp1 api'

distance = 275
spam score = 48
title = 'uses of class orgjbossseamuientityconverter seam jsf controls 210sp1 api'

distance = 277
spam score = 47
title = 'uses of package orgjbossseamuihandler seam jsf controls 211ga api'

distance = 277
spam score = 54
title = 'uses of package orgjbossseamuivalidator seam jsf controls 202sp1 api'

distance = 280
spam score = 52
title = 'uses of class orgjbossseamuiutiljsf seam jsf controls 202sp1 api'

distance = 280
spam score = 51
title = 'uses of package orgjbossseamuifilter seam jsf controls 202sp1 api'

distance = 283
spam score = 50
title = 'uses of package orgjbossseamuiresource seam jsf controls 200ga api'

distance = 288
spam score = 55
title = 'uses of package orgjbossseamuifilter seam jsf controls 203cr1 api'

distance = 291
spam score = 44
title = 'orgjbossseamuiresource seam jsf controls 211ga api'

distance = 293
spam score = 52
title = 'uses of package orgjbossseamuirenderkit seam jsf controls 202sp1 api'

distance = 296
spam score = 51
title = 'uses of package orgjbossseamuifacelet seam jsf controls 202sp1 api'

distance = 298
spam score = 47
title = 'uses of package orgjbossseamuirenderkit seam jsf controls 210sp1 api'

distance = 373
spam score = 51
title = 'uses of class orgjbossseamuiconverterentityconverter seam jsf controls 202sp1 api'

distance = 374
spam score = 57
title = 'uses of class orgjbossseamuiconverterentityconverter seam jsf controls 203cr1 api'

distance = 375
spam score = 55
title = 'uses of class orgjbossseamuiconverterdatetimeconverter seam jsf controls 203cr1 api'

distance = 376
spam score = 48
title = 'uses of class orgjbossseamjsfsetdatamodel jboss seam api documentation'

distance = 377
spam score = 47
title = 'uses of class orgjbossseamuiconverteratomiclongconverter seam jsf controls 211ga api'

distance = 378
spam score = 48
title = 'uses of package orgjbossseamuifacelet seam jsf controls 210sp1 api'

distance = 379
spam score = 57
title = 'orgjbossseamuifacelet seam jsf controls 203cr1 api'

distance = 379
spam score = 54
title = 'orgjbossseamuifacelet seam jsf controls 200ga api'

distance = 379
spam score = 50
title = 'uses of class orgjbossseamuigraphicimageuitransformimagesize seam jsf controls 210sp1 api'

distance = 379
spam score = 58
title = 'uses of class orgjbossseamuicomponentuiselectitems seam jsf controls 203cr1 api'

distance = 425
spam score = 49
title = 'uses of class orgjbossseamelel jboss seam api documentation'

distance = 425
spam score = 47
title = 'uses of class orgjbossseamuiutilcdkmethodexpressiontomethodbinding seam jsf controls 210sp1 api'

distance = 426
spam score = 50
title = 'uses of package orgjbossseamui seam jsf controls 210sp1 api'

distance = 427
spam score = 48
title = 'orgjbossseamuihandler seam jsf controls 202sp1 api'

distance = 428
spam score = 55
title = 'orgjbossseamuiresource seam jsf controls 202sp1 api'

distance = 428
spam score = 56
title = 'orgjbossseamuiresource seam jsf controls 203cr1 api'

distance = 432
spam score = 56
title = 'uses of class orgjbossseamuicomponentuiseamcommandbase seam jsf controls 202sp1 api'

distance = 433
spam score = 48
title = 'orgjbossseaminit jboss seam api documentation'

distance = 438
spam score = 60
title = 'orgjbossseamuifilter class hierarchy seam jsf controls 202sp1 api'

distance = 440
spam score = 46
title = 'uses of class orgjbossseamuifilterajax4jsffilterinstantiator seam jsf controls 211ga api'

distance = 487
spam score = 48
title = 'uses of class orgjbossseamuicomponentuiselection seam jsf controls 211ga api'

distance = 487
spam score = 48
title = 'uses of class orgjbossseamservletcontextualhttpservletrequest jboss seam api documentation'

distance = 488
spam score = 50
title = 'uses of interface orgjbossseamuigraphicimageimagetransform seam jsf controls 202sp1 api'

distance = 488
spam score = 53
title = 'orgjbossseamuiutil class hierarchy seam jsf controls 202sp1 api'

distance = 489
spam score = 44
title = 'orgjbossseamuivalidator seam jsf controls 210sp1 api'

distance = 489
spam score = 47
title = 'orgjbossseamdebug jboss seam api documentation'

distance = 491
spam score = 47
title = 'uses of class orgjbossseaminitdeploymentdescriptor jboss seam api documentation'

distance = 491
spam score = 54
title = 'orgjbossseamuiutil seam jsf controls 203cr1 api'

distance = 492
spam score = 56
title = 'orgjbossseamuicomponenthtml seam jsf controls 202sp1 api'

distance = 492
spam score = 48
title = 'uses of class orgjbossseamservletcontextualhttpservletrequest jboss seam api documentation'

distance = 520
spam score = 49
title = 'uses of class orgjbossseampersistencehibernatepersistenceprovider jboss seam api documentation'

distance = 521
spam score = 45
title = 'uses of class orgjbossseamjmsmanagedqueuesender jboss seam api documentation'

distance = 523
spam score = 46
title = 'uses of class orgjbossseamjmsmanagedqueuesender jboss seam api documentation'

distance = 525
spam score = 50
title = 'uses of package orgjbossseamannotationsasync jboss seam api documentation'

distance = 526
spam score = 48
title = 'uses of class orgjbossseamservletseamlistener jboss seam api documentation'

distance = 528
spam score = 49
title = 'orgjbossseamuiutil seam jsf controls 200ga api'

distance = 529
spam score = 49
title = 'uses of class orgjbossseamjmsmanagedqueuesender jboss seam api documentation'

distance = 530
spam score = 47
title = 'orgjbossseamejb jboss seam api documentation'

distance = 531
spam score = 65
title = 'overview seam jsf controls 200ga api'

distance = 532
spam score = 46
title = 'orgjbossseamuiconverter seam jsf controls 211ga api'

distance = 580
spam score = 52
title = 'uses of class orgjbossseamutilconversionsassociativepropertyvalue jboss seam api documentation'

distance = 580
spam score = 53
title = 'orgjbossseamuivalidator class hierarchy seam jsf controls 200ga api'

distance = 581
spam score = 46
title = 'uses of interface orgjbossseamsecurityadapterauthenticationadapter jboss seam api documentation'

distance = 585
spam score = 48
title = 'uses of class orgjbossseamutilconversionslistconverter jboss seam api documentation'

distance = 585
spam score = 50
title = 'uses of class orgjbossseamuicomponentuiselectdate seam jsf controls 202sp1 api'

distance = 588
spam score = 48
title = 'uses of class orgjbossseamutilconversionsclassconverter jboss seam api documentation'

distance = 589
spam score = 51
title = 'uses of class orgjbossseamutilconversionsenumconverter jboss seam api documentation'

distance = 589
spam score = 50
title = 'uses of class orgjbossseamutilconversionspropertiesconverter jboss seam api documentation'

distance = 591
spam score = 41
title = 'orgjbossseamlog class hierarchy jboss seam api documentation'

distance = 592
spam score = 65
title = 'overview seam jsf controls 203cr1 api'

distance = 644
spam score = 57
title = 'uses of class orgjbossseamuiconverterentityconverterabstractentityloader seam jsf controls 202sp1 api'

distance = 647
spam score = 43
title = 'uses of class orgjbossseamcaptchacaptchaimage jboss seam api documentation'

distance = 648
spam score = 60
title = 'orgjbossseamuiutilcdk seam jsf controls 202sp1 api'

distance = 651
spam score = 54
title = 'deprecated list seam jsf controls 210sp1 api'

distance = 653
spam score = 56
title = 'orgjbossseamuiutilcdk seam jsf controls 203cr1 api'

distance = 654
spam score = 50
title = 'orgjbossseamsecurityjaas class hierarchy jboss seam api documentation'

distance = 654
spam score = 53
title = 'orgjbossseamuigraphicimage seam jsf controls 202sp1 api'

distance = 654
spam score = 54
title = 'orgjbossseamannotationsfaces jboss seam api documentation'

distance = 654
spam score = 51
title = 'orgjbossseamuigraphicimage seam jsf controls 202sp1 api'

distance = 657
spam score = 53
title = 'orgjbossseamuiutilcdk seam jsf controls 211ga api'

distance = 705
spam score = 51
title = 'orgjbossseamuihandler class hierarchy seam jsf controls 202sp1 api'

distance = 705
spam score = 57
title = 'orgjbossseamuiconverterentityconverter seam jsf controls 203cr1 api'

distance = 709
spam score = 53
title = 'orgjbossseamuiconverterentityconverter seam jsf controls 202sp1 api'

distance = 713
spam score = 48
title = 'orgjbossseamannotationsweb class hierarchy jboss seam api documentation'

distance = 713
spam score = 69
title = 'deprecated list seam jsf controls 202sp1 api'

distance = 717
spam score = 56
title = 'deprecated list seam jsf controls 202sp1 api'

distance = 720
spam score = 51
title = 'orgjbossseamwebservice jboss seam api documentation'

distance = 721
spam score = 51
title = 'orgjbossseamuicomponent seam jsf controls 200ga api'

distance = 726
spam score = 57
title = 'deprecated list seam jsf controls 200ga api'

distance = 727
spam score = 47
title = 'uses of class orgjbossseamjsfarraydatamodel jboss seam api documentation'

distance = 816
spam score = 52
title = 'orgjbossseamexception jboss seam api documentation'

distance = 817
spam score = 38
title = 'orgjbossseamsecuritydigest jboss seam api documentation'

distance = 817
spam score = 42
title = 'orgjbossseamtext class hierarchy jboss seam api documentation'

distance = 817
spam score = 46
title = 'ejbdummy jboss seam api documentation'

distance = 818
spam score = 45
title = 'uses of interface orgjbossseamloglog jboss seam api documentation'

distance = 829
spam score = 49
title = 'orgjbossseamtext class hierarchy jboss seam api documentation'

distance = 834
spam score = 63
title = 'orgrichfacesuimodel richfaces jsf components library 330ga api'

distance = 849
spam score = 48
title = 'orgjbossseamannotationstimer jboss seam api documentation'

distance = 850
spam score = 47
title = 'orgjbossseamjms jboss seam api documentation'

distance = 852
spam score = 50
title = 'orgjbossseamuiutilcdk seam jsf controls 200ga api'

distance = 1352
spam score = 67
title = 'orgrichfacesrenderkithtmlimages richfaces jsf components library 330ga api'

distance = 1888
spam score = 63
title = 'southern rights gaurds'

distance = 165
spam score = 71
title = ''

distance = 178
spam score = 70
title = ''

distance = 187
spam score = 69
title = ''

distance = 202
spam score = 75
title = ''

distance = 206
spam score = 75
title = ''

distance = 208
spam score = 69
title = ''

distance = 216
spam score = 64
title = ''

distance = 220
spam score = 65
title = ''

distance = 221
spam score = 73
title = ''

distance = 237
spam score = 68
title = ''

distance = 240
spam score = 63
title = ''

distance = 250
spam score = 67
title = ''

distance = 257
spam score = 77
title = ''

distance = 260
spam score = 74
title = ''

distance = 271
spam score = 62
title = ''

distance = 297
spam score = 74
title = ''

distance = 316
spam score = 73
title = ''

distance = 363
spam score = 73
title = ''

distance = 366
spam score = 62
title = ''

distance = 418
spam score = 75
title = ''

distance = 430
spam score = 77
title = ''

distance = 437
spam score = 65
title = ''

distance = 489
spam score = 74
title = ''

distance = 523
spam score = 72
title = ''

distance = 524
spam score = 71
title = ''

distance = 553
spam score = 72
title = ''

distance = 625
spam score = 71
title = ''

distance = 686
spam score = 78
title = ''

distance = 699
spam score = 74
title = ''

distance = 723
spam score = 72
title = ''

distance = 1040
spam score = 78
title = ''

distance = 1257
spam score = 62
title = ''

distance = 1281
spam score = 66
title = ''

distance = 1883
spam score = 33
title = ''

distance = 226
spam score = 63
title = 'ulonglongseqholder java 2 platform se 50'

distance = 228
spam score = 65
title = 'ushortseqholder java 2 platform se 50'

distance = 230
spam score = 60
title = 'wstringseqholder java 2 platform se 50'

distance = 239
spam score = 65
title = 'longlongseqholder java 2 platform se 50'

distance = 239
spam score = 64
title = 'ushortseqholder java 2 platform se v142'

distance = 239
spam score = 59
title = 'wstringseqholder java 2 platform se v142'

distance = 243
spam score = 64
title = 'floatseqholder java 2 platform se 50'

distance = 244
spam score = 69
title = 'longlongseqholder java 2 platform se 50'

distance = 247
spam score = 67
title = 'longlongseqholder java 2 platform se v142'

distance = 247
spam score = 64
title = 'longlongseqholder java 2 platform se v142'

distance = 248
spam score = 66
title = 'shortseqholder java 2 platform se 50'

distance = 248
spam score = 64
title = 'longseqholder java 2 platform se 50'

distance = 253
spam score = 63
title = 'booleanseqholder java 2 platform se 50'

distance = 253
spam score = 70
title = 'shortseqholder java platform se 6'

distance = 254
spam score = 65
title = 'anyseqholder java 2 platform se 50'

distance = 255
spam score = 66
title = 'longseqholder java 2 platform se v142'

distance = 256
spam score = 65
title = 'longseqholder java 2 platform se 50'

distance = 256
spam score = 64
title = 'anyseqholder java 2 platform se 50'

distance = 257
spam score = 70
title = 'longlongseqholder java platform se 6'

distance = 257
spam score = 65
title = 'wcharseqholder java 2 platform se 50'

distance = 285
spam score = 69
title = 'policylistholder java platform se 6'

distance = 285
spam score = 63
title = 'iorinterceptor30holder java platform se 6'

distance = 286
spam score = 64
title = 'currentholder java platform se 6'

distance = 287
spam score = 61
title = 'octetseqholder java 2 platform se v141'

distance = 288
spam score = 64
title = 'octetseqholder java 2 platform se v142'

distance = 293
spam score = 69
title = 'octetseqholder java platform se 6'

distance = 293
spam score = 70
title = 'ulongseqholder java platform se 6'

distance = 294
spam score = 60
title = 'bindinglistholder java 2 platform se v141'

distance = 296
spam score = 64
title = 'policylistholder java platform se 6'

distance = 298
spam score = 61
title = 'bindingholder java 2 platform se 50'

distance = 339
spam score = 59
title = 'taggedcomponentholder java 2 platform se 50'

distance = 341
spam score = 56
title = 'nameholder java 2 platform se v141'

distance = 345
spam score = 62
title = 'bindingtypeholder java 2 platform se 50'

distance = 353
spam score = 66
title = 'namingcontextholder java 2 platform se 50'

distance = 357
spam score = 57
title = 'bindingtypeholder java 2 platform se v141'

distance = 360
spam score = 62
title = 'objectreferencefactoryholder java platform se 6'

distance = 360
spam score = 59
title = 'namecomponentholder java 2 platform se 50'

distance = 361
spam score = 61
title = 'notfoundholder java 2 platform se 50'

distance = 365
spam score = 62
title = 'namingcontextextholder java 2 platform se 50'

distance = 370
spam score = 65
title = 'notemptyholder java 2 platform se 50'

distance = 431
spam score = 49
title = 'java 2 platform se v131 class shortseqholder'

distance = 432
spam score = 55
title = 'java 2 platform se v13 class bindinglistholder'

distance = 432
spam score = 50
title = 'java 2 platform se v131 class longlongseqholder'

distance = 437
spam score = 50
title = 'java 2 platform se v131 class doubleseqholder'

distance = 437
spam score = 47
title = 'java 2 platform se v131 class bindinglistholder'

distance = 438
spam score = 55
title = 'java 2 platform se v13 class bindingholder'

distance = 438
spam score = 49
title = 'java 2 platform se v131 class bindingholder'

distance = 439
spam score = 51
title = 'java 2 platform se v131 class doubleseqholder'

distance = 440
spam score = 48
title = 'java 2 platform se v131 class anyseqholder'

distance = 440
spam score = 58
title = 'java 2 platform se v131 class anyseqholder'

distance = 475
spam score = 62
title = 'java 2 platform se v13 class alreadyboundholder'

distance = 475
spam score = 49
title = 'java 2 platform se v131 class notfoundreasonholder'

distance = 475
spam score = 49
title = 'java 2 platform se v131 class alreadyboundholder'

distance = 475
spam score = 61
title = 'java 2 platform se v13 class alreadyboundholder'

distance = 475
spam score = 61
title = 'java 2 platform se v13 class alreadyboundholder'

distance = 479
spam score = 55
title = 'java 2 platform se v13 class namecomponentholder'

distance = 480
spam score = 73
title = 'anyseqholder novell extend messaging platform api 51'

distance = 483
spam score = 79
title = 'charseqholder novell extend messaging platform api 51'

distance = 484
spam score = 77
title = 'booleanseqholder novell extend messaging platform api 51'

distance = 487
spam score = 48
title = 'javatm 2 platform standard edition v122 api specification class bindinglistholder'

distance = 525
spam score = 45
title = 'javatm 2 platform standard edition v122 api specification class alreadyboundholder'

distance = 526
spam score = 52
title = 'javatm 2 platform standard edition v122 api specification class alreadyboundholder'

distance = 526
spam score = 50
title = 'javatm 2 platform standard edition v122 api specification class nameholder'

distance = 527
spam score = 65
title = 'namecomponentholder java 2 platform se v141'

distance = 528
spam score = 44
title = 'javatm 2 platform standard edition v122 api specification class bindingtypeholder'

distance = 528
spam score = 49
title = 'javatm 2 platform standard edition v122 api specification class alreadyboundholder'

distance = 528
spam score = 49
title = 'javatm 2 platform standard edition v122 api specification class nameholder'

distance = 536
spam score = 51
title = 'javatm 2 platform standard edition v122 api specification class notemptyholder'

distance = 537
spam score = 73
title = 'bindinglistholder novell extend messaging platform api 51'

distance = 538
spam score = 47
title = 'javatm 2 platform standard edition v122 api specification class notfoundreasonholder'

distance = 604
spam score = 77
title = 'streamable java 2 platform se v142'

distance = 607
spam score = 62
title = 'invalidaddressholder novell extend messaging platform api 51'

distance = 609
spam score = 72
title = 'streamable java 2 platform se v142'

distance = 612
spam score = 69
title = 'java 2 platform se v131 interface streamable'

distance = 612
spam score = 69
title = 'streamable java 2 platform se v142'

distance = 613
spam score = 68
title = 'streamable java 2 platform se 50'

distance = 615
spam score = 66
title = 'streamable java 2 platform se 50'

distance = 616
spam score = 81
title = 'streamable java platform se 6'

distance = 619
spam score = 68
title = 'streamable java platform se 6'

distance = 620
spam score = 67
title = 'streamable java 2 platform se 50'

distance = 841
spam score = 64
title = 'bindingtypeholder'

distance = 855
spam score = 43
title = 'java platform 12 api specification class bindinglistholder'

distance = 856
spam score = 38
title = 'java platform 12 api specification class bindinglistholder'

distance = 870
spam score = 41
title = 'java platform 12 api specification class notfoundholder'

distance = 874
spam score = 65
title = 'unknownencodingholder'

distance = 883
spam score = 59
title = 'invalidaddressholder'

distance = 886
spam score = 61
title = 'alreadyboundholder'

distance = 890
spam score = 46
title = 'java platform 12 api specification class alreadyboundholder'

distance = 892
spam score = 44
title = 'java platform 12 api specification class alreadyboundholder'

distance = 896
spam score = 43
title = 'java platform 12 api specification class alreadyboundholder'

distance = 1010
spam score = 61
title = 'java 2 platform ee v13 interface streamable'

distance = 1043
spam score = 70
title = 'transactionservice 140 class notpreparedholder'

distance = 1044
spam score = 58
title = 'streamable j2ee14 sdk'

distance = 1048
spam score = 56
title = 'classe notemptyholder sur javasearchdeveloppezcom le moteur de recherche de la javadoc club dentraide des deacuteveloppeurs francophones'

distance = 1051
spam score = 70
title = 'transactionservice 140 class notransactionholder'

distance = 1052
spam score = 70
title = 'transactionservice 140 class synchronizationholder'

distance = 1056
spam score = 58
title = 'transactionservice 140 class managerholder'

distance = 1058
spam score = 74
title = 'transactionservice 140 class notsubtransactionholder'

distance = 1060
spam score = 71
title = 'transactionservice 140 class controlholder'

distance = 1063
spam score = 73
title = 'transactionservice 140 class otidtholder'

distance = 1936
spam score = 57
title = 'socialist yugoslavia signals for nonmilitary ships'

distance = 558
spam score = 86
title = ''

distance = 595
spam score = 83
title = ''

distance = 689
spam score = 82
title = ''

distance = 251
spam score = 54
title = 'uses of class orgapachesynapsesynapseconstants apache synapse 12 api'

distance = 259
spam score = 50
title = 'uses of class orgapachesynapsesynapseserver apache synapse 12 api'

distance = 293
spam score = 59
title = 'uses of class orgapachemavenjxrjxr maven jxr 21 api'

distance = 297
spam score = 53
title = 'uses of class orgapachesynapsestatisticsstatisticsholder apache synapse 12 api'

distance = 307
spam score = 53
title = 'uses of package orgapachehadoop hadoop 0172 api'

distance = 319
spam score = 64
title = 'uses of package orgapachesynapsehandler apache synapse 12 api'

distance = 319
spam score = 50
title = 'uses of package orgapachemavenutil maven 11 api'

distance = 323
spam score = 53
title = 'uses of class orgapachesynapsemetricsmetricsaggregatormodule apache synapse 12 api'

distance = 324
spam score = 53
title = 'uses of class orgapachesynapseendpointsendpointcontext apache synapse 12 api'

distance = 325
spam score = 63
title = 'uses of package orgapachesynapsemetrics apache synapse 12 api'

distance = 326
spam score = 49
title = 'uses of class orgapachesynapseutilsynapsebinarydatasource apache synapse 12 api'

distance = 327
spam score = 53
title = 'uses of class orgapachesynapseutilsimplemapimpl apache synapse 12 api'

distance = 327
spam score = 53
title = 'uses of class orgapachesynapseendpointsaddressendpoint apache synapse 12 api'

distance = 328
spam score = 53
title = 'uses of class orgapachesynapseutilhandlerutil apache synapse 12 api'

distance = 328
spam score = 52
title = 'uses of class orgapachesynapseformattextfromelementdatasource apache synapse 12 api'

distance = 329
spam score = 55
title = 'uses of package orgapachesandesha2util apache sandesha2 11 api'

distance = 330
spam score = 57
title = 'uses of class orgapachejackrabbitrmijackrabbitserverjackrabbitnodetypemanager apache jackrabbit 14 api'

distance = 331
spam score = 63
title = 'uses of package orgapacheshaletaglib shale core 104 api'

distance = 332
spam score = 57
title = 'uses of package orgapachezookeeperserver zookeeper 301 api'

distance = 332
spam score = 52
title = 'uses of class orgapachesynapseutilclasspathurlstreamhandler apache synapse 12 api'

distance = 437
spam score = 53
title = 'uses of class orgapachesynapsecoreaxis2messagecontextcreatorforaxis2 apache synapse 12 api'

distance = 437
spam score = 51
title = 'uses of class orgapachesynapsetransportbasethreadsnativeworkerpool apache synapse 12 api'

distance = 437
spam score = 50
title = 'uses of class orgapachelog4jchainsawdndfiledndtarget apache chainsaw 1990 api'

distance = 437
spam score = 56
title = 'uses of class orgapachelog4jhelpersdatetimedateformat apache log4j 1215 api'

distance = 438
spam score = 58
title = 'deprecated list commons chain 12 test api'

distance = 438
spam score = 58
title = 'uses of package orgapachezookeeperserverquorum zookeeper 301 api'

distance = 438
spam score = 58
title = 'uses of package orgapachezookeeperserverquorum zookeeper 301 api'

distance = 438
spam score = 54
title = 'uses of package orgapachesolrservlet solr nightly api'

distance = 438
spam score = 52
title = 'uses of class orgapachesynapsemediatorseipeiputils apache synapse 12 api'

distance = 438
spam score = 59
title = 'uses of class orgapachejuddifunctiondeletesubscriptionfunction juddiparent 20rc5 api'

distance = 471
spam score = 50
title = 'uses of class orgapachelog4jjmxlayoutdynamicmbean apache log4j 1215 api'

distance = 472
spam score = 51
title = 'uses of class orgapachetexenanttexentask texen 10snapshot api'

distance = 472
spam score = 59
title = 'uses of class orgapachejuddiuuidgennativeuuidgen juddiparent 20rc5 api'

distance = 472
spam score = 66
title = 'uses of package orgapachesynapsetransportamqp apache synapse 12 api'

distance = 472
spam score = 54
title = 'uses of class orgapachesandesha2securityrampartrampartbasedsecuritymanager apache sandesha2 11 api'

distance = 473
spam score = 57
title = 'uses of class orgapacheturbineutiluridatauri turbine2 24snapshot api'

distance = 473
spam score = 53
title = 'uses of class orgapachelog4jorjmsmessagerenderer apache log4j 1215 api'

distance = 473
spam score = 58
title = 'deprecated list shale spring integration 104 api'

distance = 473
spam score = 56
title = 'uses of class orgapachejuddiauthauthenticatorfactory juddiparent 20rc5 api'

distance = 473
spam score = 58
title = 'uses of class orgapachesandesha2storageinmemoryinmemoryrmdbeanmgr apache sandesha2 11 api'

distance = 503
spam score = 61
title = 'uses of class orgapachetexenutilpropertiesutil texen 10snapshot api'

distance = 503
spam score = 53
title = 'uses of class orgapacheportalsbridgesperlperlcontentrewriter perl bridge 104 api'

distance = 503
spam score = 53
title = 'uses of class orgapachelog4jxmlutilloggingentityresolver apache receivers companion for log4j 12 10snapshot api'

distance = 503
spam score = 54
title = 'deprecated list maven changelog plugin 192 api'

distance = 503
spam score = 56
title = 'uses of class orgapachejuddihandlerbusinessinfoshandler juddiparent 20rc5 api'

distance = 504
spam score = 51
title = 'uses of class orgapachejamesmime4jdecodercodecutil apache james mime4j 05 api'

distance = 504
spam score = 62
title = 'uses of class orgapachejuddiregistryadminservice juddiparent 20rc5 api'

distance = 504
spam score = 55
title = 'uses of class orgapachejuddihandlerbusinessentityhandler juddiparent 20rc5 api'

distance = 504
spam score = 53
title = 'uses of class orgapachejamesmime4jparsermimetokenembeddedmessagetest apache james mime4j 06snapshot test api'

distance = 504
spam score = 51
title = 'uses of class orgapacheabderai18ntexturlencoding abdera bundle jar 040incubating api'

distance = 541
spam score = 52
title = 'uses of class orgapachexmlrpcparserbigintegerparser apache xmlrpc 311 api'

distance = 541
spam score = 47
title = 'uses of class orgapachelog4jdbdialectpostgresqldialect apache receivers companion for log4j 12 10snapshot api'

distance = 541
spam score = 72
title = 'deprecated list maven file management api 121 api'

distance = 541
spam score = 47
title = 'uses of class orgapachelog4jdbdialectmysqldialect apache receivers companion for log4j 12 10snapshot api'

distance = 541
spam score = 59
title = 'uses of class orgapachejuddidatatyperequestdeletebusiness juddiparent 20rc5 api'

distance = 542
spam score = 46
title = 'uses of class samplesuserguidepwcallback apache synapse 12 api'

distance = 542
spam score = 54
title = 'uses of class orgapachehttpauthusernamepasswordcredentials httpclient 40beta2 api'

distance = 544
spam score = 51
title = 'uses of class orgapachejamesmime4jfieldcontentdispositioncontentdispositiontest apache james mime4j 06snapshot test api'

distance = 544
spam score = 61
title = 'deprecated list shale tiger extensions 104 api'

distance = 544
spam score = 53
title = 'uses of class orgapachejamespostagepostageruntimeexception apache james postage 01snapshot api'

distance = 584
spam score = 57
title = 'uses of package orgapachesynapseendpointsdispatch apache synapse 12 api'

distance = 584
spam score = 50
title = 'uses of class orgapachehttpimplniosslclientioeventdispatch httpcore nio 40 api'

distance = 585
spam score = 56
title = 'uses of interface javaxservletservletrequestattributelistener servlet api documentation'

distance = 585
spam score = 46
title = 'uses of class orgapachemavencontinuumwebactionbuildresultslistaction continuum project 131snapshot api'

distance = 586
spam score = 48
title = 'uses of class orgapachemavencontinuumprojectbuildermavenmavenonecontinuumprojectbuilder continuum project 131snapshot api'

distance = 586
spam score = 49
title = 'uses of interface orgapachelog4jpluginspauseable apache component companion for log4j 12 10snapshot api'

distance = 587
spam score = 56
title = 'uses of class orgapachelog4jchainsawreceiversreceivershelper apache chainsaw 1990 api'

distance = 587
spam score = 55
title = 'uses of class orgapachehttpcliententityurlencodedformentity httpclient 40beta2 api'

distance = 587
spam score = 62
title = 'deprecated list apache james jsieve mailet 03snapshot api'

distance = 587
spam score = 54
title = 'uses of class orgapachesynapseconfigxmlendpointsutilswsdl11endpointbuilder apache synapse 12 api'

distance = 622
spam score = 51
title = 'uses of interface orgapachehadoopexamplesdancingsudokucolumnname hadoop 0172 api'

distance = 622
spam score = 56
title = 'uses of class orgjbehavescenarioparserclasspathscenariodefiner jbehave core 21 api'

distance = 622
spam score = 68
title = 'uses of class orgapachehttpentitymimemultipartentity httpmime 40beta2 api'

distance = 623
spam score = 53
title = 'uses of class orgjbehavescenariomostusefulconfiguration jbehave core 21 api'

distance = 623
spam score = 53
title = 'uses of class orgapachehttpimplconndefaultresponseparser httpclient 40beta2 api'

distance = 623
spam score = 56
title = 'overview maven wagon api 10beta5snapshot test api'

distance = 623
spam score = 54
title = 'uses of class orgapachehttpimplconnhelper httpclient 40beta2 test api'

distance = 623
spam score = 48
title = 'uses of class orgapachemavencontinuumexecutionmanagerdefaultbuildexecutormanager continuum project 131snapshot api'

distance = 623
spam score = 51
title = 'uses of class orgapachelog4jhelpersmdckeysetextractor apache extras companion for log4j 12 10 api'

distance = 623
spam score = 51
title = 'uses of class orgapachehttpimplcookiebasicexpireshandler httpclient 40beta2 api'

distance = 703
spam score = 67
title = 'uses of class orgnuinintegrationjenardqlqueryservice nuin api documentation'

distance = 703
spam score = 54
title = 'uses of package orgapachemavenrepository maven 11 api'

distance = 703
spam score = 58
title = 'uses of class orgapachehttplocalserverlocaltestserverrequestlistenerworker httpclient 40beta2 test api'

distance = 704
spam score = 50
title = 'uses of class orgapacheaxis2jaxwsruntimedescriptionmarshalimplannotationbuilder axis2 api'

distance = 704
spam score = 56
title = 'uses of class orgapachehttpimplcookietestrfc2109cookieattribhandlers httpclient 40beta2 test api'

distance = 704
spam score = 53
title = 'uses of class orgapachelog4jpatternformattinginfo apache extras companion for log4j 12 10 api'

distance = 704
spam score = 54
title = 'uses of class orgapachelog4jchainsawabstractpreferencepanel apache chainsaw 1990 api'

distance = 705
spam score = 59
title = 'uses of class orgapachewicketprotocolhttpabstracthttpsessionstore wicket 132 api'

distance = 706
spam score = 61
title = 'uses of class orgapacheportalsbridgesgroovygroovyportlet groovy bridge 104 api'

distance = 706
spam score = 51
title = 'uses of class orgapachecontinuumconfigurationmodelioxpp3continuumconfigurationmodelxpp3writer continuum project 131snapshot api'

distance = 857
spam score = 60
title = 'uses of package orgapachejamesjspfpolicies apache james jspf 096snapshot api'

distance = 859
spam score = 69
title = 'deprecated list shale test framework 104 api'

distance = 860
spam score = 61
title = 'uses of interface orgapachejuddidatastoredatastore juddiparent 20rc5 api'

distance = 861
spam score = 56
title = 'uses of class orgapachejamesmime4jfieldmimeversionparseexception apache james mime4j 06snapshot api'

distance = 863
spam score = 53
title = 'uses of class orgapacheabderaprotocolservercontextresponsecontextwrapper abdera bundle jar 040incubating api'

distance = 867
spam score = 61
title = 'uses of class orgapachejuddidatatyperesponseserviceinfos juddiparent 20rc5 api'

distance = 868
spam score = 58
title = 'uses of class orgjibblepircbotpircbot pircbot 146 java irc api bot framework'

distance = 870
spam score = 59
title = 'uses of class orgapachejuddidatatypebindinginstanceparms juddiparent 20rc5 api'

distance = 871
spam score = 52
title = 'uses of interface orgapachelog4jchainsawshutdownlistener apache chainsaw 1990 api'

distance = 874
spam score = 80
title = 'overview juddiparent 20rc5 api'

distance = 1420
spam score = 54
title = 'uses of class orgapachejuddidatatypename juddiparent 20rc5 api'

distance = 1439
spam score = 68
title = 'uses of class orgapachelogoutputabstracttarget apache excalibur api'

distance = 1450
spam score = 54
title = 'uses of class orgapachezookeeperdatastat zookeeper 301 api'

distance = 1836
spam score = 75
title = 'the evolution of the reboundair safety hinge'

distance = 1842
spam score = 76
title = 'the evolution of the reboundair safety hinge'

distance = 470
spam score = 57
title = ''

distance = 516
spam score = 59
title = ''

distance = 564
spam score = 48
title = ''

distance = 565
spam score = 56
title = ''

distance = 914
spam score = 70
title = ''

distance = 198
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorletvaractionvisitor czt corejava 210 api'

distance = 215
spam score = 66
title = 'uses of interface netsourceforgecztcircusvisitorextchoiceprocessvisitor czt corejava 210 api'

distance = 216
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorifguardedcommandvisitor czt corejava 210 api'

distance = 216
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorcallactionvisitor czt corejava 210 api'

distance = 217
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorguardedactionvisitor czt corejava 210 api'

distance = 218
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorletmuactionvisitor czt corejava 210 api'

distance = 218
spam score = 66
title = 'uses of interface netsourceforgecztcircusvisitorinterleaveactionvisitor czt corejava 210 api'

distance = 218
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorprefixingactionvisitor czt corejava 210 api'

distance = 220
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorcircusfieldlistvisitor czt corejava 210 api'

distance = 222
spam score = 65
title = 'uses of interface netsourceforgecztcircusvisitoralphabetisedparallelprocessidxvisitor czt corejava 210 api'

distance = 223
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorinputfieldvisitor czt corejava 210 api'

distance = 223
spam score = 62
title = 'uses of interface netsourceforgecztcircusvisitorassignmentcommandvisitor czt corejava 210 api'

distance = 224
spam score = 66
title = 'uses of interface netsourceforgecztzvisitornegexprvisitor czt corejava 210 api'

distance = 225
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorhideactionvisitor czt corejava 210 api'

distance = 226
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitoralphabetisedparallelprocessvisitor czt corejava 210 api'

distance = 228
spam score = 65
title = 'uses of interface netsourceforgecztcircusvisitorextchoiceactionitevisitor czt corejava 210 api'

distance = 229
spam score = 62
title = 'uses of interface netsourceforgecztcircusvisitorbasicchannelsetexprvisitor czt corejava 210 api'

distance = 231
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorassignmentpairsvisitor czt corejava 210 api'

distance = 231
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorcommunicationvisitor czt corejava 210 api'

distance = 231
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorforallpredvisitor czt corejava 210 api'

distance = 241
spam score = 66
title = 'uses of interface netsourceforgecztzvisitorrenameexprvisitor czt corejava 210 api'

distance = 242
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorcondexprvisitor czt corejava 210 api'

distance = 245
spam score = 66
title = 'uses of interface netsourceforgecztzvisitorandexprvisitor czt corejava 210 api'

distance = 245
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorfreeparavisitor czt corejava 210 api'

distance = 246
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorexistspredvisitor czt corejava 210 api'

distance = 246
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorimpliesexprvisitor czt corejava 210 api'

distance = 247
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorincldeclvisitor czt corejava 210 api'

distance = 247
spam score = 67
title = 'uses of interface netsourceforgecztzvisitororpredvisitor czt corejava 210 api'

distance = 247
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorchanneldeclvisitor czt corejava 210 api'

distance = 248
spam score = 67
title = 'uses of interface netsourceforgecztzvisitoroperatorvisitor czt corejava 210 api'

distance = 262
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorchannelsetparavisitor czt corejava 210 api'

distance = 264
spam score = 64
title = 'uses of interface netsourceforgecztzvisitorzvisitor czt corejava 210 api'

distance = 266
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorchaosactionvisitor czt corejava 210 api'

distance = 267
spam score = 65
title = 'uses of interface netsourceforgecztcircusvisitorparamprocessvisitor czt corejava 210 api'

distance = 268
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorprocesstransformerpredvisitor czt corejava 210 api'

distance = 270
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitornamesettypevisitor czt corejava 210 api'

distance = 274
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorapplexprvisitor czt corejava 210 api'

distance = 274
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorandpredvisitor czt corejava 210 api'

distance = 275
spam score = 63
title = 'uses of interface netsourceforgecztcircusvisitorqualifieddeclvisitor czt corejava 210 api'

distance = 275
spam score = 65
title = 'uses of interface netsourceforgecztcircusvisitorstopactionvisitor czt corejava 210 api'

distance = 283
spam score = 66
title = 'uses of interface netsourceforgecztcircusvisitoralphabetisedparallelprocessitevisitor czt corejava 210 api'

distance = 283
spam score = 66
title = 'uses of interface netsourceforgecztzvisitorlocannvisitor czt corejava 210 api'

distance = 283
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorseqactionvisitor czt corejava 210 api'

distance = 283
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorrenameprocessvisitor czt corejava 210 api'

distance = 284
spam score = 66
title = 'uses of interface netsourceforgecztcircusvisitoractiontransformerpredvisitor czt corejava 210 api'

distance = 287
spam score = 66
title = 'uses of interface netsourceforgecztcircusvisitorbasicprocessvisitor czt corejava 210 api'

distance = 288
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorvardeclcommandvisitor czt corejava 210 api'

distance = 288
spam score = 66
title = 'uses of interface netsourceforgecztcircusvisitorextchoiceprocessitevisitor czt corejava 210 api'

distance = 289
spam score = 67
title = 'uses of interface netsourceforgecztzvisitormempredvisitor czt corejava 210 api'

distance = 289
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorgiventypevisitor czt corejava 210 api'

distance = 298
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorthetaexprvisitor czt corejava 210 api'

distance = 298
spam score = 66
title = 'uses of interface netsourceforgecztcircusvisitorinterleaveprocessvisitor czt corejava 210 api'

distance = 302
spam score = 67
title = 'uses of interface netsourceforgecztzvisitoriffexprvisitor czt corejava 210 api'

distance = 303
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorcompexprvisitor czt corejava 210 api'

distance = 304
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorsigmaexprvisitor czt corejava 210 api'

distance = 304
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorgivenparavisitor czt corejava 210 api'

distance = 305
spam score = 64
title = 'uses of interface netsourceforgecztcircusvisitorchannelsettypevisitor czt corejava 210 api'

distance = 307
spam score = 68
title = 'uses of interface netsourceforgecztzvisitoroptempparavisitor czt corejava 210 api'

distance = 308
spam score = 66
title = 'uses of interface netsourceforgecztzvisitoroperandvisitor czt corejava 210 api'

distance = 315
spam score = 67
title = 'uses of interface netsourceforgecztzvisitortypeannvisitor czt corejava 210 api'

distance = 349
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorprodtypevisitor czt corejava 210 api'

distance = 350
spam score = 68
title = 'uses of interface netsourceforgecztzvisitornewoldpairvisitor czt corejava 210 api'

distance = 353
spam score = 68
title = 'uses of interface netsourceforgecztzvisitorspecvisitor czt corejava 210 api'

distance = 354
spam score = 67
title = 'uses of interface netsourceforgecztzvisitornumstrokevisitor czt corejava 210 api'

distance = 355
spam score = 67
title = 'uses of interface netsourceforgecztzvisitorfalsepredvisitor czt corejava 210 api'

distance = 359
spam score = 68
title = 'uses of interface netsourceforgecztzvisitorpowertypevisitor czt corejava 210 api'

distance = 392
spam score = 62
title = 'uses of interface netsourceforgecztzpattvisitorjokernamelistvisitor czt corejava 210 api'

distance = 394
spam score = 62
title = 'uses of interface netsourceforgecztzpattvisitorsequentlistvisitor czt corejava 210 api'

distance = 398
spam score = 62
title = 'uses of interface netsourceforgecztzpattvisitorjokerpredbindingvisitor czt corejava 210 api'

distance = 398
spam score = 63
title = 'uses of interface netsourceforgecztzpattvisitorjokernamelistbindingvisitor czt corejava 210 api'

distance = 446
spam score = 62
title = 'uses of interface netsourceforgecztcircuspattvisitorcircusjokersvisitor czt corejava 210 api'

distance = 453
spam score = 59
title = 'uses of interface netsourceforgecztzpattvisitorzpattvisitor czt corejava 210 api'

distance = 456
spam score = 65
title = 'uses of interface netsourceforgecztozvisitorclassreflistvisitor czt corejava 210 api'

distance = 456
spam score = 64
title = 'uses of interface netsourceforgecztzpattvisitorsequentvisitor czt corejava 210 api'

distance = 458
spam score = 63
title = 'uses of interface netsourceforgecztzpattvisitorjokerexprvisitor czt corejava 210 api'

distance = 461
spam score = 64
title = 'uses of interface netsourceforgecztzpattvisitororaclevisitor czt corejava 210 api'

distance = 461
spam score = 64
title = 'uses of interface netsourceforgecztzpattvisitorjokerdecllistbindingvisitor czt corejava 210 api'

distance = 461
spam score = 63
title = 'uses of interface netsourceforgecztcircuspattvisitorjokerprocessvisitor czt corejava 210 api'

distance = 462
spam score = 62
title = 'uses of interface netsourceforgecztzpattvisitorjokerpredvisitor czt corejava 210 api'

distance = 462
spam score = 64
title = 'uses of interface netsourceforgecztzpattvisitorjokerexprlistbindingvisitor czt corejava 210 api'

distance = 769
spam score = 55
title = 'uses of package netsourceforgecztcircusjaxb czt corejava 210 api'

distance = 812
spam score = 80
title = 'overview czt corejava 210 api'

distance = 849
spam score = 63
title = 'netsourceforgecztcircuspattvisitor czt corejava 210 api'

distance = 861
spam score = 62
title = 'netsourceforgecztcircusjaxb czt corejava 210 api'

distance = 865
spam score = 60
title = 'netsourceforgecztzjaxb czt corejava 210 api'

distance = 866
spam score = 68
title = 'netsourceforgecztutil czt util 10 api'

distance = 882
spam score = 62
title = 'netsourceforgecztozjaxb czt corejava 210 api'

distance = 886
spam score = 62
title = 'uses of interface netsourceforgecztzastfalsepred czt corejava 210 api'

distance = 887
spam score = 62
title = 'netsourceforgecztcircuspattjaxb czt corejava 210 api'

distance = 893
spam score = 57
title = 'netsourceforgecztzpattjaxb czt corejava 210 api'

distance = 1027
spam score = 68
title = 'uses of package netsourceforgecztzutil czt corejava 210 api'

distance = 1058
spam score = 63
title = 'netsourceforgecztzpattimpl czt corejava 210 api'

distance = 1065
spam score = 69
title = 'netsourceforgecztzutil czt corejava 210 api'

distance = 1077
spam score = 62
title = 'uses of interface netsourceforgecztcircusastchanneltype czt corejava 210 api'

distance = 1083
spam score = 72
title = 'netsourceforgecztozimpl czt corejava 210 api'

distance = 1114
spam score = 67
title = 'netsourceforgecztbaseast czt util 10 api'

distance = 1128
spam score = 51
title = 'netsourceforgecztcircusimpl czt corejava 210 api'

distance = 1133
spam score = 61
title = 'uses of interface netsourceforgecztzastcompexpr czt corejava 210 api'

distance = 1137
spam score = 49
title = 'netsourceforgecztcircusast class hierarchy czt corejava 210 api'

distance = 1182
spam score = 69
title = 'netsourceforgecztbasevisitor czt util 10 api'

distance = 1394
spam score = 75
title = 'netsourceforgecztprintz czt parser 10 api'

distance = 1430
spam score = 75
title = 'uses of package netsourceforgecztparserutil czt parser 10 api'

distance = 1447
spam score = 79
title = 'overview groboutils'

distance = 1451
spam score = 81
title = 'overview groboutils'

distance = 1453
spam score = 79
title = 'overview groboutils'

distance = 1461
spam score = 63
title = 'predchecker czt typechecker 10 api'

distance = 1462
spam score = 80
title = 'overview groboutils'

distance = 1480
spam score = 51
title = 'uses of class netsourceforgeczttypecheckzutiluresult czt typechecker 10 api'

distance = 1507
spam score = 59
title = 'uses of package netsourceforgecztozast czt corejava 210 api'

distance = 184
spam score = 52
title = 'uses of class orgjquantlibmathgrid jquantlib v012snapshot api javadocs'

distance = 191
spam score = 53
title = 'orgjquantlib class hierarchy jquantlib v012snapshot api javadocs'

distance = 192
spam score = 52
title = 'uses of class orgjquantlibinstrumentsbond jquantlib v012snapshot api javadocs'

distance = 194
spam score = 54
title = 'uses of class orgjquantlibmathconstants jquantlib v012snapshot api javadocs'

distance = 194
spam score = 47
title = 'uses of package orgjquantlibexamples jquantlib v012snapshot api javadocs'

distance = 195
spam score = 50
title = 'uses of class orgjquantlibindexeseuriboreuribor365 jquantlib v012snapshot api javadocs'

distance = 202
spam score = 50
title = 'uses of package orgjquantlibpricingenginesvanilla jquantlib v012snapshot api javadocs'

distance = 204
spam score = 49
title = 'uses of package orgjquantlibmathsolvers1d jquantlib v012snapshot api javadocs'

distance = 207
spam score = 54
title = 'uses of package orgjquantlibutilreflect jquantlib v012snapshot api javadocs'

distance = 212
spam score = 52
title = 'uses of class orgjquantlibutilstopclock jquantlib v012snapshot api javadocs'

distance = 218
spam score = 47
title = 'uses of class orgjquantlibmathcloseness jquantlib v012snapshot api javadocs'

distance = 218
spam score = 51
title = 'uses of class orgjquantlibexamplesdiscretehedging jquantlib v012snapshot api javadocs'

distance = 219
spam score = 47
title = 'uses of class orgjquantlibexercisebermudanexercise jquantlib v012snapshot api javadocs'

distance = 223
spam score = 45
title = 'uses of class orgjquantlibmathregularisedincompletebeta jquantlib v012snapshot api javadocs'

distance = 226
spam score = 51
title = 'uses of class orgjquantlibinstrumentsoldinstrument jquantlib v012snapshot api javadocs'

distance = 227
spam score = 57
title = 'uses of class orgjquantlibinstrumentsgappayoff jquantlib v012snapshot api javadocs'

distance = 236
spam score = 53
title = 'uses of class orgjquantlibinstrumentscashornothingpayoff jquantlib v012snapshot api javadocs'

distance = 237
spam score = 51
title = 'uses of package orgjquantlibpricingengineshybrid jquantlib v012snapshot api javadocs'

distance = 241
spam score = 48
title = 'uses of class orgjquantlibmathbeta jquantlib v012snapshot api javadocs'

distance = 241
spam score = 47
title = 'uses of class orgjquantlibexerciseeuropeanexercise jquantlib v012snapshot api javadocs'

distance = 314
spam score = 53
title = 'uses of class orgjquantlibmethodsfinitedifferencescranknicolson jquantlib v012snapshot api javadocs'

distance = 315
spam score = 55
title = 'uses of class orgjquantlibtermstructuresyieldcurvesdepositratehelper jquantlib v012snapshot api javadocs'

distance = 315
spam score = 54
title = 'uses of class orgjquantliblangannotationcompoundfactor jquantlib v012snapshot api javadocs'

distance = 317
spam score = 50
title = 'orgjquantlibassets class hierarchy jquantlib v012snapshot api javadocs'

distance = 318
spam score = 55
title = 'uses of package orgjquantlibmathdistributionsalternativeimpls jquantlib v012snapshot api javadocs'

distance = 318
spam score = 52
title = 'uses of class orgjquantlibmodelvolatilityconstantestimator jquantlib v012snapshot api javadocs'

distance = 319
spam score = 50
title = 'uses of class orgjquantliblangannotationdrift jquantlib v012snapshot api javadocs'

distance = 319
spam score = 56
title = 'uses of class orgjquantlibtermstructuresyieldcurvesinterpolatedzerocurve jquantlib v012snapshot api javadocs'

distance = 320
spam score = 57
title = 'uses of package orgjquantlibmathoptimization jquantlib v012snapshot api javadocs'

distance = 320
spam score = 54
title = 'uses of class orgjquantlibtermstructuresyieldcurvesfixedratebondhelper jquantlib v012snapshot api javadocs'

distance = 348
spam score = 47
title = 'uses of class orgjquantlibpricingenginesvanillaintegralengineintegrand jquantlib v012snapshot api javadocs'

distance = 348
spam score = 54
title = 'uses of class orgjquantlibmathdistributionsbivariatenormaldistributioneqn6 jquantlib v012snapshot api javadocs'

distance = 348
spam score = 50
title = 'uses of class orgjquantlibtimecalendarsindonesiaindonesiabejcalendar jquantlib v012snapshot api javadocs'

distance = 348
spam score = 54
title = 'uses of package orgjquantlibexperimentalcollection jquantlib v012snapshot api javadocs'

distance = 349
spam score = 49
title = 'uses of class orgjquantlibmathdistributionsbivariatenormaldistributioneqn3 jquantlib v012snapshot api javadocs'

distance = 350
spam score = 52
title = 'uses of package orgjquantlibmathstatistics jquantlib v012snapshot api javadocs'

distance = 351
spam score = 45
title = 'uses of class orgjquantlibdaycountersactualactualisma jquantlib v012snapshot api javadocs'

distance = 351
spam score = 48
title = 'uses of class orgjquantlibmethodsfinitedifferenceszerocondition jquantlib v012snapshot api javadocs'

distance = 354
spam score = 48
title = 'uses of class orgjquantlibquoteshandlelink jquantlib v012snapshot api javadocs'

distance = 354
spam score = 44
title = 'uses of class orgjquantlibutilreflecttypereference jquantlib v012snapshot api javadocs'

distance = 396
spam score = 57
title = 'orgjquantlibpricingenginesasian class hierarchy jquantlib v012snapshot api javadocs'

distance = 397
spam score = 52
title = 'uses of class orgjquantlibmethodsfinitedifferencesdynamicpdesecondorderparabolic jquantlib v012snapshot api javadocs'

distance = 398
spam score = 51
title = 'uses of package orgjquantlibpricingenginesvanillafinitedifferences jquantlib v012snapshot api javadocs'

distance = 399
spam score = 53
title = 'uses of class orgjquantlibtimecalendarsiceland jquantlib v012snapshot api javadocs'

distance = 399
spam score = 47
title = 'uses of class orgjquantlibmathinterpolationsfactoriesbilinear jquantlib v012snapshot api javadocs'

distance = 401
spam score = 54
title = 'uses of class orgjquantlibmathintegralstrapezoidintegral jquantlib v012snapshot api javadocs'

distance = 401
spam score = 73
title = 'orgjquantlibmathfunctions jquantlib v012snapshot api javadocs'

distance = 402
spam score = 56
title = 'uses of package orgjquantlibmathinterpolationsfactories jquantlib v012snapshot api javadocs'

distance = 402
spam score = 62
title = 'orgjquantlibmathfunctions class hierarchy jquantlib v012snapshot api javadocs'

distance = 402
spam score = 54
title = 'uses of class orgjquantlibmathrandomnumbersseedgenerator jquantlib v012snapshot api javadocs'

distance = 447
spam score = 55
title = 'uses of class orgjquantlibtermstructuresyieldcurveszeroyieldstructure jquantlib v012snapshot api javadocs'

distance = 447
spam score = 80
title = 'orgjquantlibindexes jquantlib v012snapshot api javadocs'

distance = 449
spam score = 65
title = 'orgjquantlibmathmatrixutilities jquantlib v012snapshot api javadocs'

distance = 449
spam score = 52
title = 'uses of class orgjquantlibmathintegralsintegrator jquantlib v012snapshot api javadocs'

distance = 450
spam score = 58
title = 'uses of class orgjquantlibmathinterpolationslinearinterpolation jquantlib v012snapshot api javadocs'

distance = 451
spam score = 46
title = 'uses of class orgjquantlibtimecalendarsfinland jquantlib v012snapshot api javadocs'

distance = 456
spam score = 57
title = 'uses of class orgjquantlibtermstructuresvolatilitiesblackvariancecurve jquantlib v012snapshot api javadocs'

distance = 458
spam score = 44
title = 'uses of class orgjquantlibexerciseearlyexercise jquantlib v012snapshot api javadocs'

distance = 463
spam score = 60
title = 'orgjquantlibmathsolvers1d class hierarchy jquantlib v012snapshot api javadocs'

distance = 464
spam score = 55
title = 'uses of package orgjquantlibmathfunctions jquantlib v012snapshot api javadocs'

distance = 564
spam score = 52
title = 'uses of class orgjquantlibtimecalendarsgermany jquantlib v012snapshot api javadocs'

distance = 566
spam score = 54
title = 'uses of package orgjquantlibexercise jquantlib v012snapshot api javadocs'

distance = 566
spam score = 55
title = 'orgjquantlibpricingenginesvanillafinitedifferences class hierarchy jquantlib v012snapshot api javadocs'

distance = 568
spam score = 47
title = 'uses of interface orgjquantlibdaycountersthirty360thirty360abstraction jquantlib v012snapshot api javadocs'

distance = 575
spam score = 69
title = 'orgjquantlibpricingenginesasian jquantlib v012snapshot api javadocs'

distance = 576
spam score = 48
title = 'uses of interface orgjquantlibutilstdlibcmutableintreverseiterator jquantlib v012snapshot api javadocs'

distance = 578
spam score = 75
title = 'orgjquantlibpricingenginesarguments jquantlib v012snapshot api javadocs'

distance = 580
spam score = 54
title = 'packageprivate jquantlib v012snapshot api javadocs'

distance = 583
spam score = 56
title = 'orgjquantlibpricingenginesvanilla class hierarchy jquantlib v012snapshot api javadocs'

distance = 592
spam score = 46
title = 'uses of class orgjquantlibtermstructuresblackvariancetermstructure jquantlib v012snapshot api javadocs'

distance = 689
spam score = 51
title = 'uses of class orgjquantlibtimecalendarsitalymarket jquantlib v012snapshot api javadocs'

distance = 690
spam score = 56
title = 'uses of class orgjquantlibtimecalendarsukrainemarket jquantlib v012snapshot api javadocs'

distance = 692
spam score = 53
title = 'uses of class orgjquantlibtimecalendarstaiwanmarket jquantlib v012snapshot api javadocs'

distance = 694
spam score = 51
title = 'uses of class orgjquantlibtimecalendarsbrazilmarket jquantlib v012snapshot api javadocs'

distance = 694
spam score = 49
title = 'uses of class orgjquantlibtimecalendarsargentinamarket jquantlib v012snapshot api javadocs'

distance = 694
spam score = 51
title = 'uses of class orgjquantlibtimecalendarssouthkoreamarket jquantlib v012snapshot api javadocs'

distance = 694
spam score = 77
title = 'orgjquantlibtime class hierarchy jquantlib v012snapshot api javadocs'

distance = 698
spam score = 56
title = 'uses of interface orgjquantlibexperimentalmathrandomnumbersinversecdf jquantlib v012snapshot api javadocs'

distance = 701
spam score = 48
title = 'uses of interface orgjquantlibutilstdlibcreverseiterator jquantlib v012snapshot api javadocs'

distance = 701
spam score = 54
title = 'uses of class orgjquantlibtimecalendarsmexicomarket jquantlib v012snapshot api javadocs'

distance = 804
spam score = 51
title = 'orgjquantlibmethodslattices class hierarchy jquantlib v012snapshot api javadocs'

distance = 805
spam score = 53
title = 'uses of class orgjquantlibinstrumentsoneassetoption jquantlib v012snapshot api javadocs'

distance = 822
spam score = 53
title = 'uses of package orgjquantlibmethodsmontecarlo jquantlib v012snapshot api javadocs'

distance = 823
spam score = 53
title = 'real jquantlib v012snapshot api javadocs'

distance = 825
spam score = 54
title = 'uses of class orgjquantlibutilstdlibcdoublereference jquantlib v012snapshot api javadocs'

distance = 825
spam score = 52
title = 'rate jquantlib v012snapshot api javadocs'

distance = 826
spam score = 57
title = 'uses of package orgjquantlibpricingenginesresults jquantlib v012snapshot api javadocs'

distance = 833
spam score = 75
title = 'orgjquantlibtermstructuresvolatilities jquantlib v012snapshot api javadocs'

distance = 836
spam score = 53
title = 'drift jquantlib v012snapshot api javadocs'

distance = 837
spam score = 68
title = 'orgjquantlibdaycounters class hierarchy jquantlib v012snapshot api javadocs'

distance = 947
spam score = 69
title = 'orgjquantlibmathdistributions class hierarchy jquantlib v012snapshot api javadocs'

distance = 951
spam score = 58
title = 'uses of class orgjquantlibinstrumentsaveragetype jquantlib v012snapshot api javadocs'

distance = 954
spam score = 56
title = 'uses of interface orgjquantlibutilvisitor jquantlib v012snapshot api javadocs'

distance = 955
spam score = 75
title = 'orgjquantlibmethodsfinitedifferences jquantlib v012snapshot api javadocs'

distance = 957
spam score = 65
title = 'uses of package orgjquantlibmathdistributions jquantlib v012snapshot api javadocs'

distance = 960
spam score = 62
title = 'uses of class orgjquantlibtimedategenerationrule jquantlib v012snapshot api javadocs'

distance = 965
spam score = 43
title = 'uses of class orgjquantliblangannotationtypedef jquantlib v012snapshot api javadocs'

distance = 966
spam score = 86
title = 'orgjquantlibtime jquantlib v012snapshot api javadocs'

distance = 982
spam score = 70
title = 'orgjquantlibtermstructuresyieldcurves jquantlib v012snapshot api javadocs'

distance = 1005
spam score = 56
title = 'uses of class orgjquantlibtimewesterncalendar jquantlib v012snapshot api javadocs'

distance = 1410
spam score = 49
title = 'uses of class orgjquantlibinstrumentsplainvanillapayoff jquantlib v012snapshot api javadocs'

distance = 1423
spam score = 51
title = 'uses of interface orgjquantlibpricingenginespricingengine jquantlib v012snapshot api javadocs'

distance = 1436
spam score = 51
title = 'uses of class orgjquantlibtermstructurestermstructure jquantlib v012snapshot api javadocs'

distance = 1876
spam score = 15
title = 'bible thesaurus twined'

distance = 230
spam score = 45
title = 'comliferayportallanguage'

distance = 235
spam score = 42
title = 'comliferayportalconfiguration'

distance = 241
spam score = 44
title = 'comliferayportalliveusers'

distance = 251
spam score = 44
title = 'comliferayportalscheduler'

distance = 258
spam score = 43
title = 'comliferaylock'

distance = 274
spam score = 43
title = 'comliferayportalimage'

distance = 277
spam score = 43
title = 'comliferayutilportlet'

distance = 279
spam score = 41
title = 'comliferayportallog'

distance = 283
spam score = 42
title = 'comliferayportaljob'

distance = 283
spam score = 42
title = 'comliferaycountermodel'

distance = 283
spam score = 43
title = 'comliferayportalcache'

distance = 284
spam score = 42
title = 'comliferayportalfreemarker'

distance = 290
spam score = 42
title = 'comliferayportletratings'

distance = 291
spam score = 41
title = 'comliferayportaljcr'

distance = 292
spam score = 42
title = 'comliferayportalim'

distance = 300
spam score = 44
title = 'comliferayportallastmodified'

distance = 302
spam score = 40
title = 'comliferayportalutil'

distance = 303
spam score = 44
title = 'comliferayutillog4j'

distance = 323
spam score = 41
title = 'comliferayutillucene'

distance = 328
spam score = 41
title = 'comliferayportletbookmarks'

distance = 396
spam score = 46
title = 'comliferayportalkernelevents'

distance = 398
spam score = 48
title = 'comliferayportaltheme'

distance = 399
spam score = 44
title = 'comliferayportalkernelimage'

distance = 399
spam score = 44
title = 'comliferayportalservletfiltersheader'

distance = 399
spam score = 44
title = 'comliferaycounterserviceimpl'

distance = 402
spam score = 37
title = 'comliferayportalkernelconfiguration'

distance = 402
spam score = 43
title = 'comliferayportalplugin'

distance = 405
spam score = 44
title = 'comliferayutilbridgespython'

distance = 408
spam score = 46
title = 'comliferayutilbridgesgroovy'

distance = 410
spam score = 43
title = 'comliferayportalkernelpop'

distance = 443
spam score = 44
title = 'comliferayportletpolls'

distance = 446
spam score = 40
title = 'comliferayutilservletfilters'

distance = 447
spam score = 44
title = 'comliferayportletdocumentlibraryutilcomparator'

distance = 449
spam score = 43
title = 'comliferaydocumentlibraryservice'

distance = 452
spam score = 40
title = 'comliferayportalkerneldeployhot'

distance = 455
spam score = 44
title = 'comliferayportletcalendarservicepersistence'

distance = 456
spam score = 44
title = 'comliferayportletblogsaction'

distance = 457
spam score = 43
title = 'comliferayportletsoftwarecatalogaction'

distance = 459
spam score = 43
title = 'comliferayportletsoftwarecatalogutilcomparator'

distance = 461
spam score = 42
title = 'comliferayportalkernelschedulermessaging'

distance = 495
spam score = 45
title = 'comliferayclientportletblogsmodel'

distance = 495
spam score = 40
title = 'comliferayportalmiragecustom'

distance = 496
spam score = 44
title = 'comliferayportaljob'

distance = 501
spam score = 47
title = 'comliferaytaglibportlet'

distance = 503
spam score = 46
title = 'comliferayportalservicepersistence'

distance = 509
spam score = 44
title = 'comliferayclientportletratingsmodel'

distance = 513
spam score = 45
title = 'comliferayutilbridgesjsfsun'

distance = 513
spam score = 33
title = 'comliferayportalkerneldeployauto'

distance = 514
spam score = 45
title = 'comliferayportaleditorfckeditorcommandimpl'

distance = 516
spam score = 52
title = 'deprecated list'

distance = 542
spam score = 45
title = 'comliferayportalservletfiltersssoopensso'

distance = 544
spam score = 44
title = 'comliferayportalkernellog'

distance = 548
spam score = 37
title = 'comliferayportalkerneldaosearch'

distance = 553
spam score = 41
title = 'comliferayclientportletwikimodel'

distance = 555
spam score = 43
title = 'comliferayportletmessageboards'

distance = 555
spam score = 43
title = 'comliferayportaldeployauto'

distance = 556
spam score = 43
title = 'comliferayportletwiki'

distance = 556
spam score = 40
title = 'comliferayportalsecuritypermissioncomparator'

distance = 556
spam score = 42
title = 'comliferayportalkernelbean'

distance = 557
spam score = 43
title = 'comliferayutilant'

distance = 584
spam score = 42
title = 'comliferaycounterserviceimpl'

distance = 584
spam score = 46
title = 'comliferayutilxmldescriptor'

distance = 586
spam score = 38
title = 'comliferayutilbridgesjsficefaces'

distance = 588
spam score = 43
title = 'comliferayportletalfrescocontentaction'

distance = 594
spam score = 45
title = 'comliferayfiltersstrip'

distance = 595
spam score = 44
title = 'comliferayportletratingsservice'

distance = 596
spam score = 43
title = 'comliferayfiltersstrip'

distance = 598
spam score = 37
title = 'comliferayportalkerneldaojdbc'

distance = 600
spam score = 36
title = 'comliferayclientportlettagsmodel'

distance = 604
spam score = 43
title = 'comliferayfilterscompression'

distance = 631
spam score = 48
title = 'overview'

distance = 634
spam score = 37
title = 'comliferayclientportletworkflowmodel'

distance = 636
spam score = 50
title = 'overview'

distance = 643
spam score = 44
title = 'comliferayportletimagegalleryservice'

distance = 645
spam score = 47
title = 'comliferayportletannouncementsmodel'

distance = 650
spam score = 44
title = 'comliferayportletpollsmodel'

distance = 659
spam score = 42
title = 'comliferayportalsecurityauth'

distance = 661
spam score = 46
title = 'comliferayportalservicepermission'

distance = 665
spam score = 47
title = 'comliferayportletmessageboards'

distance = 669
spam score = 39
title = 'comliferayportalkernelportlet'

distance = 729
spam score = 43
title = 'comliferayportletmessageboardsservicepersistence'

distance = 735
spam score = 48
title = 'overview'

distance = 739
spam score = 45
title = 'comliferayutilservlet'

distance = 742
spam score = 32
title = 'comliferayportalkernelsearch'

distance = 747
spam score = 44
title = 'comliferayportletratingsservice'

distance = 748
spam score = 51
title = 'comliferayappletseditor'

distance = 756
spam score = 48
title = 'comliferayportletsocialmodel'

distance = 761
spam score = 52
title = 'comliferayappletseditor'

distance = 777
spam score = 45
title = 'comliferayportletimagegalleryservice'

distance = 789
spam score = 53
title = 'comliferayclientportalmodel'

distance = 852
spam score = 39
title = 'comliferayportletshoppingservice'

distance = 862
spam score = 48
title = 'index'

distance = 879
spam score = 64
title = 'comliferayportalservicebase'

distance = 884
spam score = 40
title = 'comliferayclientportletdocumentlibraryservicehttp'

distance = 886
spam score = 46
title = 'overview'

distance = 891
spam score = 45
title = 'index'

distance = 892
spam score = 48
title = 'overview'

distance = 895
spam score = 43
title = 'index'

distance = 907
spam score = 53
title = 'overview'

distance = 912
spam score = 46
title = 'comliferayclientportlettagsservicehttp'

distance = 1228
spam score = 47
title = 'ecbreed origin 102'

distance = 1405
spam score = 65
title = 'eduberkeleyguirpapiermachevision'

distance = 1437
spam score = 43
title = 'comzentensestep2view 2step documentation'

distance = 1740
spam score = 29
title = 'rr b class'

distance = 1897
spam score = 86
title = 'the neeg online'

distance = 61
spam score = 67
title = ''

distance = 69
spam score = 73
title = ''

distance = 78
spam score = 63
title = ''

distance = 80
spam score = 56
title = ''

distance = 81
spam score = 66
title = ''

distance = 84
spam score = 61
title = ''

distance = 84
spam score = 59
title = ''

distance = 85
spam score = 63
title = ''

distance = 85
spam score = 60
title = ''

distance = 89
spam score = 66
title = ''

distance = 91
spam score = 56
title = ''

distance = 96
spam score = 77
title = ''

distance = 96
spam score = 75
title = ''

distance = 98
spam score = 72
title = ''

distance = 100
spam score = 77
title = ''

distance = 102
spam score = 60
title = ''

distance = 103
spam score = 73
title = ''

distance = 109
spam score = 60
title = ''

distance = 119
spam score = 59
title = ''

distance = 127
spam score = 74
title = ''

distance = 131
spam score = 58
title = ''

distance = 133
spam score = 73
title = ''

distance = 135
spam score = 71
title = ''

distance = 136
spam score = 50
title = ''

distance = 137
spam score = 52
title = ''

distance = 158
spam score = 52
title = ''

distance = 166
spam score = 54
title = ''

distance = 173
spam score = 59
title = ''

distance = 176
spam score = 63
title = ''

distance = 178
spam score = 62
title = ''

distance = 199
spam score = 57
title = ''

distance = 233
spam score = 17
title = ''

distance = 243
spam score = 16
title = ''

distance = 246
spam score = 17
title = ''

distance = 283
spam score = 19
title = ''

distance = 355
spam score = 52
title = ''

distance = 358
spam score = 13
title = ''

distance = 384
spam score = 65
title = ''

distance = 397
spam score = 66
title = ''

distance = 415
spam score = 61
title = ''

distance = 437
spam score = 61
title = ''

distance = 444
spam score = 66
title = ''

distance = 455
spam score = 64
title = ''

distance = 456
spam score = 59
title = ''

distance = 461
spam score = 62
title = ''

distance = 490
spam score = 65
title = ''

distance = 528
spam score = 56
title = ''

distance = 781
spam score = 53
title = ''

distance = 781
spam score = 52
title = ''

distance = 856
spam score = 60
title = ''

distance = 883
spam score = 28
title = ''

distance = 1040
spam score = 65
title = ''

distance = 1044
spam score = 70
title = ''

distance = 1047
spam score = 63
title = ''

distance = 1127
spam score = 29
title = ''

distance = 1544
spam score = 22
title = ''

distance = 1714
spam score = 6
title = ''

distance = 1744
spam score = 64
title = ''

distance = 1767
spam score = 43
title = ''

distance = 1835
spam score = 50
title = ''

distance = 620
spam score = 60
title = ''

distance = 674
spam score = 55
title = ''

distance = 113
spam score = 63
title = 'uses of package orgapachebatik apache batik javadoc'

distance = 195
spam score = 62
title = 'uses of class orgapachebatikutilclassfileutilities apache batik javadoc'

distance = 196
spam score = 61
title = 'orgapachebatik apache batik javadoc'

distance = 196
spam score = 62
title = 'uses of package orgapachebatikappsslideshow apache batik javadoc'

distance = 200
spam score = 60
title = 'uses of class orgapachebatikutilcleanerthread apache batik javadoc'

distance = 201
spam score = 60
title = 'uses of class orgapachebatikbridgeuseragentviewport apache batik javadoc'

distance = 203
spam score = 61
title = 'uses of class orgapachebatikutilxmlresourcedescriptor apache batik javadoc'

distance = 208
spam score = 61
title = 'uses of class orgapachebatikutilparsedurljarprotocolhandler apache batik javadoc'

distance = 208
spam score = 60
title = 'uses of class orgapachebatikutilplatform apache batik javadoc'

distance = 213
spam score = 60
title = 'uses of class orgapachebatikutilsoftdoublyindexedtable apache batik javadoc'

distance = 216
spam score = 60
title = 'uses of class orgapachebatikbridgenoloadexternalresourcesecurity apache batik javadoc'

distance = 217
spam score = 62
title = 'uses of class orgapachebatikbridgeembededexternalresourcesecurity apache batik javadoc'

distance = 218
spam score = 61
title = 'uses of package orgapachebatiktranscoderprint apache batik javadoc'

distance = 218
spam score = 61
title = 'uses of package orgapachebatikgvtsvg12 apache batik javadoc'

distance = 220
spam score = 60
title = 'uses of class orgapachebatikutileventdispatcher apache batik javadoc'

distance = 220
spam score = 62
title = 'uses of package orgapachebatiktranscoderkeys apache batik javadoc'

distance = 220
spam score = 63
title = 'uses of class orgapachebatikappsslideshowmain apache batik javadoc'

distance = 221
spam score = 60
title = 'uses of class orgapachebatikbridgerelaxedexternalresourcesecurity apache batik javadoc'

distance = 222
spam score = 61
title = 'uses of interface orgapachebatiki18nextendedlocalizable apache batik javadoc'

distance = 223
spam score = 59
title = 'uses of class orgapachebatikgvtfillshapepainter apache batik javadoc'

distance = 315
spam score = 58
title = 'uses of class orgapachebatikextawtavoidtilinghintkey apache batik javadoc'

distance = 316
spam score = 59
title = 'uses of class orgapachebatikextawtrenderinghintskeyext apache batik javadoc'

distance = 316
spam score = 66
title = 'uses of class orgapachebatikbridgebridgecontextsoftreferencemememto apache batik javadoc'

distance = 318
spam score = 61
title = 'uses of class orgapachebatikswinggvtabstractresettransforminteractor apache batik javadoc'

distance = 323
spam score = 58
title = 'uses of class orgapachebatikscriptrhinorhinointerpreterfactory apache batik javadoc'

distance = 323
spam score = 62
title = 'uses of interface orgapachebatikutilsvg12constants apache batik javadoc'

distance = 326
spam score = 58
title = 'uses of class orgapachebatikappsrasterizersvgconverterurlsource apache batik javadoc'

distance = 326
spam score = 61
title = 'uses of package orgapachebatikscriptrhinosvg12 apache batik javadoc'

distance = 327
spam score = 61
title = 'uses of class orgapachebatiksvggenfontmessages apache batik javadoc'

distance = 328
spam score = 63
title = 'uses of class orgapachebatikutilguixmleditorxmleditorkit apache batik javadoc'

distance = 363
spam score = 59
title = 'uses of class orgapachebatikappssvgbrowserfinddialogclearbuttonaction apache batik javadoc'

distance = 363
spam score = 58
title = 'uses of class orgapachebatiktranscodersvg2svgsvgtranscodernewlinekey apache batik javadoc'

distance = 363
spam score = 62
title = 'uses of class orgapachebatikcssparserdefaultpseudoclasscondition apache batik javadoc'

distance = 364
spam score = 65
title = 'uses of class orgapachebatikcssparserdefaultclasscondition apache batik javadoc'

distance = 365
spam score = 63
title = 'uses of class orgapachebatikcssparserdefaultbeginhyphenattributecondition apache batik javadoc'

distance = 365
spam score = 67
title = 'uses of class orgapachebatikdomabstractattrattrtypeinfo apache batik javadoc'

distance = 366
spam score = 63
title = 'uses of class orgapachebatikcssparserdefaultconditionfactory apache batik javadoc'

distance = 367
spam score = 65
title = 'uses of class orgapachebatikcssparserdefaultpseudoelementselector apache batik javadoc'

distance = 368
spam score = 66
title = 'uses of class orgapachebatikcssparserdefaultandcondition apache batik javadoc'

distance = 368
spam score = 76
title = 'uses of class orgapachebatikdomabstractelementelementtypeinfo apache batik javadoc'

distance = 400
spam score = 59
title = 'uses of class orgapachebatikcssenginesaccsselementselector apache batik javadoc'

distance = 400
spam score = 61
title = 'uses of class orgapachebatiksvggenfonttablenamerecord apache batik javadoc'

distance = 401
spam score = 73
title = 'orgapachebatiki18n class hierarchy apache batik javadoc'

distance = 402
spam score = 60
title = 'uses of class orgapachebatikappssvgbrowserdomviewerpanel apache batik javadoc'

distance = 404
spam score = 58
title = 'uses of class orgapachebatikappssvgbrowserjsvgviewerframefullscreenaction apache batik javadoc'

distance = 404
spam score = 59
title = 'uses of class orgapachebatikcssenginesaccsslangcondition apache batik javadoc'

distance = 407
spam score = 61
title = 'uses of class orgapachebatikcssparsercsslexicalunitpredefinedfunctionlexicalunit apache batik javadoc'

distance = 413
spam score = 63
title = 'uses of package orgapachebatikcssenginevaluesvg12 apache batik javadoc'

distance = 415
spam score = 62
title = 'uses of class orgapachebatikextawtimagerenderableredrable apache batik javadoc'

distance = 416
spam score = 59
title = 'uses of class orgapachebatikcssparsercsslexicalunitfloatlexicalunit apache batik javadoc'

distance = 468
spam score = 63
title = 'uses of class orgapachebatikparserdefaulttimingspecifierlisthandler apache batik javadoc'

distance = 472
spam score = 69
title = 'uses of class orgapachebatikutilapplicationsecurityenforcer apache batik javadoc'

distance = 473
spam score = 65
title = 'uses of class orgapachebatikgvtrendererstaticrenderer apache batik javadoc'

distance = 473
spam score = 65
title = 'uses of package orgapachebatikextawtimagecodecjpeg apache batik javadoc'

distance = 476
spam score = 55
title = 'uses of class orgapachebatikutiliostreamnormalizingreaderiso88591decoderfactory apache batik javadoc'

distance = 477
spam score = 56
title = 'uses of class orgapachebatikappssvgbrowserdomviewerpanelnoderenderer apache batik javadoc'

distance = 482
spam score = 64
title = 'uses of class orgapachebatikextawtimagecodecpngpngregistryentry apache batik javadoc'

distance = 484
spam score = 65
title = 'uses of class orgapachebatikswingjsvgcanvaslocationlistener apache batik javadoc'

distance = 486
spam score = 57
title = 'uses of class orgapachebatikcssparsercsslexicalunitintegerlexicalunit apache batik javadoc'

distance = 486
spam score = 68
title = 'uses of class orgapachebatikutilcleanerthreadweakreferencecleared apache batik javadoc'

distance = 582
spam score = 68
title = 'uses of class orgapachebatikbridgeabstractsvggradientelementbridgestop apache batik javadoc'

distance = 583
spam score = 64
title = 'uses of class orgapachebatikcssparserabstractsiblingselector apache batik javadoc'

distance = 584
spam score = 65
title = 'orgapachebatikappsttf2svg apache batik javadoc'

distance = 586
spam score = 58
title = 'uses of class orgapachebatikappssvgbrowserdomviewerpanelcharacterpanel apache batik javadoc'

distance = 587
spam score = 67
title = 'orgapachebatiktranscoderprint class hierarchy apache batik javadoc'

distance = 590
spam score = 71
title = 'orgapachebatiksvggenfont apache batik javadoc'

distance = 592
spam score = 62
title = 'uses of interface orgapachebatikextawtimagerenderablefilterchainrable apache batik javadoc'

distance = 598
spam score = 61
title = 'uses of interface orgapachebatikextawtimagerenderabletilerable apache batik javadoc'

distance = 601
spam score = 64
title = 'uses of class orgapachebatikcssenginesacabstractelementselector apache batik javadoc'

distance = 603
spam score = 59
title = 'uses of class orgapachebatikextawtimagerenderedpadredzerorecterintpack apache batik javadoc'

distance = 684
spam score = 62
title = 'uses of class orgapachebatikcssenginesaccssattributecondition apache batik javadoc'

distance = 684
spam score = 61
title = 'uses of interface orgapachebatikextawtimagespiurlregistryentry apache batik javadoc'

distance = 686
spam score = 56
title = 'uses of class orgapachebatikextawtimagerenderedpadredzerorecter apache batik javadoc'

distance = 687
spam score = 57
title = 'uses of interface orgapachebatikappssvgbrowserdomdocumenttreecontroller apache batik javadoc'

distance = 690
spam score = 65
title = 'orgapachebatikappssvgpp class hierarchy apache batik javadoc'

distance = 696
spam score = 70
title = 'orgapachebatikappsslideshow class hierarchy apache batik javadoc'

distance = 703
spam score = 66
title = 'orgapachebatiktranscoderkeys apache batik javadoc'

distance = 704
spam score = 66
title = 'uses of class orgapachebatikcssparserdefaultattributecondition apache batik javadoc'

distance = 707
spam score = 76
title = 'orgapachebatikextawtfont apache batik javadoc'

distance = 715
spam score = 63
title = 'uses of class orgapachebatikswingjsvgcanvasscrollaction apache batik javadoc'

distance = 823
spam score = 64
title = 'uses of interface orgapachebatikparsererrorhandler apache batik javadoc'

distance = 825
spam score = 60
title = 'uses of interface orgapachebatikutiliostreamnormalizingreaderchardecoderfactory apache batik javadoc'

distance = 826
spam score = 74
title = 'orgapachebatiki18n apache batik javadoc'

distance = 827
spam score = 62
title = 'uses of interface orgapachebatikappssvgbrowserdomviewercontroller apache batik javadoc'

distance = 828
spam score = 63
title = 'uses of class orgapachebatikappsrasterizerdestinationtype apache batik javadoc'

distance = 834
spam score = 68
title = 'uses of package orgapachebatiktranscoderwmftosvg apache batik javadoc'

distance = 835
spam score = 63
title = 'uses of class orgapachebatikappssvgbrowserhistorybrowserinterfacecompoundupdatecommand apache batik javadoc'

distance = 836
spam score = 64
title = 'uses of class orgapachebatikextawtgeomcubic apache batik javadoc'

distance = 838
spam score = 63
title = 'uses of interface orgapachebatikparseranglehandler apache batik javadoc'

distance = 844
spam score = 65
title = 'uses of interface orgapachebatikextawtimagecodecutilimagedecoder apache batik javadoc'

distance = 981
spam score = 62
title = 'orgapachebatikscriptrhino apache batik javadoc'

distance = 995
spam score = 69
title = 'uses of interface orgapachebatikswinggvtinteractor apache batik javadoc'

distance = 996
spam score = 70
title = 'uses of class orgapachebatiksvggensvggraphics2d apache batik javadoc'

distance = 1010
spam score = 58
title = 'orgapachebatikcssenginevaluecss2 apache batik javadoc'

distance = 1011
spam score = 60
title = 'uses of interface orgapachebatikextawtimagerenderablecolormatrixrable apache batik javadoc'

distance = 1024
spam score = 59
title = 'uses of package orgapachebatikutilio apache batik javadoc'

distance = 1036
spam score = 68
title = 'uses of package orgapachebatikutilguiresource apache batik javadoc'

distance = 1038
spam score = 58
title = 'uses of package orgapachebatiksvggenfonttable apache batik javadoc'

distance = 1065
spam score = 73
title = 'uses of package orgapachebatiktranscoderimage apache batik javadoc'

distance = 1085
spam score = 65
title = 'uses of class orgapachebatikgvtfontgvtglyphmetrics apache batik javadoc'

distance = 1400
spam score = 76
title = 'orgapachebatikutilgui apache batik javadoc'

distance = 1418
spam score = 68
title = 'uses of interface orgapachebatikgvtshapepainter apache batik javadoc'

distance = 1425
spam score = 62
title = 'uses of class orgapachebatikswinggvtgvttreerendererevent apache batik javadoc'

distance = 1450
spam score = 69
title = 'uses of class orgapachebatikgvtfontgvtfontface apache batik javadoc'

distance = 1476
spam score = 68
title = 'uses of interface orgapachebatikappssvgbrowserundoablecommand apache batik javadoc'

distance = 1921
spam score = 10
title = 'idempotent slash'

distance = 186
spam score = 49
title = 'uses of package orgapacheshaletaglib shale core 110snapshot api'

distance = 190
spam score = 70
title = 'uses of package orgapacheshaleutil shale core 110snapshot api'

distance = 197
spam score = 53
title = 'uses of package orgapacheshalerenderer shale core 110snapshot api'

distance = 209
spam score = 49
title = 'uses of package orgapacheshalefaces shale core 110snapshot api'

distance = 224
spam score = 61
title = 'uses of package orgapacheshaleclayconvert shale clay 110snapshot api'

distance = 230
spam score = 53
title = 'uses of package orgapacheshalespring shale spring integration 110snapshot api'

distance = 231
spam score = 61
title = 'uses of package orgapacheshaleclayfaces shale clay 110snapshot api'

distance = 234
spam score = 52
title = 'uses of class orgapacheshaleclaycomponentclay shale clay 110snapshot api'

distance = 242
spam score = 66
title = 'uses of package orgapacheshalecomponent shale core 110snapshot api'

distance = 248
spam score = 51
title = 'uses of class orgapacheshaleclayparserparser shale clay 110snapshot api'

distance = 250
spam score = 53
title = 'uses of package orgapacheshalevalidatortag shale validator integration 110snapshot api'

distance = 250
spam score = 52
title = 'uses of package orgapacheshaleviewfaces shale view controller 110snapshot api'

distance = 251
spam score = 67
title = 'uses of package orgapacheshaleclayutils shale clay 110snapshot api'

distance = 253
spam score = 50
title = 'uses of class orgapacheshaleremotingxhtmlhelper shale remoting 110snapshot api'

distance = 256
spam score = 53
title = 'uses of package orgapacheshaletestcargo shale test framework 110snapshot api'

distance = 258
spam score = 51
title = 'uses of class orgapacheshaleutilloadbundle shale core 110snapshot api'

distance = 260
spam score = 49
title = 'uses of package orgapacheshaleusecasesexception shale use cases sample app 110snapshot api'

distance = 262
spam score = 61
title = 'uses of package orgapacheshaleclaytaglib shale clay 110snapshot api'

distance = 262
spam score = 65
title = 'uses of package orgapacheshaleremotingfaces shale remoting 110snapshot api'

distance = 262
spam score = 49
title = 'uses of package orgapacheshalevalidatorfaces shale validator integration 110snapshot api'

distance = 352
spam score = 46
title = 'uses of class orgapacheshaleremotingloggerdefaultlogger shale remoting 110snapshot api'

distance = 353
spam score = 48
title = 'uses of class orgapacheshaleviewfacessubviewcomponent shale view controller 110snapshot api'

distance = 353
spam score = 48
title = 'uses of class orgapacheshaledialogbasestatesavinglistener shale dialog manager 110snapshot api'

distance = 353
spam score = 52
title = 'uses of class orgapacheshaleremotingimplchaincontext shale remoting 110snapshot api'

distance = 354
spam score = 50
title = 'uses of class orgapacheshaletigerviewactivate shale tiger extensions 110snapshot api'

distance = 354
spam score = 50
title = 'uses of class orgapacheshaledialogbaseabstractdialogcontextmanager shale dialog manager 110snapshot api'

distance = 354
spam score = 50
title = 'uses of class orgapacheshaledialogfacesdialogphaselistener shale dialog manager 110snapshot api'

distance = 354
spam score = 46
title = 'uses of class orgapacheshaleclaycomponentchainassignpropertiescommand shale clay 110snapshot api'

distance = 354
spam score = 50
title = 'uses of class orgapacheshaleclaycomponentchainpropertyactioncommand shale clay 110snapshot api'

distance = 355
spam score = 52
title = 'uses of class orgapacheshaletigerviewsession shale tiger extensions 110snapshot api'

distance = 379
spam score = 50
title = 'uses of class orgapacheshaletestbaseabstractviewcontrollertestcase shale test framework 110snapshot api'

distance = 380
spam score = 53
title = 'uses of class orgapacheshaletestmockmockviewhandler shale test framework 110snapshot api'

distance = 380
spam score = 46
title = 'uses of class orgapacheshaletestmockmockportletresponse shale test framework 110snapshot api'

distance = 380
spam score = 45
title = 'uses of class orgapacheshaleremotingimplclassresourceprocessor shale remoting 110snapshot api'

distance = 382
spam score = 47
title = 'uses of class orgapacheshaletestmockmockpropertyresolver shale test framework 110snapshot api'

distance = 383
spam score = 52
title = 'uses of class orgapacheshaletestelmockelcontext shale test framework 110snapshot api'

distance = 383
spam score = 45
title = 'uses of class orgapacheshaleremotingimplchainprocessor shale remoting 110snapshot api'

distance = 383
spam score = 48
title = 'uses of class orgapacheshaletestmockmockexternalcontext12 shale test framework 110snapshot api'

distance = 384
spam score = 54
title = 'uses of class orgapacheshaletigerregisterfacesphaselisteneradapter shale tiger extensions 110snapshot api'

distance = 384
spam score = 53
title = 'uses of class orgapacheshaleviewfacesviewviewhandler shale view controller 110snapshot api'

distance = 426
spam score = 61
title = 'orgapacheshaletestcargo shale test framework 110snapshot api'

distance = 427
spam score = 48
title = 'uses of class orgapacheshaleusecasesprofileeditprofilestate shale use cases sample app 110snapshot api'

distance = 431
spam score = 47
title = 'uses of class orgapacheshaleclayparserbuilderchainspanbuilderrule shale clay 110snapshot api'

distance = 432
spam score = 48
title = 'uses of class orgapacheshaleusecasesjnditest shale use cases sample app 110snapshot api'

distance = 432
spam score = 52
title = 'uses of package orgapacheshaledialogscxmlimpl shale dialog manager scxml implementation 110snapshot api'

distance = 432
spam score = 50
title = 'uses of class orgapacheshaleexamplesmailreaderindex shale mailreader sample app 110snapshot api'

distance = 434
spam score = 46
title = 'uses of class orgapacheshaleclayparserbuilderchaininputbuilderrule shale clay 110snapshot api'

distance = 434
spam score = 49
title = 'uses of class orgapacheshaleusecasessubviewdelta shale use cases sample app 110snapshot api'

distance = 434
spam score = 47
title = 'uses of class orgapacheshaleclayparserbuilderchaindirectivebuilderrule shale clay 110snapshot api'

distance = 434
spam score = 48
title = 'uses of class orgapacheshaleusecasesrolodexrolodexdao shale clay usecases app 110snapshot api'

distance = 495
spam score = 64
title = 'deprecated list shale tiger extensions 110snapshot api'

distance = 496
spam score = 54
title = 'uses of class orgapacheshaletestbaseabstractjsftestcase shale test framework 110snapshot api'

distance = 500
spam score = 49
title = 'orgapacheshaleusecaseslogic class hierarchy shale use cases sample app 110snapshot api'

distance = 502
spam score = 56
title = 'uses of class orgapacheshaleexamplesmailreaderapplicationlistener shale mailreader sample app 110snapshot api'

distance = 502
spam score = 62
title = 'uses of class orgapacheshaledialogbaseabstractdialoglistener shale dialog manager 104snapshot api'

distance = 502
spam score = 72
title = 'orgapacheshaleclayconvert shale clay 110snapshot api'

distance = 502
spam score = 60
title = 'orgapacheshaletiles class hierarchy shale tiles integration 110snapshot api'

distance = 503
spam score = 50
title = 'orgapacheshalevalidatorutil class hierarchy shale validator integration 110snapshot api'

distance = 507
spam score = 67
title = 'deprecated list shale mailreader sample app 110snapshot api'

distance = 510
spam score = 57
title = 'uses of package orgapacheshaleclayparserbuilderchain shale clay 104 api'

distance = 580
spam score = 46
title = 'orgapacheshaleusecasesview class hierarchy shale use cases sample app 110snapshot api'

distance = 582
spam score = 51
title = 'orgapacheshaleusecaseslocale class hierarchy shale use cases sample app 110snapshot api'

distance = 583
spam score = 59
title = 'orgapacheshaleviewimpl class hierarchy shale view controller 110snapshot api'

distance = 583
spam score = 57
title = 'orgapacheshaleblank class hierarchy shale blank sample app 110snapshot api'

distance = 585
spam score = 78
title = 'orgapacheshaletestbase shale test framework 110snapshot api'

distance = 588
spam score = 48
title = 'constant field values shale use cases sample app 110snapshot api'

distance = 590
spam score = 53
title = 'uses of class orgapacheshaledialogbaseabstractdialogcontextlistener shale dialog manager 110snapshot api'

distance = 591
spam score = 50
title = 'uses of class orgapacheshaledialogbasicconfigviewstateimpl shale dialog manager basic implementation 110snapshot api'

distance = 591
spam score = 53
title = 'uses of class orgapacheshaleclayparserbuilderverbatimbuilder shale clay 110snapshot api'

distance = 593
spam score = 59
title = 'orgapacheshaleclaycomponent class hierarchy shale clay 110snapshot api'

distance = 670
spam score = 59
title = 'orgapacheshaledialogbasic shale dialog manager basic implementation 110snapshot api'

distance = 672
spam score = 66
title = 'orgapacheshaleclayutils shale clay 110snapshot api'

distance = 672
spam score = 70
title = 'orgapacheshaledialogfaces shale dialog manager 110snapshot api'

distance = 674
spam score = 61
title = 'orgapacheshaletigerfaces shale tiger extensions 110snapshot api'

distance = 675
spam score = 52
title = 'uses of class orgapacheshaletestmockmockhttpservletrequest shale test framework 110snapshot api'

distance = 677
spam score = 62
title = 'overview shale core 110snapshot api'

distance = 679
spam score = 55
title = 'uses of package orgapacheshaledialogscxml shale dialog manager scxml implementation 110snapshot api'

distance = 680
spam score = 49
title = 'uses of class orgapacheshaletestmockmockfacescontextfactory shale test framework 110snapshot api'

distance = 681
spam score = 56
title = 'uses of package orgapacheshaleclayconfig shale clay 104 api'

distance = 681
spam score = 66
title = 'uses of package orgapacheshaletigermanaged shale tiger extensions 110snapshot api'

distance = 834
spam score = 53
title = 'orgapacheshaletestel class hierarchy shale test framework 110snapshot api'

distance = 839
spam score = 73
title = 'orgapacheshaleusecasesrolodex shale clay usecases app 110snapshot api'

distance = 841
spam score = 51
title = 'view shale tiger extensions 110snapshot api'

distance = 841
spam score = 49
title = 'request shale tiger extensions 110snapshot api'

distance = 841
spam score = 49
title = 'application shale tiger extensions 110snapshot api'

distance = 841
spam score = 77
title = 'orgapacheshaledialogbase shale dialog manager 110snapshot api'

distance = 843
spam score = 47
title = 'overview maven model 302snapshot api'

distance = 845
spam score = 49
title = 'uses of interface orgapacheshaledialogbasicmodelviewstate shale dialog manager basic implementation 110snapshot api'

distance = 846
spam score = 65
title = 'orgapacheshaleclayconfig shale clay 110snapshot api'

distance = 848
spam score = 54
title = 'uses of class orgapacheshaledialogbasicconfigabstractstate shale dialog manager basic implementation 110snapshot api'

distance = 1025
spam score = 79
title = 'orgapacheshalevalidatorconverter shale validator integration 110snapshot api'

distance = 1027
spam score = 70
title = 'orgapacheshalevalidatorvalidator shale validator integration 110snapshot api'

distance = 1027
spam score = 75
title = 'uses of interface orgapacheshaledialogdialoglistener shale dialog manager 104snapshot api'

distance = 1031
spam score = 65
title = 'uses of package orgapacheshaleview shale view controller 104 api'

distance = 1035
spam score = 74
title = 'orgapacheshaleexamplessqlbrowser shale sql browser sample app 110snapshot api'

distance = 1042
spam score = 69
title = 'orgapacheshaleusecasesview shale use cases sample app 104 api'

distance = 1045
spam score = 67
title = 'orgapacheshaleusecaseslookup shale use cases sample app 104 api'

distance = 1060
spam score = 77
title = 'uses of interface orgapacheshaledialogdialogcontextmanagerlistener shale dialog manager 110snapshot api'

distance = 1064
spam score = 63
title = 'orgapacheshaletigermanagedrules shale tiger extensions 110snapshot api'

distance = 1073
spam score = 75
title = 'orgapacheshaleremotingfaces shale remoting 104 api'

distance = 1369
spam score = 73
title = 'uses of package orgapacheshaleclayconfigbeans shale clay 110snapshot api'

distance = 1370
spam score = 64
title = 'index shale sql browser sample app 110snapshot api'

distance = 1372
spam score = 65
title = 'orgapacheshaleclayparserbuilder shale clay 110snapshot api'

distance = 1484
spam score = 69
title = 'orgapacheshaletigerregister shale tiger extensions 110snapshot api'

distance = 286
spam score = 58
title = 's3exception hadoop 0172 api'

distance = 297
spam score = 57
title = 's3exception hadoop 0190 api'

distance = 300
spam score = 54
title = 'validationexception tapestry 5 project 5018 api'

distance = 316
spam score = 60
title = 's3exception hadoop 0182 api'

distance = 317
spam score = 53
title = 's3filesystemexception hadoop 0172 api'

distance = 319
spam score = 59
title = 's3filesystemexception hadoop 0153 api'

distance = 335
spam score = 56
title = 's3filesystemexception hadoop 0190 api'

distance = 340
spam score = 56
title = 's3filesystemexception hadoop 0190 api'

distance = 341
spam score = 58
title = 'queryexception nutch 09 api'

distance = 344
spam score = 54
title = 'queryexception nutch 081 api'

distance = 346
spam score = 62
title = 'corruptindexexception lucene 230 api'

distance = 348
spam score = 55
title = 'queryexception nutch 09 api'

distance = 354
spam score = 66
title = 'protocolexception apache synapse 12 api'

distance = 357
spam score = 61
title = 'corruptindexexception lucene 230 api'

distance = 366
spam score = 74
title = 'corruptindexexception lucene 220 api'

distance = 368
spam score = 71
title = 'corruptindexexception lucene 232 api'

distance = 372
spam score = 59
title = 'corruptindexexception lucene 240 api'

distance = 373
spam score = 59
title = 'timeoutexception apache james jspf 096snapshot api'

distance = 375
spam score = 55
title = 'notreplicatedyetexception hadoop 0182 api'

distance = 377
spam score = 60
title = 'corruptindexexception lucene 231 api'

distance = 486
spam score = 66
title = 'portletexception jetspeed 1 enterprise portal 16 api'

distance = 486
spam score = 68
title = 'extractorexception slide api documentation'

distance = 487
spam score = 71
title = 'webapplicationfactorycreationexception wicket 132 api'

distance = 488
spam score = 71
title = 'notallmetaregionsonlineexception hbase 0190 api'

distance = 489
spam score = 83
title = 'corruptpowerpointfileexception poi api documentation'

distance = 490
spam score = 53
title = 'invalidfiletypeexception hadoop 0172 api'

distance = 490
spam score = 57
title = 'pagenotfoundexception core library 411snapshot api'

distance = 491
spam score = 61
title = 'blockedexception nutch 09 api'

distance = 493
spam score = 60
title = 'checksumexception hadoop 0182 api'

distance = 493
spam score = 56
title = 'nosuchdefinitionexception tiles 2 207 api'

distance = 532
spam score = 57
title = 'expiredpasswordexception struts 1310 api'

distance = 532
spam score = 68
title = 'serviceparametermissingexception slide api documentation'

distance = 532
spam score = 70
title = 'objectnotfoundexception jcs 1325rc api'

distance = 532
spam score = 67
title = 'unabletolocateserviceexception slide api documentation'

distance = 533
spam score = 64
title = 'jspelexception tomcat api documentation'

distance = 533
spam score = 60
title = 'datamanagementexception continuum project 131snapshot api'

distance = 534
spam score = 67
title = 'factorynotfoundexception tiles 2 212snapshot api'

distance = 534
spam score = 64
title = 'macroexception slide api documentation'

distance = 534
spam score = 57
title = 'breakbreakexception apache velocity 161 api'

distance = 534
spam score = 71
title = 'assertionfailederror junit api'

distance = 566
spam score = 66
title = 'donotretryioexception hbase 0190 api'

distance = 566
spam score = 71
title = 'servicedisconnectionfailedexception slide api documentation'

distance = 567
spam score = 48
title = 'irisyntaxexception abdera bundle jar 040incubating api'

distance = 567
spam score = 68
title = 'resultsettoolargeexception juddiparent 20rc5 api'

distance = 567
spam score = 64
title = 'invalidmatrixexception commons math 12 api'

distance = 568
spam score = 68
title = 'littleendianbufferunderrunexception poi api documentation'

distance = 568
spam score = 62
title = 'usermismatchexception juddiparent 20rc5 api'

distance = 568
spam score = 68
title = 'requesttimeoutexception juddiparent 20rc5 api'

distance = 569
spam score = 66
title = 'requestdeniedexception juddiparent 20rc5 api'

distance = 569
spam score = 53
title = 'ftpexceptionbadsystresponse nutch 081 api'

distance = 601
spam score = 63
title = 'invalidcategoryexception juddiparent 20rc5 api'

distance = 601
spam score = 57
title = 'keeperexceptioninvalidaclexception zookeeper 301 api'

distance = 601
spam score = 64
title = 'keeperexceptionunimplementedexception zookeeper 301 api'

distance = 602
spam score = 59
title = 'probablynotpkcs8exception'

distance = 603
spam score = 58
title = 'keeperexceptionbadversionexception zookeeper 301 api'

distance = 604
spam score = 64
title = 'alreadyclosedexception lucene 20081220020442 api'

distance = 605
spam score = 63
title = 'keeperexceptionnoauthexception zookeeper 301 api'

distance = 605
spam score = 63
title = 'indexnotfoundexception hbase 0190 api'

distance = 605
spam score = 59
title = 'shellexitcodeexception hadoop 0172 api'

distance = 606
spam score = 62
title = 'keeperexceptioninvalidcallbackexception zookeeper 301 api'

distance = 628
spam score = 69
title = 'keyretiredexception juddiparent 20rc5 api'

distance = 629
spam score = 55
title = 'fileerror nutch 081 api'

distance = 629
spam score = 47
title = 'configurationexception apache jackrabbit 13 api'

distance = 630
spam score = 59
title = 'fileerror nutch 09 api'

distance = 630
spam score = 70
title = 'objectexistsexception jcs 1325rc api'

distance = 630
spam score = 85
title = 'saxnotsupportedexception xml standard api'

distance = 630
spam score = 72
title = 'canonicalizationexception axiom 128 api'

distance = 631
spam score = 56
title = 'cryptographyexception apachepdfbox080incubatordev api'

distance = 632
spam score = 73
title = 'queryexception objectrelationalbridge 104 api documentation'

distance = 633
spam score = 54
title = 'pqftranslationexception cqljava'

distance = 687
spam score = 66
title = 'unknownpluginexception maven 11 api'

distance = 687
spam score = 58
title = 'invalidbookdescriptorexception doxia 10alpha11 api'

distance = 687
spam score = 60
title = 'parsernotfound nutch 09 api'

distance = 688
spam score = 60
title = 'illegaldataexception jdom v10'

distance = 688
spam score = 61
title = 'velocity 14 api class parseerrorexception'

distance = 688
spam score = 80
title = 'missingattributeexception commonsjelly 11snapshot api'

distance = 690
spam score = 70
title = 'singularmatrixexception commons math 20snapshot api'

distance = 692
spam score = 73
title = 'castexception commons contract 02 api'

distance = 693
spam score = 57
title = 'xalanjava 271 class internalerror'

distance = 693
spam score = 73
title = 'notarotationmatrixexception commons math 20snapshot api'

distance = 745
spam score = 65
title = 'stalesessionexception tapestry 416 api'

distance = 747
spam score = 72
title = 'accesscontrolexception turbine2 24snapshot api'

distance = 748
spam score = 74
title = 'crossserverbindingexception slide api documentation'

distance = 749
spam score = 56
title = 'circularincludeexception digester 17 api'

distance = 749
spam score = 62
title = 'checkrequiredattributescheckrequiredattributesexception mule esb 220 api'

distance = 749
spam score = 67
title = 'unknownauthenticationtypeexception mule esb 212 api'

distance = 750
spam score = 73
title = 'validationexception turbine2 233dev api'

distance = 752
spam score = 52
title = 'ircexception pircbot 146 java irc api bot framework'

distance = 754
spam score = 61
title = 'unknownpositionexception cqljava'

distance = 754
spam score = 79
title = 'xalanjava 271 class saxnotrecognizedexception'

distance = 831
spam score = 74
title = 'restartresponseexception wicket 132 api'

distance = 837
spam score = 60
title = 'cyclicgoalchainexception maven 11 api'

distance = 837
spam score = 65
title = 'xalanjava 271 class wrappedruntimeexception'

distance = 838
spam score = 50
title = 'xalanjava 2 class stopparseexception'

distance = 842
spam score = 53
title = 'installabortedexception eclipse platform api specification'

distance = 842
spam score = 75
title = 'insufficientstorageexception slide api documentation'

distance = 842
spam score = 59
title = 'storingexception oscube 03 api'

distance = 844
spam score = 66
title = 'xerces2 xml parser api class rangeexceptionimpl'

distance = 846
spam score = 69
title = 'argumentoutsidedomainexception commons math 12 api'

distance = 846
spam score = 62
title = 'invaliddigestvalueexception'

distance = 1889
spam score = 0
title = 'welcome to the best shopping destination'

distance = 1898
spam score = 0
title = 'international site check it now for a lot of offers'

distance = 1912
spam score = 27
title = 'anemones and animals that live in symbiosis them starfish photos hexacorallia seeanemonen und die tiere die in symbiose auf ihnen leben'

distance = 134
spam score = 51
title = 'uses of class orghibernatelazyinitializationexception hibernate api documentation'

distance = 148
spam score = 53
title = 'uses of package orghibernatelob hibernate api documentation'

distance = 150
spam score = 52
title = 'uses of class orghibernateassertionfailure hibernate api documentation'

distance = 159
spam score = 49
title = 'uses of package orghibernatepersister hibernate api documentation'

distance = 183
spam score = 50
title = 'uses of class orghibernatetypearraytype hibernate api documentation'

distance = 186
spam score = 50
title = 'uses of class orghibernateannotationsparent hibernate annotations api documentation'

distance = 190
spam score = 55
title = 'uses of class orghibernatesecurejaccpreloadeventlistener hibernate api documentation'

distance = 195
spam score = 50
title = 'uses of class orghibernatesecurejaccpreupdateeventlistener hibernate api documentation'

distance = 202
spam score = 47
title = 'uses of class orghibernateconnectiondrivermanagerconnectionprovider hibernate api documentation'

distance = 210
spam score = 50
title = 'uses of class orghibernateidassigned hibernate api documentation'

distance = 213
spam score = 52
title = 'uses of class orghibernatesecurejaccpreinserteventlistener hibernate api documentation'

distance = 214
spam score = 50
title = 'uses of package orghibernateproxymap hibernate api documentation'

distance = 215
spam score = 49
title = 'uses of class orghibernatecriterionrowcountprojection hibernate api documentation'

distance = 215
spam score = 51
title = 'uses of class orghibernatesqlalias hibernate api documentation'

distance = 215
spam score = 47
title = 'uses of class orghibernateannotationsparameter hibernate annotations api documentation'

distance = 216
spam score = 45
title = 'uses of class orghibernateconnectionconnectionproviderfactory hibernate api documentation'

distance = 216
spam score = 47
title = 'uses of class orghibernateannotationscascade hibernate annotations api documentation'

distance = 216
spam score = 53
title = 'uses of class orghibernateannotationsforcediscriminator hibernate annotations api documentation'

distance = 216
spam score = 50
title = 'uses of class orghibernatecriterionexistssubqueryexpression hibernate api documentation'

distance = 217
spam score = 50
title = 'uses of class orghibernatecriterionilikeexpression hibernate api documentation'

distance = 304
spam score = 54
title = 'uses of package orghibernatetoolinstrumentjavassist hibernate api documentation'

distance = 304
spam score = 46
title = 'uses of class orghibernatecfgjoinedsubclassfksecondpass hibernate annotations api documentation'

distance = 304
spam score = 56
title = 'uses of package orghibernatetoolinstrumentcglib hibernate api documentation'

distance = 306
spam score = 49
title = 'uses of class orghibernateimplcriteriaimplorderentry hibernate api documentation'

distance = 307
spam score = 49
title = 'uses of class orghibernateinterceptjavassistfieldinterceptorimpl hibernate api documentation'

distance = 307
spam score = 56
title = 'uses of class orghibernateeventdefdefaultpostloadeventlistener hibernate api documentation'

distance = 308
spam score = 52
title = 'uses of class orghibernatecacheentrystructuredcollectioncacheentry hibernate api documentation'

distance = 308
spam score = 48
title = 'uses of class orghibernatecfgpropertyholderbuilder hibernate annotations api documentation'

distance = 308
spam score = 48
title = 'uses of class orghibernatecfgannotationsversion hibernate annotations api documentation'

distance = 308
spam score = 51
title = 'uses of class orghibernatebytecodejavassistaccessoptimizeradapter hibernate api documentation'

distance = 376
spam score = 51
title = 'uses of class orghibernateloadercustomsqlsqlqueryparser hibernate api documentation'

distance = 376
spam score = 49
title = 'orghibernatemetadata class hierarchy hibernate api documentation'

distance = 377
spam score = 48
title = 'uses of class orghibernateproxypojojavassistserializableproxy hibernate api documentation'

distance = 379
spam score = 51
title = 'uses of class orghibernateloadercustomsqlsqlqueryreturnprocessor hibernate api documentation'

distance = 385
spam score = 49
title = 'uses of class orghibernatetoolhbm2ddlschemavalidatortask hibernate api documentation'

distance = 388
spam score = 42
title = 'orghibernatesearchjpaimpl hibernate search api documentation'

distance = 391
spam score = 50
title = 'uses of class orghibernatetoolhbm2ddlschemavalidator hibernate api documentation'

distance = 396
spam score = 47
title = 'uses of class orghibernatecfgannotationsbagbinder hibernate annotations api documentation'

distance = 399
spam score = 48
title = 'uses of class orghibernatehqlastutilastappender hibernate api documentation'

distance = 400
spam score = 48
title = 'overview hibernate entitymanager api documentation'

distance = 512
spam score = 47
title = 'uses of package orghibernatetype hibernate annotations api documentation'

distance = 514
spam score = 42
title = 'uses of class javaxpersistencepreupdate ejb 30 persistence api documentation'

distance = 515
spam score = 48
title = 'uses of class javaxpersistenceattributeoverrides ejb 30 persistence api documentation'

distance = 516
spam score = 56
title = 'orghibernateinterceptjavassist hibernate api documentation'

distance = 516
spam score = 44
title = 'uses of class javaxpersistencejoincolumns ejb 30 persistence api documentation'

distance = 517
spam score = 41
title = 'uses of class javaxpersistenceoptimisticlockexception ejb 30 persistence api documentation'

distance = 518
spam score = 53
title = 'uses of class orghibernateactioncollectionrecreateaction hibernate api documentation'

distance = 518
spam score = 43
title = 'uses of class orghibernateprettyformatter hibernate api documentation'

distance = 519
spam score = 42
title = 'uses of class javaxpersistencetablegenerator ejb 30 persistence api documentation'

distance = 520
spam score = 41
title = 'uses of class javaxpersistenceinheritance ejb 30 persistence api documentation'

distance = 542
spam score = 51
title = 'uses of class orghibernateactionbulkoperationcleanupaction hibernate api documentation'

distance = 542
spam score = 42
title = 'uses of class javaxpersistencepreremove ejb 30 persistence api documentation'

distance = 543
spam score = 43
title = 'uses of class orghibernatejdbccolumnnamecache hibernate api documentation'

distance = 544
spam score = 43
title = 'uses of class javaxpersistencetransactionrequiredexception ejb 30 persistence api documentation'

distance = 545
spam score = 45
title = 'uses of class javaxpersistenceprimarykeyjoincolumns ejb 30 persistence api documentation'

distance = 545
spam score = 43
title = 'uses of class javaxpersistenceonetoone ejb 30 persistence api documentation'

distance = 546
spam score = 45
title = 'uses of interface orghibernatecfgquerysecondpass hibernate api documentation'

distance = 551
spam score = 54
title = 'uses of package orghibernateproxypojo hibernate api documentation'

distance = 556
spam score = 41
title = 'orghibernateshardsengine hibernate shards api documentation'

distance = 560
spam score = 41
title = 'orghibernateshardsstrategyselection hibernate shards api documentation'

distance = 645
spam score = 51
title = 'uses of class orghibernateannotationsbatchsize hibernate annotations api documentation'

distance = 646
spam score = 41
title = 'orghibernatesearchimpl hibernate search api documentation'

distance = 650
spam score = 53
title = 'uses of class orghibernateannotationssort hibernate annotations api documentation'

distance = 650
spam score = 51
title = 'uses of class orghibernateutilequalshelper hibernate api documentation'

distance = 651
spam score = 48
title = 'uses of class orghibernatehqlastparametertranslationsimplparameterinfo hibernate api documentation'

distance = 663
spam score = 50
title = 'uses of class orghibernatehqlcollectionproperties hibernate api documentation'

distance = 663
spam score = 49
title = 'uses of class orghibernatetransformtolistresulttransformer hibernate api documentation'

distance = 666
spam score = 52
title = 'uses of interface orghibernateusertypeusertype hibernate api documentation'

distance = 673
spam score = 39
title = 'uses of class orghibernateannotationsanymetadef hibernate annotations api documentation'

distance = 676
spam score = 67
title = 'orghibernatecfgannotationsreflection hibernate annotations api documentation'

distance = 744
spam score = 57
title = 'uses of class orghibernateenginequerynativesqlqueryplan hibernate api documentation'

distance = 744
spam score = 55
title = 'uses of class orghibernateenginequeryqueryplancache hibernate api documentation'

distance = 750
spam score = 51
title = 'uses of class orghibernatetupleentityabstractentitytuplizer hibernate api documentation'

distance = 750
spam score = 46
title = 'orghibernateenversevent hibernate envers 340snapshot api'

distance = 753
spam score = 61
title = 'orghibernateloadercustomsql hibernate api documentation'

distance = 753
spam score = 60
title = 'uses of package orghibernatecacheentry hibernate api documentation'

distance = 754
spam score = 48
title = 'uses of package orgjbossenversevent hibernate envers 340snapshot api'

distance = 755
spam score = 54
title = 'overview hibernate annotations api documentation'

distance = 757
spam score = 59
title = 'uses of class orghibernateimplabstractqueryimpl hibernate api documentation'

distance = 767
spam score = 53
title = 'uses of class orghibernateenversdefaultrevisionentity hibernate envers 340snapshot api'

distance = 846
spam score = 58
title = 'uses of interface orghibernatecontextcurrentsessioncontext hibernate api documentation'

distance = 847
spam score = 63
title = 'overview hibernate entitymanager api documentation'

distance = 849
spam score = 59
title = 'orghibernatetoolinstrument hibernate api documentation'

distance = 855
spam score = 49
title = 'orghibernateenversqueryprojection hibernate envers 340snapshot api'

distance = 856
spam score = 42
title = 'uses of class orghibernatetoolhbm2ddlschemaexport hibernate api documentation'

distance = 857
spam score = 44
title = 'uses of class orghibernatecriterionproperty hibernate api documentation'

distance = 857
spam score = 50
title = 'uses of package orghibernateenverssynchronization hibernate envers 340snapshot api'

distance = 858
spam score = 50
title = 'uses of package orghibernatebytecodejavassist hibernate api documentation'

distance = 858
spam score = 57
title = 'uses of package orghibernateutil hibernate api documentation'

distance = 859
spam score = 46
title = 'uses of class orghibernateannotationsformula hibernate annotations api documentation'

distance = 944
spam score = 38
title = 'uses of interface javaxpersistenceentitymanager ejb 30 persistence api documentation'

distance = 944
spam score = 58
title = 'uses of package orghibernateaction hibernate api documentation'

distance = 946
spam score = 54
title = 'orghibernatetoolinstrumentcglib hibernate api documentation'

distance = 947
spam score = 48
title = 'orghibernateloadercriteria hibernate api documentation'

distance = 947
spam score = 48
title = 'uses of interface orghibernatebytecodeproxyfactoryfactory hibernate api documentation'

distance = 947
spam score = 59
title = 'orghibernatelob hibernate api documentation'

distance = 948
spam score = 45
title = 'uses of interface orghibernateexceptionviolatedconstraintnameextracter hibernate api documentation'

distance = 949
spam score = 53
title = 'orghibernatetuplecomponent hibernate api documentation'

distance = 951
spam score = 44
title = 'autoformmozdevorg overview'

distance = 952
spam score = 59
title = 'orghibernateproxy hibernate api documentation'

distance = 1259
spam score = 48
title = 'uses of class orghibernatecriterionmatchmode hibernate api documentation'

distance = 1273
spam score = 48
title = 'uses of class orghibernateenginefilterdefinition hibernate api documentation'

distance = 1280
spam score = 68
title = 'uses of class orghibernatemappingcolumn hibernate api documentation'

distance = 1288
spam score = 44
title = 'uses of class orghibernatemappingidgenerator hibernate annotations api documentation'

distance = 1288
spam score = 54
title = 'uses of class orghibernateengineidentifiervalue hibernate api documentation'

distance = 1291
spam score = 46
title = 'uses of class orghibernatecfgannotationsnullability hibernate annotations api documentation'

distance = 1294
spam score = 38
title = 'uses of class orghibernatecfginheritancestate hibernate annotations api documentation'

distance = 1399
spam score = 33
title = 'uses of class orghibernatecfgannotationconfiguration hibernate annotations api documentation'

distance = 280
spam score = 66
title = 'bufferunderflowexception java 2 platform se 50'

distance = 286
spam score = 66
title = 'cancelledkeyexception java 2 platform se 50'

distance = 288
spam score = 65
title = 'bufferunderflowexception java 2 platform se v142'

distance = 288
spam score = 64
title = 'bufferunderflowexception java 2 platform se 50'

distance = 289
spam score = 67
title = 'bufferunderflowexception java 2 platform se v142'

distance = 291
spam score = 71
title = 'invalidmarkexception java 2 platform se 50'

distance = 294
spam score = 68
title = 'bufferunderflowexception java 2 platform se 50'

distance = 295
spam score = 59
title = 'cancelledkeyexception java 2 platform se 50'

distance = 295
spam score = 64
title = 'invalidmarkexception java 2 platform se 50'

distance = 296
spam score = 63
title = 'bufferunderflowexception java platform se 6'

distance = 302
spam score = 70
title = 'bufferunderflowexception java 2 platform se v142'

distance = 305
spam score = 67
title = 'bufferunderflowexception java platform se 6'

distance = 308
spam score = 62
title = 'bufferoverflowexception java 2 platform se 50'

distance = 308
spam score = 62
title = 'cancelledkeyexception java 2 platform se v142'

distance = 310
spam score = 65
title = 'invalidmarkexception java 2 platform se v142'

distance = 310
spam score = 65
title = 'bufferunderflowexception java platform se 6'

distance = 311
spam score = 63
title = 'readonlybufferexception java 2 platform se 50'

distance = 312
spam score = 80
title = 'aclnotfoundexception java 2 platform se 50'

distance = 313
spam score = 59
title = 'cancelledkeyexception java 2 platform se v142'

distance = 313
spam score = 62
title = 'bufferoverflowexception java 2 platform se v142'

distance = 383
spam score = 65
title = 'bufferunderflowexception java 2 platform se v142'

distance = 383
spam score = 63
title = 'cancelledkeyexception java 2 platform se v142'

distance = 383
spam score = 62
title = 'readonlybufferexception java 2 platform se 50'

distance = 385
spam score = 63
title = 'nonreadablechannelexception java platform se 6'

distance = 385
spam score = 53
title = 'illegalblockingmodeexception java 2 platform se v142'

distance = 386
spam score = 56
title = 'filelockinterruptionexception java 2 platform se 50'

distance = 386
spam score = 61
title = 'nonwritablechannelexception java 2 platform se v141'

distance = 386
spam score = 62
title = 'charactercodingexception java platform se 6'

distance = 386
spam score = 60
title = 'notyetboundexception java platform se 6'

distance = 387
spam score = 60
title = 'charactercodingexception java platform se 6'

distance = 440
spam score = 57
title = 'closedchannelexception java 2 platform se 50'

distance = 440
spam score = 60
title = 'lastownerexception java 2 platform se 50'

distance = 443
spam score = 66
title = 'invalidapplicationexception java 2 platform se 50'

distance = 443
spam score = 57
title = 'closedchannelexception java 2 platform se v142'

distance = 443
spam score = 59
title = 'codermalfunctionerror java 2 platform se v142'

distance = 443
spam score = 64
title = 'genericsignatureformaterror java 2 platform se 50'

distance = 444
spam score = 62
title = 'closedchannelexception java 2 platform se v142'

distance = 445
spam score = 55
title = 'codermalfunctionerror java 2 platform se 50'

distance = 448
spam score = 67
title = 'codermalfunctionerror java 2 platform se 50'

distance = 449
spam score = 59
title = 'charactercodingexception java 2 platform se v142'

distance = 509
spam score = 68
title = 'invalidobjectexception java platform se 6'

distance = 510
spam score = 48
title = 'illegalformatexception java 2 platform se 50'

distance = 510
spam score = 68
title = 'transactionrequiredexception java 2 platform se v142'

distance = 511
spam score = 63
title = 'invalidobjectexception java 2 platform se v142'

distance = 511
spam score = 74
title = 'notactiveexception java 2 platform se 50'

distance = 512
spam score = 69
title = 'threaddeath java 2 platform se v142'

distance = 513
spam score = 70
title = 'cannotredoexception java 2 platform se v142'

distance = 513
spam score = 73
title = 'cannotredoexception java 2 platform se v142'

distance = 513
spam score = 68
title = 'transactionrequiredexception java 2 platform se v142'

distance = 514
spam score = 60
title = 'invalidtransactionexception java 2 platform se 50'

distance = 567
spam score = 68
title = 'invalidtargetobjecttypeexception java 2 platform se 50'

distance = 567
spam score = 76
title = 'streamcorruptedexception java 2 platform se v142'

distance = 567
spam score = 64
title = 'transactionrequiredexception java 2 platform se v142'

distance = 568
spam score = 61
title = 'illegalcharsetnameexception java 2 platform se v142'

distance = 569
spam score = 58
title = 'sslexception java 2 platform se v142'

distance = 570
spam score = 63
title = 'notactiveexception java 2 platform se v142'

distance = 570
spam score = 63
title = 'sslexception java 2 platform se v142'

distance = 571
spam score = 65
title = 'illegalcharsetnameexception java 2 platform se v142'

distance = 571
spam score = 68
title = 'transactionrolledbackexception java 2 platform se v142'

distance = 572
spam score = 62
title = 'streamcorruptedexception java 2 platform se v142'

distance = 610
spam score = 76
title = 'adapteralreadyexists java 2 platform se v142'

distance = 610
spam score = 61
title = 'adapterinactive java 2 platform se v142'

distance = 610
spam score = 63
title = 'invalidvalue java 2 platform se 50'

distance = 610
spam score = 62
title = 'wrongpolicy java 2 platform se v142'

distance = 610
spam score = 64
title = 'sslprotocolexception java 2 platform se 50'

distance = 610
spam score = 59
title = 'streamcorruptedexception java 2 platform se v142'

distance = 610
spam score = 58
title = 'sslhandshakeexception java 2 platform se v142'

distance = 610
spam score = 71
title = 'adapternonexistent java 2 platform se v142'

distance = 611
spam score = 63
title = 'unsupportedcharsetexception java platform se 6'

distance = 611
spam score = 66
title = 'unsupportedcharsetexception java platform se 6'

distance = 654
spam score = 60
title = 'invalidname java 2 platform se 50'

distance = 654
spam score = 60
title = 'sslprotocolexception java platform se 6'

distance = 654
spam score = 59
title = 'objectnotactive java 2 platform se v141'

distance = 654
spam score = 61
title = 'sslkeyexception java 2 platform se v142'

distance = 655
spam score = 69
title = 'invaliddndoperationexception java 2 platform se v142'

distance = 655
spam score = 61
title = 'servantalreadyactive java 2 platform se v141'

distance = 656
spam score = 64
title = 'sslpeerunverifiedexception java platform se 6'

distance = 657
spam score = 79
title = 'sslpeerunverifiedexception java platform se 6'

distance = 659
spam score = 69
title = 'sslpeerunverifiedexception java 2 platform se 50'

distance = 660
spam score = 58
title = 'sslprotocolexception java platform se 6'

distance = 724
spam score = 67
title = 'badbinaryopvalueexpexception java platform se 6'

distance = 724
spam score = 52
title = 'java 2 platform se v131 class unsupportedflavorexception'

distance = 725
spam score = 54
title = 'threaddeath java platform se 7 b47'

distance = 726
spam score = 66
title = 'invalidpolicy java 2 platform se v142'

distance = 726
spam score = 68
title = 'unmappablecharacterexception java platform se 6'

distance = 727
spam score = 81
title = 'badbinaryopvalueexpexception java 2 platform se 50'

distance = 727
spam score = 44
title = 'java 2 platform se v131 class streamcorruptedexception'

distance = 727
spam score = 59
title = 'unmappablecharacterexception java platform se 6'

distance = 728
spam score = 61
title = 'unmappablecharacterexception java platform se 6'

distance = 728
spam score = 69
title = 'malformedinputexception java 2 platform se v142'

distance = 967
spam score = 75
title = 'unknownelementexception java platform se 6'

distance = 969
spam score = 82
title = 'applicationexception java 2 platform se 50'

distance = 970
spam score = 82
title = 'applicationexception java 2 platform se v142'

distance = 971
spam score = 69
title = 'applicationexception java platform se 6'

distance = 991
spam score = 61
title = 'lsexception java 2 platform se 50'

distance = 994
spam score = 63
title = 'lsexception java 2 platform se 50'

distance = 995
spam score = 67
title = 'lsexception java 2 platform se 50'

distance = 1010
spam score = 76
title = 'lsexception java platform se 6'

distance = 1012
spam score = 57
title = 'lsexception java platform se 6'

distance = 1026
spam score = 62
title = 'indirectionexception java 2 platform se 50'

distance = 1468
spam score = 65
title = 'userexception java 2 platform se 50'

distance = 1473
spam score = 53
title = 'userexception java 2 se v1 40'

distance = 1715
spam score = 38
title = 'javascript dpunktverlag'

distance = 1830
spam score = 34
title = 'forresinstbuit'

distance = 1926
spam score = 30
title = 'przetargi w polsce zachodniopomorskie drka przetargi nieograniczone'

distance = 201
spam score = 68
title = ''

distance = 209
spam score = 65
title = ''

distance = 229
spam score = 65
title = ''

distance = 233
spam score = 67
title = ''

distance = 236
spam score = 66
title = ''

distance = 236
spam score = 67
title = ''

distance = 237
spam score = 65
title = ''

distance = 243
spam score = 66
title = ''

distance = 246
spam score = 65
title = ''

distance = 247
spam score = 68
title = ''

distance = 248
spam score = 65
title = ''

distance = 251
spam score = 67
title = ''

distance = 253
spam score = 67
title = ''

distance = 253
spam score = 70
title = ''

distance = 255
spam score = 66
title = ''

distance = 256
spam score = 65
title = ''

distance = 256
spam score = 66
title = ''

distance = 257
spam score = 65
title = ''

distance = 258
spam score = 64
title = ''

distance = 260
spam score = 65
title = ''

distance = 262
spam score = 66
title = ''

distance = 263
spam score = 66
title = ''

distance = 264
spam score = 65
title = ''

distance = 267
spam score = 67
title = ''

distance = 310
spam score = 68
title = ''

distance = 311
spam score = 68
title = ''

distance = 316
spam score = 69
title = ''

distance = 320
spam score = 67
title = ''

distance = 321
spam score = 67
title = ''

distance = 329
spam score = 65
title = ''

distance = 339
spam score = 67
title = ''

distance = 348
spam score = 65
title = ''

distance = 351
spam score = 68
title = ''

distance = 352
spam score = 67
title = ''

distance = 359
spam score = 67
title = ''

distance = 376
spam score = 66
title = ''

distance = 381
spam score = 64
title = ''

distance = 402
spam score = 66
title = ''

distance = 406
spam score = 65
title = ''

distance = 435
spam score = 66
title = ''

distance = 461
spam score = 66
title = ''

distance = 462
spam score = 67
title = ''

distance = 463
spam score = 66
title = ''

distance = 463
spam score = 68
title = ''

distance = 466
spam score = 66
title = ''

distance = 484
spam score = 67
title = ''

distance = 486
spam score = 65
title = ''

distance = 492
spam score = 72
title = ''

distance = 498
spam score = 67
title = ''

distance = 538
spam score = 68
title = ''

distance = 547
spam score = 69
title = ''

distance = 549
spam score = 69
title = ''

distance = 552
spam score = 67
title = ''

distance = 555
spam score = 68
title = ''

distance = 557
spam score = 65
title = ''

distance = 559
spam score = 65
title = ''

distance = 559
spam score = 70
title = ''

distance = 565
spam score = 66
title = ''

distance = 570
spam score = 67
title = ''

distance = 590
spam score = 69
title = ''

distance = 669
spam score = 68
title = ''

distance = 671
spam score = 71
title = ''

distance = 672
spam score = 68
title = ''

distance = 749
spam score = 67
title = ''

distance = 758
spam score = 66
title = ''

distance = 805
spam score = 70
title = ''

distance = 806
spam score = 72
title = ''

distance = 806
spam score = 71
title = ''

distance = 1026
spam score = 67
title = ''

distance = 1028
spam score = 71
title = ''

distance = 1103
spam score = 66
title = ''

distance = 1107
spam score = 69
title = ''

distance = 1126
spam score = 68
title = ''

distance = 1128
spam score = 64
title = ''

distance = 1152
spam score = 76
title = ''

distance = 1267
spam score = 73
title = ''

distance = 1272
spam score = 69
title = ''

distance = 1322
spam score = 69
title = ''

distance = 1890
spam score = 63
title = ''

distance = 1890
spam score = 44
title = ''

distance = 269
spam score = 54
title = 'javatm 2 platform standard edition v122 api specification class nosuchmethodexception'

distance = 272
spam score = 56
title = 'javatm 2 platform standard edition v122 api specification class negativearraysizeexception'

distance = 273
spam score = 52
title = 'javatm 2 platform standard edition v122 api specification class nosuchmethodexception'

distance = 280
spam score = 51
title = 'javatm 2 platform standard edition v122 api specification class arithmeticexception'

distance = 283
spam score = 54
title = 'javatm 2 platform standard edition v122 api specification class arithmeticexception'

distance = 288
spam score = 56
title = 'javatm 2 platform standard edition v122 api specification class unsupportedoperationexception'

distance = 289
spam score = 51
title = 'javatm 2 platform standard edition v122 api specification class unsupportedoperationexception'

distance = 292
spam score = 44
title = 'java platform 12 api specification class arithmeticexception'

distance = 292
spam score = 48
title = 'javatm 2 platform standard edition v122 api specification class classcircularityerror'

distance = 293
spam score = 68
title = 'javatm 2 platform standard edition v122 api specification class arithmeticexception'

distance = 294
spam score = 48
title = 'javatm 2 platform standard edition v122 api specification class unsupportedoperationexception'

distance = 295
spam score = 62
title = 'javatm 2 platform standard edition v122 api specification class negativearraysizeexception'

distance = 297
spam score = 50
title = 'javatm 2 platform standard edition v122 api specification class classcircularityerror'

distance = 298
spam score = 56
title = 'javatm 2 platform standard edition v122 api specification class unsupportedoperationexception'

distance = 299
spam score = 48
title = 'java platform 12 api specification class nosuchmethodexception'

distance = 302
spam score = 53
title = 'javatm 2 platform standard edition v122 api specification class arithmeticexception'

distance = 304
spam score = 42
title = 'java platform 12 api specification class arithmeticexception'

distance = 304
spam score = 48
title = 'javatm 2 platform standard edition v122 api specification class stackoverflowerror'

distance = 305
spam score = 48
title = 'java platform 12 api specification class arithmeticexception'

distance = 312
spam score = 48
title = 'javatm 2 platform standard edition v122 api specification class internalerror'

distance = 439
spam score = 46
title = 'java platform 12 api specification class illegalcomponentstateexception'

distance = 440
spam score = 65
title = 'java platform 12 api specification class clonenotsupportedexception'

distance = 441
spam score = 42
title = 'java platform 12 api specification class charconversionexception'

distance = 441
spam score = 70
title = 'java 2 platform se v131 class illegalargumentexception'

distance = 442
spam score = 49
title = 'javatm 2 platform standard edition v122 api specification class profiledataexception'

distance = 442
spam score = 71
title = 'javatm 2 platform standard edition v122 api specification class clonenotsupportedexception'

distance = 443
spam score = 57
title = 'javatm 2 platform standard edition v122 api specification class runtimeexception'

distance = 443
spam score = 46
title = 'javatm 2 platform standard edition v122 api specification class unknownserviceexception'

distance = 443
spam score = 41
title = 'java platform 12 api specification class zipexception'

distance = 445
spam score = 47
title = 'javatm 2 platform standard edition v122 api specification class profiledataexception'

distance = 493
spam score = 62
title = 'javatm 2 platform standard edition v122 api specification class interruptedexception'

distance = 494
spam score = 70
title = 'javatm 2 platform standard edition v122 api specification class illegalmonitorstateexception'

distance = 495
spam score = 55
title = 'javatm 2 platform standard edition v122 api specification class unsupportedlookandfeelexception'

distance = 495
spam score = 56
title = 'javatm 2 platform standard edition v122 api specification class alreadyboundexception'

distance = 496
spam score = 54
title = 'javatm 2 platform standard edition v122 api specification class keyexception'

distance = 499
spam score = 54
title = 'java 2 platform se v131 class unsupportedencodingexception'

distance = 500
spam score = 68
title = 'java 2 platform se v131 class numberformatexception'

distance = 500
spam score = 52
title = 'java 2 platform se v131 class securityexception'

distance = 501
spam score = 64
title = 'java 2 platform se v131 class arraystoreexception'

distance = 502
spam score = 55
title = 'java 2 platform se v131 class abstractmethoderror'

distance = 535
spam score = 55
title = 'javatm 2 platform standard edition v122 api specification class certificatenotyetvalidexception'

distance = 535
spam score = 43
title = 'java platform 12 api specification class servernotactiveexception'

distance = 536
spam score = 45
title = 'java 2 platform se v131 class mimetypeparseexception'

distance = 536
spam score = 50
title = 'java 2 platform se v131 class jarexception'

distance = 536
spam score = 49
title = 'javatm 2 platform standard edition v122 api specification class introspectionexception'

distance = 537
spam score = 43
title = 'java platform 12 api specification class emptystackexception'

distance = 537
spam score = 52
title = 'java 2 platform se v131 class crlexception'

distance = 537
spam score = 56
title = 'javatm 2 platform standard edition v122 api specification class certificatenotyetvalidexception'

distance = 538
spam score = 41
title = 'java platform 12 api specification class introspectionexception'

distance = 538
spam score = 51
title = 'java platform 12 api specification class generalsecurityexception'

distance = 586
spam score = 77
title = 'mid profile class unsupportedencodingexception'

distance = 587
spam score = 48
title = 'rim device java library class illegalthreadstateexception'

distance = 587
spam score = 54
title = 'rim device java library class unsupportedencodingexception'

distance = 588
spam score = 60
title = 'java 2 platform se v13 class printerabortexception'

distance = 589
spam score = 52
title = 'rim device java library class instantiationexception'

distance = 589
spam score = 51
title = 'mid profile class illegalthreadstateexception'

distance = 590
spam score = 60
title = 'mid profile class illegalstateexception'

distance = 591
spam score = 49
title = 'java platform 12 api specification class stringindexoutofboundsexception'

distance = 591
spam score = 59
title = 'java 2 platform se v131 class printerexception'

distance = 592
spam score = 53
title = 'rim device java library class indexoutofboundsexception'

distance = 651
spam score = 52
title = 'java 2 platform se v131 class syncfailedexception'

distance = 651
spam score = 59
title = 'javatm 2 platform standard edition v122 api specification class invaliddndoperationexception'

distance = 651
spam score = 71
title = 'runtimeexception mid profile'

distance = 653
spam score = 44
title = 'java platform 12 api specification class notactiveexception'

distance = 653
spam score = 50
title = 'rim device java library class landmarkexception'

distance = 654
spam score = 58
title = 'mid profile class unsupportedencodingexception'

distance = 654
spam score = 53
title = 'java platform 12 api specification class expandvetoexception'

distance = 654
spam score = 39
title = 'java platform 12 api specification class nosuchelementexception'

distance = 654
spam score = 47
title = 'java platform 12 api specification class unsupportedflavorexception'

distance = 656
spam score = 35
title = 'java platform 12 api specification class concurrentmodificationexception'

distance = 691
spam score = 61
title = 'interruptedexception mid profile'

distance = 691
spam score = 43
title = 'java platform 12 api specification class bounds'

distance = 692
spam score = 51
title = 'javatm 2 platform standard edition v122 api specification class propertyvetoexception'

distance = 692
spam score = 57
title = 'java 2 platform se v131 class concurrentmodificationexception'

distance = 693
spam score = 52
title = 'javatm 2 platform standard edition v122 api specification class alreadybound'

distance = 693
spam score = 54
title = 'rim device java library class nullpointerexception'

distance = 694
spam score = 66
title = 'mid profile class midletstatechangeexception'

distance = 694
spam score = 72
title = 'mid profile class nullpointerexception'

distance = 695
spam score = 64
title = 'connectionnotfoundexception mid profile'

distance = 696
spam score = 55
title = 'rim device java library class interruptedexception'

distance = 724
spam score = 59
title = 'midletstatechangeexception mid profile'

distance = 725
spam score = 48
title = 'jpeg api class imageformatexception'

distance = 726
spam score = 49
title = 'javatm 2 platform standard edition v122 api specification class accesscontrolexception'

distance = 728
spam score = 54
title = 'java 2 platform se v131 class expandvetoexception'

distance = 729
spam score = 49
title = 'rim device java library class arrayindexoutofboundsexception'

distance = 729
spam score = 44
title = 'java platform 12 api specification class invalidname'

distance = 730
spam score = 67
title = 'rim device java library class runtimeexception'

distance = 730
spam score = 57
title = 'midletstatechangeexception mid profile'

distance = 731
spam score = 56
title = 'javatm 2 platform standard edition v122 api specification class cannotundoexception'

distance = 731
spam score = 56
title = 'java 2 platform se v131 class rmisecurityexception'

distance = 892
spam score = 63
title = 'nullpointerexception mid profile'

distance = 899
spam score = 48
title = 'java platform 12 api specification class cannotproceed'

distance = 910
spam score = 59
title = 'stringindexoutofboundsexception mid profile'

distance = 926
spam score = 55
title = 'javatm 2 platform standard edition v122 api specification class initialize'

distance = 941
spam score = 48
title = 'javatm 2 platform standard edition v122 api specification class optionaldataexception'

distance = 944
spam score = 48
title = 'java platform 12 api specification class dragsourceevent'

distance = 946
spam score = 37
title = 'java platform 12 api specification class optionaldataexception'

distance = 947
spam score = 43
title = 'javatm 2 platform standard edition v122 api specification class optionaldataexception'

distance = 949
spam score = 50
title = 'rim device java library class nonpersistableobjectexception'

distance = 958
spam score = 56
title = 'javatm 2 platform standard edition v122 api specification class implimit'

distance = 1331
spam score = 44
title = 'jpeg api class truncatedfileexception'

distance = 1338
spam score = 50
title = 'jpeg api class truncatedfileexception'

distance = 1466
spam score = 53
title = 'userexception java 2 se v1 40'

distance = 1840
spam score = 6
title = 'constructivistclassroom constructivist classroom'

distance = 1876
spam score = 22
title = 'technical details of basement construction'

distance = 204
spam score = 49
title = 'uses of package fihuttmlxsmilesmlfcswing xsmiles 12 api doc'

distance = 217
spam score = 53
title = 'uses of package fihuttmlxsmilesmlfcjax xsmiles 12 api doc'

distance = 221
spam score = 49
title = 'uses of package fihuttmlxsmilesmlfcdrml xsmiles 12 api doc'

distance = 226
spam score = 53
title = 'uses of package fihuttmlxsmilesmlfcsip xsmiles 12 api doc'

distance = 239
spam score = 48
title = 'uses of package fihuttmlxsmilesmlfcsip xsmiles 12 api doc'

distance = 241
spam score = 49
title = 'uses of package fihuttmlxsmilesmlfcswing xsmiles 12 api doc'

distance = 249
spam score = 52
title = 'uses of package fihuttmlxsmilescontenthtml xsmiles 12 api doc'

distance = 277
spam score = 51
title = 'fihuttmlxsmilesmlfcsip xsmiles 12 api doc'

distance = 279
spam score = 53
title = 'uses of package fihuttmlxsmilesguiconsole xsmiles 12 api doc'

distance = 280
spam score = 49
title = 'uses of package fihuttmlxsmilesmlfccommjxta xsmiles 12 api doc'

distance = 284
spam score = 52
title = 'uses of package fihuttmlxsmilesmlfccommjxta xsmiles 12 api doc'

distance = 287
spam score = 47
title = 'uses of class fihuttmlxsmilescontentdummyfetcher xsmiles 12 api doc'

distance = 294
spam score = 59
title = 'fihuttmlxsmilesmlfcsip xsmiles 12 api doc'

distance = 295
spam score = 50
title = 'uses of class fihuttmlxsmilesmlfcsignatureresolver xsmiles 12 api doc'

distance = 297
spam score = 51
title = 'uses of package fihuttmlxsmilesguinewgui xsmiles 12 api doc'

distance = 299
spam score = 53
title = 'uses of package fihuttmlxsmilesmlfcdrmldom xsmiles 12 api doc'

distance = 305
spam score = 49
title = 'uses of package fihuttmlxsmilesguimobile xsmiles 12 api doc'

distance = 306
spam score = 48
title = 'uses of class fihuttmlxsmilesmlfcgeneralattributehandler xsmiles 12 api doc'

distance = 309
spam score = 44
title = 'uses of class fihuttmlxsmilesmlfciodevicetest xsmiles 12 api doc'

distance = 309
spam score = 49
title = 'uses of class fihuttmlxsmilesmlfcdrmldrmlfc xsmiles 12 api doc'

distance = 413
spam score = 51
title = 'fihuttmlxsmilesguimlfc class hierarchy xsmiles 12 api doc'

distance = 414
spam score = 48
title = 'uses of class fihuttmlxsmilesmlfccssswingswingstylesheetwrapper xsmiles 12 api doc'

distance = 418
spam score = 55
title = 'uses of package fihuttmlxsmilesmlfcsmilviewerswingmediajava2 xsmiles 12 api doc'

distance = 420
spam score = 49
title = 'fihuttmlxsmilesmessaging class hierarchy xsmiles 12 api doc'

distance = 421
spam score = 47
title = 'uses of interface fihuttmlxsmilesmlfccssswingswingstylableelement xsmiles 12 api doc'

distance = 424
spam score = 47
title = 'uses of class fihuttmlxsmilesguimetmetstylesheetmenu xsmiles 12 api doc'

distance = 424
spam score = 49
title = 'uses of class fihuttmlxsmilesguimediageneralawttextmedia xsmiles 12 api doc'

distance = 426
spam score = 51
title = 'uses of class fihuttmlxsmilesguicomponentsawtawtselectmanycompact xsmiles 12 api doc'

distance = 426
spam score = 48
title = 'uses of interface fihuttmlxsmilesmlfcaamlnainativeaudio xsmiles 12 api doc'

distance = 427
spam score = 47
title = 'uses of class fihuttmlxsmilesguicompatibilityjdk11jdk11compatibility xsmiles 12 api doc'

distance = 469
spam score = 45
title = 'uses of class fihuttmlxsmilescommimplementationsipsipaddressbook xsmiles 12 api doc'

distance = 469
spam score = 51
title = 'fihuttmlxsmilescommevents class hierarchy xsmiles 12 api doc'

distance = 469
spam score = 52
title = 'uses of package fihuttmlxsmilesmlfcxformsdomswing xsmiles 12 api doc'

distance = 470
spam score = 51
title = 'fihuttmlxsmilescommpresence class hierarchy xsmiles 12 api doc'

distance = 471
spam score = 48
title = 'uses of class fihuttmlxsmilesguicomponentsawtawtrange xsmiles 12 api doc'

distance = 471
spam score = 47
title = 'uses of interface fihuttmlxsmilescsslayoutviewscrollview xsmiles 12 api doc'

distance = 471
spam score = 48
title = 'fihuttmlxsmilesmlfcxformsui xsmiles 12 api doc'

distance = 472
spam score = 66
title = 'fihuttmlxsmilesguicompatibilityjdk11 xsmiles 12 api doc'

distance = 472
spam score = 49
title = 'fihuttmlxsmilescommimplementationsip xsmiles 12 api doc'

distance = 472
spam score = 49
title = 'fihuttmlxsmilescommevents class hierarchy xsmiles 12 api doc'

distance = 499
spam score = 56
title = 'fihuttmlxsmilesguiswing class hierarchy xsmiles 12 api doc'

distance = 500
spam score = 47
title = 'uses of class fihuttmlxsmilesguiftvdoublebufferedpanel xsmiles 12 api doc'

distance = 500
spam score = 45
title = 'uses of class fihuttmlxsmilesmlfcsmilviewerawtawtmediahandler xsmiles 12 api doc'

distance = 501
spam score = 47
title = 'uses of class fihuttmlxsmilesmlfcsmilviewerswingswingbrushhandler xsmiles 12 api doc'

distance = 502
spam score = 47
title = 'uses of class fihuttmlxsmilesguigui2awtsimpleawtgui xsmiles 12 api doc'

distance = 502
spam score = 48
title = 'uses of class fihuttmlxsmilesecmarhinorhinoscripter xsmiles 12 api doc'

distance = 503
spam score = 52
title = 'uses of package fihuttmlxsmilesmlfcsmilviewersmilmlfc xsmiles 12 api doc'

distance = 507
spam score = 58
title = 'fihuttmlxsmilesguimobile xsmiles 12 api doc'

distance = 508
spam score = 48
title = 'fihuttmlxsmilesmlfcsmilviewerswingmediajava2 xsmiles 12 api doc'

distance = 509
spam score = 47
title = 'uses of class fihuttmlxsmilesecmarhinoxsmileswrapfactory xsmiles 12 api doc'

distance = 560
spam score = 53
title = 'uses of package fihuttmlxsmilescommimplementationgeneralevents xsmiles 12 api doc'

distance = 560
spam score = 54
title = 'uses of package fihuttmlxsmilescommpresence xsmiles 12 api doc'

distance = 560
spam score = 50
title = 'uses of package fihuttmlxsmilescommpresence xsmiles 12 api doc'

distance = 562
spam score = 51
title = 'uses of class fihuttmlxsmilesmlfcaamlpoint3d xsmiles 12 api doc'

distance = 562
spam score = 50
title = 'fihuttmlxsmilesmlfc class hierarchy xsmiles 12 api doc'

distance = 562
spam score = 51
title = 'uses of package fihuttmlxsmilescommimplementationgeneralevents xsmiles 12 api doc'

distance = 565
spam score = 51
title = 'uses of package fihuttmlxsmilesecmarhino xsmiles 12 api doc'

distance = 572
spam score = 49
title = 'fihuttmlxsmilesmessaging xsmiles 12 api doc'

distance = 572
spam score = 51
title = 'fihuttmlxsmilescommimplementationgeneralmessages class hierarchy xsmiles 12 api doc'

distance = 583
spam score = 50
title = 'uses of class fihuttmlxsmilesguicomponentsawtawtcaption xsmiles 12 api doc'

distance = 638
spam score = 67
title = 'fihuttmlxsmilesmlfcsmilviewerswingmedia xsmiles 12 api doc'

distance = 638
spam score = 54
title = 'fihuttmlxsmilesmlfcsignature xsmiles 12 api doc'

distance = 638
spam score = 60
title = 'fihuttmlxsmilesmlfcxformsdata xsmiles 12 api doc'

distance = 638
spam score = 46
title = 'uses of interface fihuttmlxsmilesmlfcxbl2xblimplementation xsmiles 12 api doc'

distance = 639
spam score = 55
title = 'fihuttmlxsmilesmlfcxformsdominterface xsmiles 12 api doc'

distance = 639
spam score = 49
title = 'uses of class fihuttmlxsmilesmlfcsmilviewerhavihavifocusmanager xsmiles 12 api doc'

distance = 640
spam score = 54
title = 'fihuttmlxsmilesguigui2awt xsmiles 12 api doc'

distance = 640
spam score = 58
title = 'fihuttmlxsmilesmlfcxforms xsmiles 12 api doc'

distance = 642
spam score = 55
title = 'uses of class fihuttmlxsmilesguigui2awtawteventscontainerex xsmiles 12 api doc'

distance = 645
spam score = 53
title = 'fihuttmlxsmilesguinewgui xsmiles 12 api doc'

distance = 725
spam score = 55
title = 'uses of package fihuttmlxsmilescsslayoutview xsmiles 12 api doc'

distance = 726
spam score = 49
title = 'fihuttmlxsmilesmlfcxformsxpath xsmiles 12 api doc'

distance = 730
spam score = 58
title = 'uses of package fihuttmlxsmilescsslayout xsmiles 12 api doc'

distance = 736
spam score = 51
title = 'fihuttmlxsmilesmlfcio xsmiles 12 api doc'

distance = 737
spam score = 46
title = 'uses of package fihuttmlxsmilesmlfcxformsui xsmiles 12 api doc'

distance = 742
spam score = 57
title = 'fihuttmlxsmilesmlfcsmilviewer xsmiles 12 api doc'

distance = 742
spam score = 70
title = 'fihuttmlxsmilesevent xsmiles 12 api doc'

distance = 742
spam score = 54
title = 'fihuttmlxsmilesmlfcsmilviewerhavimedia xsmiles 12 api doc'

distance = 743
spam score = 53
title = 'fihuttmlxsmilesmlfcxformsinstancexercespsvi xsmiles 12 api doc'

distance = 743
spam score = 66
title = 'fihuttmlxsmilesmlfcio xsmiles 12 api doc'

distance = 800
spam score = 58
title = 'fihuttmlxsmilesmlfcxbl2dom xsmiles 12 api doc'

distance = 806
spam score = 55
title = 'uses of package fihuttmlxsmilesguimlfc xsmiles 12 api doc'

distance = 808
spam score = 52
title = 'uses of package fihuttmlxsmilesmlfcxslforender xsmiles 12 api doc'

distance = 809
spam score = 72
title = 'fihuttmlxsmilesmlfcxbl2dom xsmiles 12 api doc'

distance = 813
spam score = 61
title = 'fihuttmlxsmilesmlfcsignatureswing class hierarchy xsmiles 12 api doc'

distance = 813
spam score = 58
title = 'fihuttmlxsmilesgui xsmiles 12 api doc'

distance = 814
spam score = 59
title = 'fihuttmlxsmilesgui class hierarchy xsmiles 12 api doc'

distance = 814
spam score = 52
title = 'uses of class fihuttmlxsmilesguicomponentsswingcalendarjdaychooser xsmiles 12 api doc'

distance = 815
spam score = 65
title = 'fihuttmlxsmilesgui xsmiles 12 api doc'

distance = 822
spam score = 56
title = 'uses of package fihuttmlxsmilesmlfcgeneral xsmiles 12 api doc'

distance = 918
spam score = 49
title = 'fihuttmlxsmiles class hierarchy xsmiles 12 api doc'

distance = 918
spam score = 70
title = 'fihuttmlxsmilesmlfcgeneral xsmiles 12 api doc'

distance = 920
spam score = 54
title = 'fihuttmlxsmilesguicomponentsswingcalendar xsmiles 12 api doc'

distance = 921
spam score = 56
title = 'fihuttmlxsmilesmlfccssswing class hierarchy xsmiles 12 api doc'

distance = 922
spam score = 56
title = 'fihuttmlxsmilesguimet xsmiles 12 api doc'

distance = 923
spam score = 52
title = 'uses of interface fihuttmlxsmilesguicomponentsxtabbedpane xsmiles 12 api doc'

distance = 925
spam score = 50
title = 'fihuttmlxsmilescontent xsmiles 12 api doc'

distance = 930
spam score = 70
title = 'fihuttmlxsmilesguimet xsmiles 12 api doc'

distance = 933
spam score = 64
title = 'fihuttmlxsmilescontent xsmiles 12 api doc'

distance = 937
spam score = 50
title = 'uses of package fihuttmlxsmilesmlfcxformsdata xsmiles 12 api doc'

distance = 1320
spam score = 50
title = 'uses of class fihuttmlxsmilesguicomponentsfocusmanagerfocuspoint xsmiles 12 api doc'

distance = 1336
spam score = 82
title = 'fihuttmlxsmilesguicomponents xsmiles 12 api doc'

distance = 1338
spam score = 69
title = 'fihuttmlxsmilesguicomponents xsmiles 12 api doc'

distance = 1347
spam score = 62
title = 'fihuttmlxsmilesguicomponentsswing xsmiles 12 api doc'

distance = 1351
spam score = 77
title = 'fihuttmlxsmilesguicomponentsswing xsmiles 12 api doc'

distance = 189
spam score = 53
title = 'uses of package weblogicsecurityauth weblogic server 103 api reference'

distance = 189
spam score = 55
title = 'uses of package weblogicservletsecurity weblogic server 103 api reference'

distance = 191
spam score = 53
title = 'uses of package weblogicservletannotation weblogic server 103 api reference'

distance = 191
spam score = 53
title = 'uses of package weblogicmanagementtimer weblogic server 103 api reference'

distance = 191
spam score = 51
title = 'uses of package weblogicservletlogging weblogic server 103 api reference'

distance = 193
spam score = 53
title = 'uses of package weblogicsecurityprovider weblogic server 103 api reference'

distance = 205
spam score = 51
title = 'uses of package weblogicmanagementlogging weblogic server 103 api reference'

distance = 209
spam score = 53
title = 'uses of package weblogicrmiregistry weblogic server 103 api reference'

distance = 210
spam score = 52
title = 'weblogici18n class hierarchy weblogic server 103 api reference'

distance = 216
spam score = 49
title = 'uses of class weblogicmanagementattributeaddnotification weblogic server 103 api reference'

distance = 217
spam score = 48
title = 'uses of package weblogicjdbcextensions weblogic server 103 api reference'

distance = 220
spam score = 52
title = 'uses of class weblogicrmialreadyboundexception weblogic server 103 api reference'

distance = 220
spam score = 50
title = 'uses of class weblogicapplicationapplicationlifecyclelistener weblogic server 103 api reference'

distance = 221
spam score = 49
title = 'uses of class weblogicapplicationapplicationversionlifecyclelistener weblogic server 103 api reference'

distance = 222
spam score = 50
title = 'uses of class weblogicmanagementattributeremovenotification weblogic server 103 api reference'

distance = 222
spam score = 53
title = 'uses of class weblogicjwsasyncresponse weblogic server 103 api reference'

distance = 224
spam score = 52
title = 'uses of class weblogicrmiaccessexception weblogic server 103 api reference'

distance = 227
spam score = 49
title = 'uses of class weblogicmanagementtimertimer weblogic server 103 api reference'

distance = 227
spam score = 55
title = 'uses of package weblogicjwssoap weblogic server 103 api reference'

distance = 228
spam score = 47
title = 'uses of class weblogicejbgenericentitybean weblogic server 103 api reference'

distance = 344
spam score = 53
title = 'uses of class weblogicmanagementsecurityauthenticationauthenticatorimpl weblogic server 103 api reference'

distance = 344
spam score = 49
title = 'uses of class weblogicmanagementsecuritypkkeystoreimpl weblogic server 103 api reference'

distance = 348
spam score = 48
title = 'uses of class weblogicmanagementsecurityauthenticationidentityasserterimpl weblogic server 103 api reference'

distance = 349
spam score = 48
title = 'uses of interface weblogicwseeasyncasyncsoapinvokestate weblogic server 103 api reference'

distance = 352
spam score = 49
title = 'uses of class weblogicmanagementsecurityauthorizationadjudicatorimpl weblogic server 103 api reference'

distance = 353
spam score = 50
title = 'uses of interface weblogicwtcjatmiappkey weblogic server 103 api reference'

distance = 355
spam score = 47
title = 'weblogicservletlogging class hierarchy weblogic server 103 api reference'

distance = 359
spam score = 47
title = 'uses of interface weblogicservletloggingcustomelflogger weblogic server 103 api reference'

distance = 359
spam score = 46
title = 'uses of interface weblogicrmiextensionsdisconnectmonitor weblogic server 103 api reference'

distance = 360
spam score = 46
title = 'uses of interface weblogicjdbcextensionsconnectionpoolfailovercallback weblogic server 103 api reference'

distance = 402
spam score = 51
title = 'uses of package weblogicdiagnosticswatch weblogic server 103 api reference'

distance = 404
spam score = 50
title = 'uses of class weblogicxjsptagsbeanparamtag weblogic server 103 api reference'

distance = 407
spam score = 46
title = 'uses of class weblogici18nloggingnoncataloglogger weblogic server 103 api reference'

distance = 415
spam score = 56
title = 'weblogicdeployapitools class hierarchy weblogic server 103 api reference'

distance = 418
spam score = 46
title = 'uses of interface commonjtimerstimermanager weblogic server 103 api reference'

distance = 421
spam score = 58
title = 'uses of package weblogicnethttp weblogic server 103 api reference'

distance = 425
spam score = 57
title = 'weblogicrmiregistry class hierarchy weblogic server 103 api reference'

distance = 426
spam score = 58
title = 'weblogici18n weblogic server 103 api reference'

distance = 438
spam score = 54
title = 'uses of interface weblogicjmsserversessionpoolfactory weblogic server 103 api reference'

distance = 439
spam score = 55
title = 'uses of package weblogicrmiserver weblogic server 103 api reference'

distance = 500
spam score = 56
title = 'uses of interface weblogicxmlstreamlocation weblogic server 103 api reference'

distance = 501
spam score = 48
title = 'weblogicwseeconnectiontransporthttp weblogic server 103 api reference'

distance = 501
spam score = 48
title = 'weblogicdeployapimodel class hierarchy weblogic server 103 api reference'

distance = 507
spam score = 54
title = 'weblogicuddiclientservice class hierarchy weblogic server 103 api reference'

distance = 508
spam score = 48
title = 'uses of class weblogictimecommontrigger weblogic server 103 api reference'

distance = 508
spam score = 41
title = 'weblogici18n weblogic server 103 api reference'

distance = 508
spam score = 56
title = 'weblogicmanagementlogging class hierarchy weblogic server 103 api reference'

distance = 511
spam score = 60
title = 'weblogicrmiregistry weblogic server 103 api reference'

distance = 515
spam score = 48
title = 'uses of class weblogicloggingwllevel weblogic server 103 api reference'

distance = 519
spam score = 46
title = 'uses of interface weblogicxmlstreamenddocument weblogic server 103 api reference'

distance = 573
spam score = 57
title = 'uses of package weblogicuddiclientstructuresexception weblogic server 103 api reference'

distance = 578
spam score = 54
title = 'uses of class weblogicxmlsecurityspecsentitydescriptor weblogic server 103 api reference'

distance = 580
spam score = 56
title = 'uses of interface weblogicwebservicecontextwebservicesession weblogic server 103 api reference'

distance = 583
spam score = 68
title = 'weblogici18nlogging weblogic server 103 api reference'

distance = 584
spam score = 47
title = 'weblogicwseejwswlw weblogic server 103 api reference'

distance = 585
spam score = 54
title = 'uses of interface commonjworkworkmanager weblogic server 103 api reference'

distance = 585
spam score = 60
title = 'uses of package weblogictimecommon weblogic server 103 api reference'

distance = 587
spam score = 62
title = 'weblogicmanagementscriptingutils weblogic server 103 api reference'

distance = 590
spam score = 56
title = 'uses of class weblogicuddiclientstructuresdatatypesaddress weblogic server 103 api reference'

distance = 591
spam score = 64
title = 'uses of package weblogicdeployapitools weblogic server 103 api reference'

distance = 631
spam score = 69
title = 'weblogicmanagementlogging weblogic server 103 api reference'

distance = 636
spam score = 58
title = 'weblogicuddiclientstructuresexception class hierarchy weblogic server 103 api reference'

distance = 637
spam score = 67
title = 'weblogictimecommon class hierarchy weblogic server 103 api reference'

distance = 640
spam score = 50
title = 'uses of class weblogicwebserviceasyncinvokecompletedevent weblogic server 103 api reference'

distance = 645
spam score = 41
title = 'combealogging weblogic server 103 api reference'

distance = 649
spam score = 43
title = 'weblogici18nlogging weblogic server 103 api reference'

distance = 650
spam score = 54
title = 'uses of class weblogicxmlsecurityspecsspecbase weblogic server 103 api reference'

distance = 654
spam score = 46
title = 'weblogicwseejwswlw class hierarchy weblogic server 103 api reference'

distance = 656
spam score = 63
title = 'weblogicwebserviceasync class hierarchy weblogic server 103 api reference'

distance = 661
spam score = 69
title = 'weblogicuddiclientservice weblogic server 103 api reference'

distance = 719
spam score = 57
title = 'weblogicmanagementtimer class hierarchy weblogic server 103 api reference'

distance = 720
spam score = 53
title = 'uses of class weblogicwebserviceencodingattachmentcodec weblogic server 103 api reference'

distance = 721
spam score = 48
title = 'weblogicuddiclientservice weblogic server 103 api reference'

distance = 731
spam score = 58
title = 'uses of package weblogicwebservicecontext weblogic server 103 api reference'

distance = 731
spam score = 49
title = 'uses of class weblogicdiagnosticscontextinvaliddyeexception weblogic server 103 api reference'

distance = 736
spam score = 39
title = 'weblogiccachefilter weblogic server 103 api reference'

distance = 739
spam score = 57
title = 'weblogicuddiclientstructuresresponse class hierarchy weblogic server 103 api reference'

distance = 740
spam score = 44
title = 'combeaconsolehandles class hierarchy weblogic server 103 administration console api reference'

distance = 747
spam score = 48
title = 'combeaconsolehandles weblogic server 103 administration console api reference'

distance = 748
spam score = 61
title = 'uses of class weblogicwebserviceencodingabstractcodec weblogic server 103 api reference'

distance = 808
spam score = 66
title = 'explicitlycontrolled weblogic server 103 api reference'

distance = 810
spam score = 49
title = 'uses of interface weblogicxmlstreamstartdocument weblogic server 103 api reference'

distance = 810
spam score = 50
title = 'uses of interface weblogicworkareaprimitiveworkcontext weblogic server 103 api reference'

distance = 818
spam score = 47
title = 'forcedotnetcompatiblebinding weblogic server 103 api reference'

distance = 822
spam score = 65
title = 'weblogicjms weblogic server 103 api reference'

distance = 835
spam score = 49
title = 'weblogicxmlcryptowss class hierarchy weblogic server 103 api reference'

distance = 836
spam score = 47
title = 'context weblogic server 103 api reference'

distance = 839
spam score = 46
title = 'uses of interface weblogicxmlstreamendelement weblogic server 103 api reference'

distance = 843
spam score = 45
title = 'commonjwork class hierarchy weblogic server 103 api reference'

distance = 848
spam score = 48
title = 'wltimer weblogic server 103 api reference'

distance = 913
spam score = 45
title = 'weblogicmanagementdeploy weblogic server 103 api reference'

distance = 923
spam score = 49
title = 'weblogicjndi class hierarchy weblogic server 103 api reference'

distance = 925
spam score = 53
title = 'usewlw81bindingtypes weblogic server 103 api reference'

distance = 931
spam score = 60
title = 'weblogicxmlstreamutil class hierarchy weblogic server 103 api reference'

distance = 932
spam score = 64
title = 'weblogicapachexmlserialize class hierarchy weblogic server 103 api reference'

distance = 937
spam score = 60
title = 'weblogicrmi class hierarchy weblogic server 103 api reference'

distance = 940
spam score = 46
title = 'uses of class weblogicservlethttprequestresponsekey weblogic server 103 api reference'

distance = 955
spam score = 60
title = 'deprecated list weblogic server 103 administration console api reference'

distance = 961
spam score = 50
title = 'uses of interface weblogicjdbcrowsetsortedrowset weblogic server 103 api reference'

distance = 965
spam score = 50
title = 'uses of interface weblogicjdbcrowsetwlcachedrowset weblogic server 103 api reference'

distance = 1296
spam score = 50
title = 'weblogicuddiclientstructuresresponse weblogic server 103 api reference'

distance = 1334
spam score = 60
title = 'uses of package weblogicuddiclientstructuresresponse weblogic server 103 api reference'

distance = 1395
spam score = 44
title = 'uses of interface commonjtimerstimer weblogic server 103 api reference'

distance = 1401
spam score = 46
title = 'uses of class weblogicuddiclientstructuresdatatypestextnode weblogic server 103 api reference'

distance = 1402
spam score = 49
title = 'uses of class weblogicuddiclientstructuresresponsedispositionreport weblogic server 103 api reference'

distance = 254
spam score = 70
title = 'failedloginexception java 2 platform se 50'

distance = 258
spam score = 70
title = 'failedloginexception java 2 platform se 50'

distance = 266
spam score = 70
title = 'failedloginexception java 2 platform se 50'

distance = 279
spam score = 73
title = 'accountexception java 2 platform se 50'

distance = 286
spam score = 78
title = 'accountexception java 2 platform se 50'

distance = 288
spam score = 61
title = 'accountexception java 2 platform se 50'

distance = 290
spam score = 70
title = 'accountexception java 2 platform se 50'

distance = 290
spam score = 69
title = 'failedloginexception java 2 platform se v142'

distance = 290
spam score = 68
title = 'failedloginexception java 2 platform se v142'

distance = 292
spam score = 70
title = 'failedloginexception java 2 platform se v142'

distance = 292
spam score = 66
title = 'failedloginexception java 2 platform se v141'

distance = 304
spam score = 70
title = 'accountexception java 2 platform se 50'

distance = 306
spam score = 72
title = 'failedloginexception java 2 platform se v142'

distance = 308
spam score = 67
title = 'credentialexception java 2 platform se 50'

distance = 310
spam score = 66
title = 'accountexception java platform se 6'

distance = 313
spam score = 74
title = 'accountexpiredexception java 2 platform se 50'

distance = 313
spam score = 75
title = 'accountexpiredexception java 2 platform se v142'

distance = 314
spam score = 74
title = 'accountexpiredexception java 2 platform se 50'

distance = 315
spam score = 64
title = 'accountexpiredexception java 2 platform se v142'

distance = 317
spam score = 68
title = 'accountnotfoundexception java 2 platform se 50'

distance = 319
spam score = 63
title = 'accountexpiredexception java 2 platform se v142'

distance = 319
spam score = 78
title = 'accountexpiredexception java 2 platform se v142'

distance = 319
spam score = 74
title = 'accountexpiredexception java 2 platform se 50'

distance = 319
spam score = 71
title = 'accountlockedexception java 2 platform se 50'

distance = 320
spam score = 78
title = 'accountnotfoundexception java 2 platform se 50'

distance = 320
spam score = 62
title = 'accountexpiredexception java 2 platform se 50'

distance = 321
spam score = 71
title = 'accountexpiredexception java 2 platform se v142'

distance = 322
spam score = 65
title = 'accountnotfoundexception java 2 platform se 50'

distance = 323
spam score = 67
title = 'accountexpiredexception java 2 platform se v141'

distance = 328
spam score = 58
title = 'accountexpiredexception java 2 platform se v141'

distance = 330
spam score = 73
title = 'accountlockedexception java 2 platform se 50'

distance = 331
spam score = 57
title = 'accountexpiredexception java 2 platform se v141'

distance = 332
spam score = 64
title = 'credentialexpiredexception java 2 platform se v142'

distance = 334
spam score = 69
title = 'credentialnotfoundexception java 2 platform se 50'

distance = 334
spam score = 68
title = 'credentialexpiredexception java 2 platform se v142'

distance = 336
spam score = 56
title = 'accountexpiredexception java 2 platform se v142'

distance = 337
spam score = 63
title = 'credentialnotfoundexception java 2 platform se 50'

distance = 338
spam score = 73
title = 'accountnotfoundexception java 2 platform se 50'

distance = 338
spam score = 56
title = 'credentialexception java platform se 6'

distance = 338
spam score = 72
title = 'accountexpiredexception java platform se 6'

distance = 341
spam score = 57
title = 'credentialexception java 2 platform se 50'

distance = 341
spam score = 62
title = 'credentialexpiredexception java 2 platform se v141'

distance = 342
spam score = 69
title = 'accountlockedexception java 2 platform se 50'

distance = 342
spam score = 70
title = 'failedloginexception java 2 platform se v142'

distance = 343
spam score = 78
title = 'credentialexpiredexception java 2 platform se v142'

distance = 344
spam score = 64
title = 'credentialexpiredexception java 2 platform se 50'

distance = 344
spam score = 64
title = 'credentialexception java 2 platform se 50'

distance = 345
spam score = 68
title = 'credentialexpiredexception java 2 platform se v142'

distance = 346
spam score = 67
title = 'credentialexpiredexception java 2 platform se 50'

distance = 346
spam score = 68
title = 'loginexception java 2 platform se 50'

distance = 350
spam score = 72
title = 'loginexception java 2 platform se 50'

distance = 350
spam score = 61
title = 'accountexpiredexception java 2 platform se v142'

distance = 352
spam score = 70
title = 'accountlockedexception java 2 platform se 50'

distance = 354
spam score = 65
title = 'accountlockedexception java platform se 6'

distance = 357
spam score = 64
title = 'credentialnotfoundexception java 2 platform se 50'

distance = 357
spam score = 57
title = 'accountexpiredexception java 2 platform se v142'

distance = 358
spam score = 77
title = 'accountexpiredexception java platform se 6'

distance = 359
spam score = 57
title = 'accountnotfoundexception java 2 platform se 50'

distance = 360
spam score = 66
title = 'accountnotfoundexception java platform se 6'

distance = 360
spam score = 64
title = 'credentialexpiredexception java 2 platform se 50'

distance = 361
spam score = 60
title = 'credentialexpiredexception java 2 platform se 50'

distance = 370
spam score = 63
title = 'accountexpiredexception java 2 platform se 50'

distance = 372
spam score = 66
title = 'credentialexpiredexception java 2 platform se 50'

distance = 374
spam score = 79
title = 'accountlockedexception java platform se 6'

distance = 374
spam score = 66
title = 'credentialnotfoundexception java 2 platform se 50'

distance = 381
spam score = 68
title = 'loginexception java platform se 6'

distance = 383
spam score = 67
title = 'credentialexpiredexception java 2 platform se v142'

distance = 416
spam score = 58
title = 'loginexception java 2 platform se 50'

distance = 475
spam score = 63
title = 'java 2 platform ee v13 class failedloginexception'

distance = 475
spam score = 64
title = 'java 2 platform ee v13 class failedloginexception'

distance = 514
spam score = 55
title = 'java 2 platform ee v13 class accountexpiredexception'

distance = 523
spam score = 61
title = 'java 2 platform ee v13 class credentialexpiredexception'

distance = 532
spam score = 67
title = 'java 2 platform ee v13 class accountexpiredexception'

distance = 546
spam score = 69
title = 'java 2 platform ee v13 class credentialexpiredexception'

distance = 558
spam score = 84
title = 'failedloginexception java authentication and authorization service v20'

distance = 563
spam score = 58
title = 'java 2 platform ee v13 class loginexception'

distance = 571
spam score = 55
title = 'failedloginexception'

distance = 571
spam score = 48
title = 'failedloginexception'

distance = 578
spam score = 66
title = 'java 2 platform ee v13 class loginexception'

distance = 580
spam score = 58
title = 'java 2 platform ee v13 class loginexception'

distance = 586
spam score = 11
title = 'java 2 platform ee v13 class credentialexpiredexception java platform enterprise edition v131 api specifications java c'

distance = 604
spam score = 80
title = 'credentialexception java authentication and authorization service v20'

distance = 606
spam score = 48
title = 'accountexpiredexception'

distance = 611
spam score = 81
title = 'credentialexpiredexception java authentication and authorization service v20'

distance = 611
spam score = 43
title = 'accountexpiredexception'

distance = 619
spam score = 79
title = 'accountnotfoundexception java authentication and authorization service v20'

distance = 638
spam score = 11
title = 'java 2 platform ee v13 class loginexception java platform enterprise edition v131 api specifications java c'

distance = 645
spam score = 53
title = 'credentialexpiredexception'

distance = 1120
spam score = 54
title = 'accountexception gnu classpath 095 documentation'

distance = 1137
spam score = 54
title = 'accountexpiredexception gnu classpath 095 documentation'

distance = 1144
spam score = 54
title = 'accountlockedexception gnu classpath 095 documentation'

distance = 1157
spam score = 56
title = 'credentialnotfoundexception gnu classpath 095 documentation'

distance = 1164
spam score = 56
title = 'credentialexception gnu classpath 095 documentation'

distance = 1229
spam score = 74
title = 'appconfigurationentry java 2 platform se 50'

distance = 1232
spam score = 84
title = 'configfile java authentication and authorization service v20'

distance = 1232
spam score = 80
title = 'configfile java authentication and authorization service v20'

distance = 1234
spam score = 90
title = 'configfile java authentication and authorization service v20'

distance = 1239
spam score = 74
title = 'appconfigurationentry java 2 platform se 50'

distance = 1252
spam score = 78
title = 'configfile java authentication and authorization service'

distance = 1270
spam score = 75
title = 'java 2 platform ee v13 class appconfigurationentry'

distance = 1274
spam score = 59
title = 'appconfigurationentry'

distance = 1276
spam score = 22
title = 'configfile java authentication and authorization service jdk 5 documentation v60 java 2 sdk java c'

distance = 1277
spam score = 71
title = 'java 2 platform ee v13 class appconfigurationentry'

distance = 1318
spam score = 58
title = 'loginmodulemanager oracle containers for j2ee security java api reference'

distance = 1353
spam score = 61
title = 'filecachereader'

distance = 1356
spam score = 48
title = 'loginmodulemanager oracle application server jaas provider api reference'

distance = 1498
spam score = 34
title = 'loginmodulemanager jaas provider java api reference'

distance = 1847
spam score = 2
title = 'balconyconstruction balcony construction'

distance = 253
spam score = 66
title = 'when'

distance = 299
spam score = 70
title = 'orientation'

distance = 311
spam score = 81
title = 'direction'

distance = 312
spam score = 66
title = 'paranthesis'

distance = 342
spam score = 63
title = 'conditiontype'

distance = 346
spam score = 68
title = 'type'

distance = 352
spam score = 65
title = 'programdelimiter'

distance = 356
spam score = 65
title = 'horizontaljustification'

distance = 360
spam score = 64
title = 'transformdirection'

distance = 361
spam score = 68
title = 'types'

distance = 363
spam score = 83
title = 'constantpooltranslationmode'

distance = 367
spam score = 68
title = 'dispatchertype resin 40s090128'

distance = 368
spam score = 63
title = 'depictionorientation'

distance = 369
spam score = 74
title = 'transactionmanagementtype cuba api documentation'

distance = 372
spam score = 69
title = 'indextype mentawai'

distance = 375
spam score = 67
title = 'expressionbuildertypes'

distance = 375
spam score = 68
title = 'fingerprintoperation'

distance = 380
spam score = 58
title = 'messagemessagetype'

distance = 382
spam score = 67
title = 'when findbugs 137 api'

distance = 383
spam score = 73
title = 'debugstate'

distance = 516
spam score = 75
title = 'sparqlqueryconstantsengine allegrographnbsp31nbspjavanbspinterface compatible with 301 and earlier'

distance = 518
spam score = 71
title = 'backgroundrepeat thinwire ria ajax framework api v12rc2'

distance = 518
spam score = 72
title = 'backgroundrepeat thinwire ria ajax framework api v12rc2'

distance = 518
spam score = 63
title = 'customfielddateformat itracker 300 api'

distance = 518
spam score = 74
title = 'foreignkeyaction jdo2 api 21'

distance = 519
spam score = 61
title = 'stylehorizontalalignment gxt api 122'

distance = 519
spam score = 74
title = 'jointype metamodel 113 api'

distance = 519
spam score = 64
title = 'registryregistryrootkey'

distance = 519
spam score = 61
title = 'styleorientation gxt api 122'

distance = 521
spam score = 76
title = 'persistencemodifier jdo2 api 21'

distance = 548
spam score = 86
title = 'looptoolaction velocitytools 20snapshot documentation'

distance = 548
spam score = 62
title = 'treechecknodes gxt api 123'

distance = 549
spam score = 68
title = 'colormode abeel java toolkit ajt 117'

distance = 549
spam score = 61
title = 'browserinterfacetypes xj3d 20 code library'

distance = 550
spam score = 67
title = 'multipleregexfilenamefiltermatchtype clapperorg utility api'

distance = 550
spam score = 62
title = 'soapbindinguse java platform se 6'

distance = 551
spam score = 67
title = 'atomiccoordinatesformat'

distance = 551
spam score = 70
title = 'rsdynamicclienthttpmethod'

distance = 551
spam score = 68
title = 'rftechnology hal 051snapshot api'

distance = 552
spam score = 69
title = 'associationtype java persistence objects'

distance = 577
spam score = 65
title = 'buffersetscope jedit api'

distance = 578
spam score = 87
title = 'platyconstunit platypus code'

distance = 578
spam score = 69
title = 'webparammode java platform se 6'

distance = 579
spam score = 76
title = 'authenticationtype epcis 043snapshot api'

distance = 579
spam score = 66
title = 'eventmanagernodeselectionorigin sonivis tool api specification'

distance = 579
spam score = 62
title = 'formsubmiteventmethodtype java platform se 7 b47'

distance = 579
spam score = 55
title = 'webparammode java platform se 6'

distance = 580
spam score = 67
title = 'deactivationoptions aqualogic data services platform api'

distance = 581
spam score = 72
title = 'createmodalmode'

distance = 581
spam score = 55
title = 'webparammode java platform se 6'

distance = 610
spam score = 69
title = 'authenticationserviceauthmechanism'

distance = 610
spam score = 60
title = 'stylescroll gxt api 122'

distance = 610
spam score = 55
title = 'soapbindingparameterstyle java platform se 6'

distance = 610
spam score = 57
title = 'processbuilderredirecttype java platform se 7 b48'

distance = 611
spam score = 62
title = 'soapbindingparameterstyle java platform se 6'

distance = 611
spam score = 71
title = 'requestruntimetarget aqualogic data services platform api'

distance = 611
spam score = 66
title = 'graphattrtype pantheontools'

distance = 611
spam score = 64
title = 'soapbindingparameterstyle java platform se 6'

distance = 612
spam score = 55
title = 'ittrackkind'

distance = 612
spam score = 69
title = 'acknowledgementmode jboss ejb 30 api documentation'

distance = 650
spam score = 69
title = 'eventtype'

distance = 650
spam score = 60
title = 'cnpjconstraintsrotina stella core 11 api'

distance = 651
spam score = 71
title = 'simplecommands'

distance = 652
spam score = 73
title = 'treevizfilesystemxmlnodeinfoattributetype treeviz 016 20081216'

distance = 653
spam score = 67
title = 'applicationtrustmanagercause opends directory server api documentation'

distance = 653
spam score = 64
title = 'cnpjerror stella core 12 api'

distance = 654
spam score = 67
title = 'storetype java memcached client'

distance = 654
spam score = 62
title = 'messageboxmessageboxtype gxt api 122'

distance = 655
spam score = 67
title = 'applicationtrustmanagercause opends directory server api documentation'

distance = 655
spam score = 68
title = 'commkind czt jaxb 10 api'

distance = 693
spam score = 69
title = 'ieconstraintsrotina stella core 12 api'

distance = 694
spam score = 59
title = 'ieconstraintsrotina stella core 11 api'

distance = 694
spam score = 65
title = 'elementtype java 2 platform se 50'

distance = 695
spam score = 65
title = 'germanymarket jquantlib v012snapshot api javadocs'

distance = 695
spam score = 65
title = 'defaults unitils 20snapshot api'

distance = 696
spam score = 64
title = 'sourcesourcetype spring me core 10snapshot api'

distance = 696
spam score = 71
title = 'phonetype validation 14snapshot api'

distance = 698
spam score = 63
title = 'autocolorcorrelogrammode lire api'

distance = 698
spam score = 48
title = 'elementtype'

distance = 698
spam score = 73
title = 'jwildcardtypeboundtype google web toolkit javadoc'

distance = 753
spam score = 65
title = 'logginglevel middleheaven 001snapshot api'

distance = 754
spam score = 66
title = 'referencetype jodd'

distance = 755
spam score = 63
title = 'syntaxexceptionreason'

distance = 755
spam score = 75
title = 'retentionpolicy java 2 platform se 50'

distance = 755
spam score = 59
title = 'metrictype sonivis tool api specification'

distance = 755
spam score = 60
title = 'imagetype seam jsf controls 200ga api'

distance = 756
spam score = 59
title = 'imagetype seam jsf controls 202sp1 api'

distance = 757
spam score = 76
title = 'mediacontentexpression google data apis client library'

distance = 760
spam score = 64
title = 'attributekeyswindingrule jhotdraw 71'

distance = 760
spam score = 58
title = 'enetworktype sonivis tool api specification'

distance = 847
spam score = 86
title = 'nestingkind java platform se 6'

distance = 847
spam score = 85
title = 'timeunit jquantlib v012snapshot api javadocs'

distance = 848
spam score = 78
title = 'topologycacheexceptiontype opends directory server api documentation'

distance = 851
spam score = 59
title = 'imagecomponentimageclass java 3d 151'

distance = 852
spam score = 71
title = 'adtowerinternallayout dhd multimedia gallery v15055 javadoc'

distance = 854
spam score = 65
title = 'nestingkind java platform se 6'

distance = 854
spam score = 72
title = 'nestingkind java platform se 6'

distance = 855
spam score = 71
title = 'nestingkind java platform se 6'

distance = 856
spam score = 77
title = 'blendop'

distance = 857
spam score = 63
title = 'nestingkind java platform se 7 b47'

distance = 1101
spam score = 60
title = 'dialogmodalitytype java platform se 6'

distance = 1104
spam score = 68
title = 'requesttype lobo 0984 java browser clientlet and extensions api documentation'

distance = 1110
spam score = 57
title = 'marketlistingsubcategory facebook java library 18final api'

distance = 1119
spam score = 67
title = 'periodcountbasis'

distance = 1139
spam score = 52
title = 'firstlastgroupfirstlastpattern'

distance = 1400
spam score = 55
title = 'uses of class systemciancianmode'

distance = 1448
spam score = 65
title = 'uses of class communicationcommunicationtype'

distance = 1607
spam score = 81
title = 'javafx 10 api javafxanimationkeyvaluetargettype java fx'

distance = 1639
spam score = 29
title = 'glow reference'

distance = 243
spam score = 66
title = 'java java se ee me javax activation mimetypeparseexception java api by example from geeks to geeks'

distance = 250
spam score = 62
title = 'java java se ee me javax ejb removeexception java api by example from geeks to geeks'

distance = 255
spam score = 74
title = 'java java se ee me javax transaction heuristiccommitexception java api by example from geeks to geeks'

distance = 258
spam score = 68
title = 'java java se ee me javax crypto shortbufferexception java api by example from geeks to geeks'

distance = 259
spam score = 62
title = 'java java se ee me javax crypto exemptionmechanismexception java api by example from geeks to geeks'

distance = 262
spam score = 76
title = 'java java se ee me javax transaction rollbackexception java api by example from geeks to geeks'

distance = 266
spam score = 67
title = 'java java se ee me java lang nosuchmethodexception java api by example from geeks to geeks'

distance = 267
spam score = 70
title = 'java java se ee me javax crypto nosuchpaddingexception java api by example from geeks to geeks'

distance = 267
spam score = 73
title = 'java java se ee me javax print printexception java api by example from geeks to geeks'

distance = 269
spam score = 63
title = 'java java se ee me javax transaction heuristicmixedexception java api by example from geeks to geeks'

distance = 270
spam score = 62
title = 'java java se ee me javax naming partialresultexception java api by example from geeks to geeks'

distance = 271
spam score = 64
title = 'java java se ee me javax management notcompliantmbeanexception java api by example from geeks to geeks'

distance = 271
spam score = 75
title = 'java java se ee me javax transaction heuristicrollbackexception java api by example from geeks to geeks'

distance = 275
spam score = 70
title = 'java java se ee me java lang nosuchfieldexception java api by example from geeks to geeks'

distance = 278
spam score = 67
title = 'java java se ee me javax mail methodnotsupportedexception java api by example from geeks to geeks'

distance = 282
spam score = 66
title = 'java java se ee me javax naming sizelimitexceededexception java api by example from geeks to geeks'

distance = 286
spam score = 65
title = 'java java se ee me java lang unknownerror java api by example from geeks to geeks'

distance = 287
spam score = 63
title = 'java java se ee me javax ejb nosuchentityexception java api by example from geeks to geeks'

distance = 287
spam score = 64
title = 'java java se ee me javax management attributenotfoundexception java api by example from geeks to geeks'

distance = 288
spam score = 62
title = 'java java se ee me javax management mbeanregistrationexception java api by example from geeks to geeks'

distance = 424
spam score = 63
title = 'java java se ee me javax xml rpc holders booleanholder java api by example from geeks to geeks'

distance = 424
spam score = 67
title = 'java java se ee me javax servlet jsp jspengineinfo java api by example from geeks to geeks'

distance = 424
spam score = 63
title = 'java java se ee me javax telephony phone phonebutton java api by example from geeks to geeks'

distance = 425
spam score = 64
title = 'java java se ee me java util jar jarexception java api by example from geeks to geeks'

distance = 426
spam score = 66
title = 'java java se ee me javax xml registry invalidrequestexception java api by example from geeks to geeks'

distance = 427
spam score = 62
title = 'java java se ee me javax xml datatype datatypeconfigurationexception java api by example from geeks to geeks'

distance = 427
spam score = 60
title = 'java java se ee me javax mail search searchterm java api by example from geeks to geeks'

distance = 428
spam score = 70
title = 'java java se ee me javax tv carousel carouselfilechangeevent java api by example from geeks to geeks'

distance = 429
spam score = 63
title = 'java java se ee me javax management queryeval java api by example from geeks to geeks'

distance = 429
spam score = 61
title = 'java java se ee me javax xml parsers factoryconfigurationerror java api by example from geeks to geeks'

distance = 488
spam score = 66
title = 'java java se ee me javax mail search andterm java api by example from geeks to geeks'

distance = 490
spam score = 67
title = 'java java se ee me java security keystoreexception java api by example from geeks to geeks'

distance = 490
spam score = 64
title = 'java java se ee me java security acl permission java api by example from geeks to geeks'

distance = 490
spam score = 66
title = 'java java se ee me javax activation mimetypesfiletypemap java api by example from geeks to geeks'

distance = 490
spam score = 64
title = 'java java se ee me javax swing event treeexpansionevent java api by example from geeks to geeks'

distance = 491
spam score = 66
title = 'java java se ee me javax security auth destroyable java api by example from geeks to geeks'

distance = 491
spam score = 63
title = 'java java se ee me javax print docflavorreader java api by example from geeks to geeks'

distance = 492
spam score = 71
title = 'java java se ee me java security providerexception java api by example from geeks to geeks'

distance = 492
spam score = 65
title = 'java java se ee me java awt imagecapabilities java api by example from geeks to geeks'

distance = 493
spam score = 66
title = 'java java se ee me javax crypto spec psourcepspecified java api by example from geeks to geeks'

distance = 533
spam score = 68
title = 'java java se ee me org omg dynamicany namedynanypair java api by example from geeks to geeks'

distance = 533
spam score = 63
title = 'java java se ee me javax net ssl certpathtrustmanagerparameters java api by example from geeks to geeks'

distance = 534
spam score = 65
title = 'java java se ee me javax microedition media control framepositioningcontrol java api by example from geeks to geeks'

distance = 534
spam score = 70
title = 'java java se ee me org omg corba namevaluepair java api by example from geeks to geeks'

distance = 535
spam score = 64
title = 'java java se ee me javax swing inputverifier java api by example from geeks to geeks'

distance = 535
spam score = 65
title = 'java java se ee me javax management attributevalueexp java api by example from geeks to geeks'

distance = 536
spam score = 65
title = 'java java se ee me javax print attribute hashprintserviceattributeset java api by example from geeks to geeks'

distance = 536
spam score = 68
title = 'java java se ee me java security keystoretrustedcertificateentry java api by example from geeks to geeks'

distance = 537
spam score = 60
title = 'java java se ee me javax microedition io outputconnection java api by example from geeks to geeks'

distance = 537
spam score = 64
title = 'java java se ee me javax swing plaf optionpaneui java api by example from geeks to geeks'

distance = 575
spam score = 64
title = 'java java se ee me javax naming ldap sortcontrol java api by example from geeks to geeks'

distance = 576
spam score = 67
title = 'java java se ee me javax swing boxaccessiblebox java api by example from geeks to geeks'

distance = 576
spam score = 61
title = 'java java se ee me java nio channels asynchronouscloseexception java api by example from geeks to geeks'

distance = 576
spam score = 69
title = 'java java se ee me javax swing event celleditorlistener java api by example from geeks to geeks'

distance = 577
spam score = 63
title = 'java java se ee me javax crypto spec oaepparameterspec java api by example from geeks to geeks'

distance = 578
spam score = 70
title = 'java java se ee me java awt canvasaccessibleawtcanvas java api by example from geeks to geeks'

distance = 580
spam score = 72
title = 'java java se ee me java awt compositecontext java api by example from geeks to geeks'

distance = 580
spam score = 65
title = 'java java se ee me org omg iop taggedprofile java api by example from geeks to geeks'

distance = 580
spam score = 64
title = 'java java se ee me javax crypto interfaces dhkey java api by example from geeks to geeks'

distance = 582
spam score = 64
title = 'java java se ee me java rmi server servercloneexception java api by example from geeks to geeks'

distance = 623
spam score = 63
title = 'java java se ee me javax swing event tablemodellistener java api by example from geeks to geeks'

distance = 623
spam score = 65
title = 'java java se ee me javax telephony mobile networkselection java api by example from geeks to geeks'

distance = 624
spam score = 67
title = 'java java se ee me java awt popupmenuaccessibleawtpopupmenu java api by example from geeks to geeks'

distance = 624
spam score = 63
title = 'java java se ee me javax xml registry declarativequerymanager java api by example from geeks to geeks'

distance = 624
spam score = 65
title = 'java java se ee me javax swing boxfilleraccessibleboxfiller java api by example from geeks to geeks'

distance = 624
spam score = 67
title = 'java java se ee me javax swing plaf basic basictreeuicelleditorhandler java api by example from geeks to geeks'

distance = 625
spam score = 65
title = 'java java se ee me org omg corba objadapter java api by example from geeks to geeks'

distance = 625
spam score = 67
title = 'java java se ee me javax naming event namespacechangelistener java api by example from geeks to geeks'

distance = 625
spam score = 64
title = 'java java se ee me org omg corba intfrepos java api by example from geeks to geeks'

distance = 625
spam score = 65
title = 'java java se ee me org omg corba dataconversion java api by example from geeks to geeks'

distance = 669
spam score = 67
title = 'java java se ee me java awt event keyadapter java api by example from geeks to geeks'

distance = 669
spam score = 65
title = 'java java se ee me javax management openmbean openmbeanattributeinfo java api by example from geeks to geeks'

distance = 669
spam score = 64
title = 'java java se ee me javax net ssl sslsocketfactory java api by example from geeks to geeks'

distance = 669
spam score = 63
title = 'java java se ee me javax swing plaf basic basiccomboboxeditoruiresource java api by example from geeks to geeks'

distance = 670
spam score = 66
title = 'java java se ee me javax swing plaf basic basictreeuitreeincrementaction java api by example from geeks to geeks'

distance = 670
spam score = 66
title = 'java java se ee me javax swing plaf listui java api by example from geeks to geeks'

distance = 670
spam score = 63
title = 'java java se ee me java net contenthandler java api by example from geeks to geeks'

distance = 671
spam score = 66
title = 'java java se ee me org omg cosnaming namingcontextholder java api by example from geeks to geeks'

distance = 672
spam score = 62
title = 'java java se ee me javax servlet jsp tagext tagextrainfo java api by example from geeks to geeks'

distance = 672
spam score = 70
title = 'java java se ee me java lang reflect malformedparameterizedtypeexception java api by example from geeks to geeks'

distance = 732
spam score = 69
title = 'java java se ee me java io objectoutput java api by example from geeks to geeks'

distance = 738
spam score = 72
title = 'java java se ee me javax swing jcheckboxaccessiblejcheckbox java api by example from geeks to geeks'

distance = 738
spam score = 79
title = 'java java se ee me javacard framework userexception java api by example from geeks to geeks'

distance = 739
spam score = 66
title = 'java java se ee me org omg portableserver servantretentionpolicyid java api by example from geeks to geeks'

distance = 741
spam score = 64
title = 'java java se ee me java rmi server remotecall java api by example from geeks to geeks'

distance = 741
spam score = 66
title = 'java java se ee me javax swing plaf basic basictreeuicomponenthandler java api by example from geeks to geeks'

distance = 742
spam score = 70
title = 'java java se ee me java security spec x509encodedkeyspec java api by example from geeks to geeks'

distance = 742
spam score = 62
title = 'java java se ee me javax crypto sealedobject java api by example from geeks to geeks'

distance = 744
spam score = 66
title = 'java java se ee me org omg portableinterceptor forwardrequesthelper java api by example from geeks to geeks'

distance = 744
spam score = 71
title = 'java java se ee me java lang threaduncaughtexceptionhandler java api by example from geeks to geeks'

distance = 905
spam score = 51
title = 'java java se ee me javax naming java api by example from geeks to geeks'

distance = 905
spam score = 68
title = 'java java se ee me java awt geom quadcurve2dfloat java api by example from geeks to geeks'

distance = 906
spam score = 65
title = 'java java se ee me javax jms temporaryqueue java api by example from geeks to geeks'

distance = 908
spam score = 71
title = 'java java se ee me javax tv service simanager java api by example from geeks to geeks'

distance = 909
spam score = 75
title = 'java java se ee me javax ejb timedobject java api by example from geeks to geeks'

distance = 912
spam score = 70
title = 'java open source codes java lang deprecated java api by example from geeks to geeks'

distance = 915
spam score = 67
title = 'java java se ee me javax swing text keymap java api by example from geeks to geeks'

distance = 917
spam score = 52
title = 'java open source codes java lang abstractmethoderror java api by example from geeks to geeks'

distance = 923
spam score = 64
title = 'java java se ee me java util concurrent scheduledexecutorservice java api by example from geeks to geeks'

distance = 923
spam score = 67
title = 'java java se ee me java net unknownhostexception java api by example from geeks to geeks'

distance = 1570
spam score = 72
title = 'java open source codes org objectweb cjdbc console gui frames guiselectshutdownframe java api by example from geeks to geeks'

distance = 1575
spam score = 52
title = 'java open source codes org objectstyle cayenne modeler dialog db dbgeneratoroptionsview java api by example from geeks to geeks'

distance = 1576
spam score = 55
title = 'java open source codes org springframework mail mailsendexception java api by example from geeks to geeks'

distance = 1619
spam score = 65
title = 'java open source codes org objectweb jac aspects integrity constraintwrapper java api by example from geeks to geeks'

distance = 1633
spam score = 71
title = 'java open source codes org objectweb openccm components ccmhomewithpkimpl java api by example from geeks to geeks'

distance = 1657
spam score = 58
title = 'java open source codes org springframework aop support methodmatcherstests java api by example from geeks to geeks'

distance = 1712
spam score = 57
title = 'java open source codes org objectweb jonas jonasadmin test domain fjonasadmindomain java api by example from geeks to geeks'

distance = 1904
spam score = 28
title = 'dblp manolis terrovitis'

distance = 281
spam score = 60
title = ''

distance = 281
spam score = 60
title = ''

distance = 308
spam score = 68
title = ''

distance = 341
spam score = 63
title = ''

distance = 353
spam score = 67
title = ''

distance = 353
spam score = 66
title = ''

distance = 365
spam score = 64
title = ''

distance = 374
spam score = 59
title = ''

distance = 376
spam score = 55
title = ''

distance = 379
spam score = 66
title = ''

distance = 389
spam score = 55
title = ''

distance = 391
spam score = 55
title = ''

distance = 397
spam score = 57
title = ''

distance = 404
spam score = 78
title = ''

distance = 409
spam score = 58
title = ''

distance = 410
spam score = 64
title = ''

distance = 430
spam score = 54
title = ''

distance = 433
spam score = 77
title = ''

distance = 437
spam score = 77
title = ''

distance = 438
spam score = 76
title = ''

distance = 466
spam score = 54
title = ''

distance = 482
spam score = 77
title = ''

distance = 490
spam score = 71
title = ''

distance = 491
spam score = 56
title = ''

distance = 491
spam score = 62
title = ''

distance = 492
spam score = 56
title = ''

distance = 515
spam score = 57
title = ''

distance = 524
spam score = 69
title = ''

distance = 551
spam score = 55
title = ''

distance = 565
spam score = 73
title = ''

distance = 574
spam score = 54
title = ''

distance = 632
spam score = 76
title = ''

distance = 678
spam score = 75
title = ''

distance = 680
spam score = 69
title = ''

distance = 697
spam score = 64
title = ''

distance = 701
spam score = 72
title = ''

distance = 715
spam score = 54
title = ''

distance = 732
spam score = 60
title = ''

distance = 786
spam score = 69
title = ''

distance = 814
spam score = 55
title = ''

distance = 821
spam score = 69
title = ''

distance = 849
spam score = 86
title = ''

distance = 856
spam score = 56
title = ''

distance = 888
spam score = 60
title = ''

distance = 1850
spam score = 7
title = ''

distance = 1893
spam score = 7
title = ''

distance = 169
spam score = 58
title = 'uses of package orgapachepoigenerator poi api documentation'

distance = 173
spam score = 59
title = 'uses of package orgapachepoidev poi api documentation'

distance = 184
spam score = 62
title = 'uses of class orgapachepoihssfdevhssf poi api documentation'

distance = 192
spam score = 61
title = 'uses of package orgapachepoiextractor poi api documentation'

distance = 204
spam score = 64
title = 'uses of package orgapachepoihslfexceptions poi api documentation'

distance = 205
spam score = 64
title = 'uses of package orgapachepoihssfdev poi api documentation'

distance = 208
spam score = 61
title = 'uses of package orgapachepoihssfextractor poi api documentation'

distance = 213
spam score = 60
title = 'uses of package orgapachepoihdgfexceptions poi api documentation'

distance = 231
spam score = 59
title = 'uses of class orgapachepoihssfrecordcalcmoderecord poi api documentation'

distance = 231
spam score = 66
title = 'uses of package orgapachepoihsmf poi api documentation'

distance = 233
spam score = 58
title = 'uses of class orgapachepoihssfrecordcalccountrecord poi api documentation'

distance = 237
spam score = 58
title = 'uses of class orgapachepoiutillist2d poi api documentation'

distance = 237
spam score = 60
title = 'uses of class orgapachepoidevooxmllister poi api documentation'

distance = 240
spam score = 56
title = 'uses of class orgapachepoihssfmodelrowblocksreader poi api documentation'

distance = 240
spam score = 57
title = 'uses of class orgapachepoihssfdevformulaviewer poi api documentation'

distance = 240
spam score = 58
title = 'uses of class orgapachepoihssfrecordboolerrrecord poi api documentation'

distance = 240
spam score = 54
title = 'uses of class orgapachepoihssfextractorexcelextractor poi api documentation'

distance = 241
spam score = 55
title = 'uses of class orgapachepoihssfmodelhssfformulaparser poi api documentation'

distance = 248
spam score = 64
title = 'uses of class orgapachepoidevrecordgenerator poi api documentation'

distance = 248
spam score = 57
title = 'uses of package orgapachepoihpsfextractor poi api documentation'

distance = 331
spam score = 57
title = 'uses of class orgapachepoipoifsstorageheaderblockwriter poi api documentation'

distance = 332
spam score = 55
title = 'uses of class orgapachepoissformulaformularenderer poi api documentation'

distance = 332
spam score = 54
title = 'uses of class orgapachepoihwpfsprmparagraphsprmuncompressor poi api documentation'

distance = 333
spam score = 55
title = 'uses of class orgapachepoihwpfmodelfibshorthandler poi api documentation'

distance = 333
spam score = 59
title = 'uses of package orgapachepoihsmfparsers poi api documentation'

distance = 334
spam score = 60
title = 'uses of class orgapachepoihssfrecordformulafunctionsgroup poi api documentation'

distance = 334
spam score = 57
title = 'uses of class orgapachepoicontribpoibrowserextendabletreecellrenderer poi api documentation'

distance = 335
spam score = 62
title = 'uses of class orgapachepoicontribmetricsfontmetricsdumper poi api documentation'

distance = 335
spam score = 58
title = 'uses of class orgapachepoihssfutilhssfcolorautomatic poi api documentation'

distance = 335
spam score = 54
title = 'uses of class orgapachepoihwpfsprmsectionsprmcompressor poi api documentation'

distance = 361
spam score = 57
title = 'uses of class orgapachepoihssfrecordformulafunctionscritbinom poi api documentation'

distance = 361
spam score = 60
title = 'uses of class orgapachepoihssfutilhssfcolortan poi api documentation'

distance = 361
spam score = 57
title = 'uses of class orgapachepoicontribpoibrowserpropertysetdescriptor poi api documentation'

distance = 361
spam score = 60
title = 'uses of class orgapachepoihssfeventusermodeldummyrecordmissingrowdummyrecord poi api documentation'

distance = 361
spam score = 57
title = 'uses of class orgapachepoipoifsfilesystemdocumentdescriptor poi api documentation'

distance = 362
spam score = 57
title = 'uses of class orgapachepoihssfrecordaggregatesmergedcellstable poi api documentation'

distance = 362
spam score = 56
title = 'uses of class orgapachepoissutilsheetreferences poi api documentation'

distance = 362
spam score = 61
title = 'uses of class orgapachepoixssfextractorxssfexcelextractor poi api documentation'

distance = 362
spam score = 57
title = 'uses of class orgapachepoihssfrecordformulafunctionsfiles poi api documentation'

distance = 363
spam score = 56
title = 'uses of class orgapachepoissusermodelshapetypes poi api documentation'

distance = 383
spam score = 59
title = 'uses of class orgapachepoihssfutilhssfcolorseagreen poi api documentation'

distance = 383
spam score = 70
title = 'orgapachepoihssfrecordformulaatp poi api documentation'

distance = 384
spam score = 56
title = 'uses of class orgapachepoihssfrecordformulafunctionscount poi api documentation'

distance = 384
spam score = 61
title = 'orgapachepoihsmf class hierarchy poi api documentation'

distance = 384
spam score = 59
title = 'uses of class orgapachepoihssfutilhssfcolorlightorange poi api documentation'

distance = 384
spam score = 57
title = 'uses of class orgapachepoihslfmodelshapepainter poi api documentation'

distance = 385
spam score = 56
title = 'uses of class orgapachepoihssfrecordaggregatesrecordaggregatepositiontrackingvisitor poi api documentation'

distance = 385
spam score = 53
title = 'uses of interface orgapachepoissusermodeltextbox poi api documentation'

distance = 386
spam score = 58
title = 'uses of class orgapachepoihssfutilhssfcolorgrey80percent poi api documentation'

distance = 386
spam score = 67
title = 'orgapachepoixslf poi api documentation'

distance = 458
spam score = 59
title = 'uses of class orgapachepoihwpfmodelffn poi api documentation'

distance = 460
spam score = 58
title = 'uses of class orgapachepoihwpfsprmsprmuncompressor poi api documentation'

distance = 461
spam score = 68
title = 'orgapachepoihssfextractor poi api documentation'

distance = 462
spam score = 63
title = 'uses of class orgapachepoihslfrecordanimationinfoatom poi api documentation'

distance = 464
spam score = 60
title = 'uses of class orgapachepoihpbfmodelqcbitsqctextbit poi api documentation'

distance = 464
spam score = 61
title = 'orgapachepoihpbfdev class hierarchy poi api documentation'

distance = 465
spam score = 69
title = 'orgapachepoicontribmetrics class hierarchy poi api documentation'

distance = 466
spam score = 61
title = 'uses of class orgapachepoihwpfmodeltypessepabstracttype poi api documentation'

distance = 466
spam score = 60
title = 'uses of class orgapachepoihssfutilhssfcolorlightcornflowerblue poi api documentation'

distance = 468
spam score = 57
title = 'uses of class orgapachepoihwpfmodeltypestapabstracttype poi api documentation'

distance = 545
spam score = 58
title = 'uses of class orgapachepoihdgfchunkschunkcommand poi api documentation'

distance = 545
spam score = 62
title = 'uses of class orgapachepoihdgfstreamspointercontainingstream poi api documentation'

distance = 546
spam score = 60
title = 'orgapachepoipoifsdev class hierarchy poi api documentation'

distance = 549
spam score = 52
title = 'uses of package orgapachepoihwpfsprm poi api documentation'

distance = 551
spam score = 60
title = 'orgapachepoihssfrecordcf class hierarchy poi api documentation'

distance = 552
spam score = 57
title = 'uses of interface orgapachepoixssfmodelxssfmodel poi api documentation'

distance = 552
spam score = 70
title = 'uses of class orgapachepoipoifsstorageblockallocationtablewriter poi api documentation'

distance = 553
spam score = 60
title = 'uses of class orgapachepoixssfusermodelhelperscolumnhelper poi api documentation'

distance = 554
spam score = 61
title = 'orgapachepoihssfeventusermodeldummyrecord class hierarchy poi api documentation'

distance = 555
spam score = 70
title = 'orgapachepoihsmfdatatypes poi api documentation'

distance = 668
spam score = 78
title = 'orgapachepoihwpfsprm poi api documentation'

distance = 670
spam score = 71
title = 'orgapachepoihwpfmodeltypes poi api documentation'

distance = 670
spam score = 64
title = 'uses of package orgapachepoicommonusermodel poi api documentation'

distance = 673
spam score = 64
title = 'orgapachepoihslfutil class hierarchy poi api documentation'

distance = 676
spam score = 64
title = 'uses of class orgapachepoixslfxslfslideshow poi api documentation'

distance = 677
spam score = 72
title = 'uses of package orgapachepoihdgfstreams poi api documentation'

distance = 683
spam score = 58
title = 'uses of class orgapachepoihssfusermodelhssfconditionalformatting poi api documentation'

distance = 685
spam score = 74
title = 'uses of class orgapachepoihssfrecordabstractescherholderrecord poi api documentation'

distance = 686
spam score = 62
title = 'uses of package orgapachepoipoifseventfilesystem poi api documentation'

distance = 687
spam score = 63
title = 'uses of class orgapachepoihsmfdatatypeschunks poi api documentation'

distance = 849
spam score = 67
title = 'uses of class orgapachepoihssfrecordsharedvaluerecordbase poi api documentation'

distance = 855
spam score = 58
title = 'uses of interface orgapachepoissusermodelname poi api documentation'

distance = 860
spam score = 82
title = 'orgapachepoihdgfstreams poi api documentation'

distance = 863
spam score = 73
title = 'orgapachepoixssfmodel poi api documentation'

distance = 869
spam score = 55
title = 'uses of interface orgapachepoislusermodelnotes poi api documentation'

distance = 873
spam score = 65
title = 'uses of class orgapachepoipoifsstoragerawdatablock poi api documentation'

distance = 875
spam score = 65
title = 'uses of class orgapachepoixwpfusermodelxwpfdocument poi api documentation'

distance = 877
spam score = 74
title = 'uses of class orgapachepoihssfmodelabstractshape poi api documentation'

distance = 877
spam score = 68
title = 'uses of package orgapachepoihssfrecordcf poi api documentation'

distance = 881
spam score = 60
title = 'uses of class orgapachepoihwpfusermodeltable poi api documentation'

distance = 1092
spam score = 59
title = 'uses of class orgapachepoissusermodelverticalalignment poi api documentation'

distance = 1102
spam score = 59
title = 'uses of class orgapachepoihslfmodeltextshape poi api documentation'

distance = 1102
spam score = 55
title = 'uses of class orgapachepoihssfrecordformulanameptg poi api documentation'

distance = 1105
spam score = 71
title = 'uses of package orgapachepoihssfrecordformulafunctions poi api documentation'

distance = 1107
spam score = 65
title = 'uses of class orgapachepoihsmfdatatypeschunk poi api documentation'

distance = 1107
spam score = 72
title = 'orgapachepoixwpfusermodel poi api documentation'

distance = 1108
spam score = 61
title = 'uses of class orgapachepoihssfmodelrecordstream poi api documentation'

distance = 1109
spam score = 68
title = 'uses of class orgapachepoipoixmltextextractor poi api documentation'

distance = 1118
spam score = 67
title = 'uses of class orgapachepoihssfrecordrecordformatexception poi api documentation'

distance = 1119
spam score = 69
title = 'uses of class orgapachepoihpsfhpsfexception poi api documentation'

distance = 1459
spam score = 62
title = 'uses of package orgapachepoissformula poi api documentation'

distance = 1464
spam score = 60
title = 'uses of package orgapachepoihssfusermodel poi api documentation'

distance = 1471
spam score = 70
title = 'orgapachepoissusermodel poi api documentation'

distance = 1485
spam score = 58
title = 'uses of class orgapachepoipoixmldocumentpart poi api documentation'

distance = 1495
spam score = 75
title = 'orgapachepoicontribpoibrowser poi api documentation'

distance = 1647
spam score = 62
title = 'uses of class orgapachepoihslfmodelshape poi api documentation'

distance = 212
spam score = 50
title = 'uses of package orgapachestruts2 struts 2 sitegraph plugin 212 api'

distance = 218
spam score = 50
title = 'uses of package orgapachestruts2tiles struts 2 tiles plugin 212 api'

distance = 224
spam score = 55
title = 'uses of package orgapachestruts2s1 struts 2 struts 1 plugin 208 api'

distance = 226
spam score = 53
title = 'uses of package orgapachestruts2sitegraph struts 2 sitegraph plugin 212 api'

distance = 240
spam score = 57
title = 'uses of package orgapachestrutsplugins struts 1310 api'

distance = 250
spam score = 56
title = 'uses of package orgapachestruts2tiles struts 2 tiles plugin 2014 api'

distance = 253
spam score = 57
title = 'uses of package orgapachestrutsplugins struts extras 1310 api'

distance = 259
spam score = 55
title = 'uses of package orgapachestruts2s1 struts 2 struts 1 plugin 20112 api'

distance = 260
spam score = 50
title = 'uses of class orgapachestruts2main struts 2 sitegraph plugin 212 api'

distance = 260
spam score = 58
title = 'uses of package orgapachestruts struts 1310 api'

distance = 261
spam score = 55
title = 'uses of package orgapachestruts2s1 struts 2 struts 1 plugin 206 api'

distance = 263
spam score = 59
title = 'uses of package orgapachestrutsplugins struts extras 1310 api'

distance = 268
spam score = 67
title = 'uses of package orgapachestruts2s1 struts 2 struts 1 plugin 212 api'

distance = 272
spam score = 56
title = 'uses of package orgapachestruts2 struts 2 sitegraph plugin 206 api'

distance = 278
spam score = 50
title = 'uses of class orgapachestruts2sitegraphsitegraph struts 2 sitegraph plugin 212 api'

distance = 278
spam score = 53
title = 'uses of package orgapachestruts2 struts 2 sitegraph plugin 2014 api'

distance = 280
spam score = 55
title = 'uses of package orgapachestruts struts 1310 api'

distance = 287
spam score = 55
title = 'uses of package orgapachestruts2s1 struts 2 struts 1 plugin 2011 api'

distance = 289
spam score = 54
title = 'uses of package orgapachestruts2plexus struts 2 plexus plugin 208 api'

distance = 296
spam score = 52
title = 'uses of package orgapachestruts2tiles struts 2 tiles plugin 2011 api'

distance = 437
spam score = 57
title = 'uses of class orgapachestruts2jsfrestoreviewinterceptor struts 2 jsf plugin 20111 api'

distance = 437
spam score = 52
title = 'uses of class orgapachestruts2plexusplexusfilter struts 2 plexus plugin 20111 api'

distance = 437
spam score = 52
title = 'uses of package orgapachestruts2sitemesh struts 2 sitemesh plugin 2012 api'

distance = 437
spam score = 54
title = 'uses of package orgapachestrutschaincommandsutil struts core 1310 api'

distance = 438
spam score = 56
title = 'uses of package orgapachestruts2dispatchermultipart struts 2 pell multipart plugin 209 api'

distance = 438
spam score = 58
title = 'uses of class orgapachestruts2jsfrestoreviewinterceptor struts 2 jsf plugin 2011 api'

distance = 438
spam score = 52
title = 'orgapachestruts2portletutil struts 2 core 2012 api'

distance = 439
spam score = 57
title = 'uses of class orgapachestrutschaincommandsunauthorizedactionexception struts 1310 api'

distance = 439
spam score = 54
title = 'uses of class orgapachestruts2plexusplexusthreadlocal struts 2 plexus plugin 20111 api'

distance = 439
spam score = 63
title = 'overview struts 2 sitegraph plugin 20111 api'

distance = 472
spam score = 53
title = 'uses of class orgapachestruts2plexusplexusfilter struts 2 plexus plugin 2014 api'

distance = 472
spam score = 51
title = 'uses of class orgapachestruts2jsffacesrender struts 2 jsf plugin 2014 api'

distance = 472
spam score = 57
title = 'orgapachestrutsplugins class hierarchy struts 1310 api'

distance = 472
spam score = 59
title = 'uses of package orgapachestruts2dispatcher struts 2 jfreechart plugin 2014 api'

distance = 474
spam score = 53
title = 'uses of class orgapachestrutsconfigimpldefaultmoduleconfigfactory struts 1310 api'

distance = 474
spam score = 53
title = 'uses of class orgapachestruts2sitemeshvelocitypagefilter struts 2 sitemesh plugin 2011 api'

distance = 475
spam score = 54
title = 'uses of package orgapachestruts2interceptordebugging struts 2 core 2014 api'

distance = 475
spam score = 69
title = 'overview struts faces 1310 api'

distance = 475
spam score = 52
title = 'uses of class orgapachestruts2configbrowsershowbeansaction struts 2 configuration browser plugin 212 api'

distance = 475
spam score = 57
title = 'uses of class orgapachestrutsscriptingrequesttovariablefilter struts scripting 1310 api'

distance = 523
spam score = 56
title = 'orgapachestrutsfacesutil struts faces 1310 test api'

distance = 524
spam score = 53
title = 'orgapachestruts2sitegraphentities struts 2 sitegraph plugin 206 api'

distance = 524
spam score = 48
title = 'uses of class orgapachestruts2sitegraphmodellink struts 2 sitegraph plugin 212 api'

distance = 524
spam score = 57
title = 'uses of class orgapachestruts2sitegraphentitiesfilebasedview struts 2 sitegraph plugin 206 api'

distance = 525
spam score = 53
title = 'deprecated list struts 2 pell multipart plugin 2012 api'

distance = 525
spam score = 63
title = 'deprecated list struts 2 sitemesh plugin 212 api'

distance = 526
spam score = 51
title = 'uses of package orgapachestrutsfacescomponent struts 138 api'

distance = 526
spam score = 58
title = 'deprecated list struts 2 jasper reports plugin 209 api'

distance = 526
spam score = 60
title = 'deprecated list struts 2 pell multipart plugin 20112 api'

distance = 527
spam score = 54
title = 'orgapachestruts2interceptordebugging struts 2 core 2011 api'

distance = 560
spam score = 64
title = 'orgapachestruts2dispatcher class hierarchy struts 2 jfreechart plugin 2014 api'

distance = 560
spam score = 68
title = 'orgapachestruts2dispatchermultipart struts 2 pell multipart plugin 2011 api'

distance = 560
spam score = 55
title = 'uses of package orgapachestruts2configbrowser struts 2 configuration browser plugin 209 api'

distance = 561
spam score = 58
title = 'deprecated list struts 2 pell multipart plugin 2011 api'

distance = 562
spam score = 65
title = 'orgapachestruts2sitegraph struts 2 sitegraph plugin 212 api'

distance = 562
spam score = 62
title = 'uses of class orgapachestruts2viewsjasperreportsvaluestackdatasource struts 2 jasper reports plugin 2014 api'

distance = 562
spam score = 65
title = 'orgapachestruts2viewsannotations struts 2 core 2014 api'

distance = 564
spam score = 57
title = 'uses of class orgapachestrutsvalidatorbeanvalidatorform struts 1310 api'

distance = 565
spam score = 67
title = 'deprecated list struts 2 plexus plugin 2014 api'

distance = 565
spam score = 69
title = 'orgapachestruts2sitegraphmodel struts 2 sitegraph plugin 2014 api'

distance = 613
spam score = 58
title = 'uses of package orgapachestruts2viewsjasperreports struts 2 jasper reports plugin 20112 api'

distance = 615
spam score = 60
title = 'orgapachestrutsscripting class hierarchy struts 1310 api'

distance = 615
spam score = 53
title = 'uses of package orgapachestruts2viewsjasperreports struts 2 jasper reports plugin 2012 api'

distance = 615
spam score = 47
title = 'serialized form struts 2 plexus plugin 212 api'

distance = 616
spam score = 60
title = 'uses of package orgapachestruts2viewsjasperreports struts 2 jasper reports plugin 209 api'

distance = 616
spam score = 58
title = 'orgapachestrutsscripting class hierarchy struts 1310 api'

distance = 617
spam score = 66
title = 'uses of class orgapachestruts2configbrowserlistvalidatorsaction struts 2 configuration browser plugin 2014 api'

distance = 617
spam score = 52
title = 'uses of package orgapachestruts2viewsjspiterator struts 2 core 20112 api'

distance = 619
spam score = 78
title = 'orgapachestruts2plexus struts 2 plexus plugin 209 api'

distance = 619
spam score = 57
title = 'apache struts api documentation uses of class orgapachestrutsconfigimpldefaultmoduleconfigfactory'

distance = 699
spam score = 61
title = 'orgapachestrutsplugins struts 138 api'

distance = 700
spam score = 49
title = 'orgapachestruts2sitegraphentities struts 2 sitegraph plugin 20112 api'

distance = 700
spam score = 74
title = 'orgapachestrutsvalidatorvalidwhen struts core 1310 api'

distance = 700
spam score = 71
title = 'orgapachestruts2sitemesh struts 2 sitemesh plugin 208 api'

distance = 701
spam score = 62
title = 'orgapachestruts2tiles struts 2 tiles plugin 209 api'

distance = 702
spam score = 75
title = 'orgapachestruts2tiles struts 2 tiles plugin 212 api'

distance = 702
spam score = 60
title = 'orgapachestrutsfacesapplication class hierarchy struts 1310 api'

distance = 702
spam score = 64
title = 'apache struts api documentation package orgapachestrutsplugins'

distance = 703
spam score = 75
title = 'apache struts api documentation package orgapachestrutsplugins'

distance = 704
spam score = 54
title = 'orgapachestrutsfacesutil class hierarchy struts faces 1310 test api'

distance = 793
spam score = 53
title = 'orgapachestruts2dispatchermultipart struts 2 core 212 api'

distance = 794
spam score = 59
title = 'uses of class orgapachestruts2componentstablerendererabstractcellrenderer struts 2 core 2014 api'

distance = 795
spam score = 73
title = 'orgapachestruts2viewsjasperreports struts 2 jasper reports plugin 2014 api'

distance = 796
spam score = 67
title = 'orgapachestrutsactions class hierarchy struts extras 1310 api'

distance = 797
spam score = 55
title = 'uses of package orgjbehavemojo jbehave maven plugin 201 api'

distance = 800
spam score = 49
title = 'orgapachestruts2viewsjspiterator struts 2 core 212 api'

distance = 802
spam score = 70
title = 'orgapachestruts2viewsjasperreports struts 2 jasper reports plugin 209 api'

distance = 803
spam score = 64
title = 'orgapachestruts2viewsjasperreports struts 2 jasper reports plugin 208 api'

distance = 804
spam score = 56
title = 'orgapachestruts2portlet struts 2 core 2011 api'

distance = 804
spam score = 65
title = 'orgapachestruts2viewsjasperreports struts 2 jasper reports plugin 2012 api'

distance = 965
spam score = 54
title = 'orgapachestrutsappsmailreaderdaoimplmemory struts 138 api'

distance = 969
spam score = 55
title = 'orgapachestruts2componentstemplate struts 2 core 20112 api'

distance = 970
spam score = 45
title = 'uses of package orgapachemavenplugin maven 11 api'

distance = 974
spam score = 54
title = 'orgapachestruts2viewsfreemarkertags struts 2 core 20111 api'

distance = 976
spam score = 73
title = 'orgstrutsmewishlistpresentationstrutswish test api'

distance = 980
spam score = 42
title = 'index struts 2 jfreechart plugin 20112 api'

distance = 983
spam score = 68
title = 'orgapachestruts2viewsfreemarkertags struts 2 core 2014 api'

distance = 986
spam score = 51
title = 'orgapachestruts2portletservlet struts 2 core 20111 api'

distance = 990
spam score = 51
title = 'orgapachestruts2portlet struts 2 core 20112 api'

distance = 991
spam score = 64
title = 'orgstrutsmewishlistpresentationstrutslogin test api'

distance = 1792
spam score = 49
title = 'verb workshop 2005'

distance = 131
spam score = 51
title = 'uses of package orgapachetapestrypages tapestry 416 api'

distance = 180
spam score = 65
title = 'uses of package orgapachetapestrypages tapestry 403 api'

distance = 202
spam score = 53
title = 'uses of package orgapachetapestrywmlpages tapestry 416 api'

distance = 235
spam score = 54
title = 'uses of package orgapachetapestry5tutorialpages tapestry 5 project 5018 api'

distance = 241
spam score = 54
title = 'uses of class orgapachetapestry5versionutils tapestry 5 project 5018 api'

distance = 244
spam score = 55
title = 'uses of class orgapachetapestry5symbolconstants tapestry 5 project 5018 api'

distance = 255
spam score = 55
title = 'uses of package orgapachetapestry5corelibpages tapestry 5 project 5018 api'

distance = 257
spam score = 50
title = 'uses of package orgapachetapestry5internalmodel tapestry 5 project 5018 api'

distance = 263
spam score = 55
title = 'uses of package orgapachetapestry5spring tapestry 5 project 5018 api'

distance = 271
spam score = 51
title = 'uses of package orgapachetapestrycontriblink tapestry 416 api'

distance = 283
spam score = 64
title = 'uses of package orgapachetapestrytest tapestry 403 api'

distance = 285
spam score = 49
title = 'uses of package orgapachetapestrydojohtml tapestry 416 api'

distance = 286
spam score = 64
title = 'uses of package orgapachetapestryengineencoders tapestry 403 api'

distance = 296
spam score = 51
title = 'uses of class orgapachetapestryassetexternalresource tapestry 416 api'

distance = 299
spam score = 52
title = 'uses of class orgapachetapestrycomponentsinsert tapestry 416 api'

distance = 302
spam score = 48
title = 'uses of class orgapachetapestryhtmlinserttext tapestry 416 api'

distance = 302
spam score = 59
title = 'uses of class orgapachetapestrybasesessionstoreoptimized tapestry 403 api'

distance = 307
spam score = 52
title = 'uses of class orgapachetapestryformtextfield tapestry 416 api'

distance = 308
spam score = 52
title = 'uses of class orgapachetapestryassetexternalasset tapestry 416 api'

distance = 311
spam score = 52
title = 'uses of class orgapachetapestryportletactionrequestservicertowebrequestservicerbridge tapestry 416 api'

distance = 391
spam score = 55
title = 'uses of class orgapachetapestry5annotationspagedetached tapestry 5 project 5018 api'

distance = 393
spam score = 50
title = 'uses of class orgapachetapestryservicesimpldojoajaxresponsebuilder tapestry 416 api'

distance = 393
spam score = 59
title = 'uses of class orgapachetapestryformtranslatedfieldsupportimpl tapestry 403 api'

distance = 393
spam score = 55
title = 'uses of class orgapachetapestry5annotationspageattached tapestry 5 project 5018 api'

distance = 394
spam score = 60
title = 'uses of class orgapachetapestryspecbindingspecification tapestry 403 api'

distance = 397
spam score = 54
title = 'uses of class orgapachetapestry5iocannotationseagerload tapestry 5 project 5018 api'

distance = 397
spam score = 60
title = 'uses of class orgapachetapestryengineenginemessages tapestry 403 api'

distance = 398
spam score = 52
title = 'uses of class orgapachetapestryutilioserializableadaptortest tapestry 416 test api'

distance = 398
spam score = 53
title = 'uses of class orgapachetapestry5beaneditornonvisual tapestry 5 project 5018 api'

distance = 399
spam score = 48
title = 'uses of class orgapachetapestryservicesimpljsonresponsebuilder tapestry 416 api'

distance = 445
spam score = 57
title = 'uses of class orgapachetapestryservicesimplbindingsourceimpl tapestry 403 api'

distance = 447
spam score = 47
title = 'orgapachetapestrydata class hierarchy tapestry 416 api'

distance = 447
spam score = 60
title = 'orgapachetapestrytest class hierarchy tapestry 403 api'

distance = 448
spam score = 51
title = 'uses of class orgapachetapestry5corelibmixinsrenderdisabled tapestry 5 project 5018 api'

distance = 449
spam score = 56
title = 'uses of class orgapachetapestryservicesimplclassfinderimpl tapestry 403 api'

distance = 450
spam score = 49
title = 'orgapachetapestryjunitmocklib tapestry 416 test api'

distance = 452
spam score = 50
title = 'orgapachetapestryjunitmockc31 tapestry 416 test api'

distance = 458
spam score = 52
title = 'orgapachetapestry5uploadcomponents class hierarchy tapestry 5 project 5018 api'

distance = 458
spam score = 50
title = 'uses of package orgapachetapestrycontribajax tapestry 416 api'

distance = 459
spam score = 58
title = 'uses of class orgapachetapestryutiltextasciicharactertranslator tapestry 403 api'

distance = 527
spam score = 62
title = 'uses of class orgapachetapestryannotationspersist annotations 411snapshot api'

distance = 528
spam score = 60
title = 'uses of class orgapachetapestry5utilabstractselectmodel tapestry 5 project 5018 api'

distance = 530
spam score = 57
title = 'uses of class orgapachetapestryannotationsasset annotations 411snapshot api'

distance = 531
spam score = 54
title = 'orgapachetapestry5corelibpages class hierarchy tapestry 5 project 5018 api'

distance = 531
spam score = 46
title = 'orgapachetapestryintegrationapp1pages tapestry 416 test api'

distance = 531
spam score = 61
title = 'orgapachetapestry5corelibpages tapestry 5 project 5018 api'

distance = 532
spam score = 57
title = 'orgapachetapestrypages tapestry 416 test api'

distance = 532
spam score = 59
title = 'uses of class orgapachetapestryannotationscomponent annotations 411snapshot api'

distance = 532
spam score = 54
title = 'uses of class orgapachetapestryannotationsinjectassetannotationworker annotations 411snapshot api'

distance = 534
spam score = 55
title = 'uses of class orgapachetapestryannotationsinjectstateannotationworker annotations 411snapshot api'

distance = 597
spam score = 56
title = 'orgapachetapestryjson tapestry 416 test api'

distance = 598
spam score = 55
title = 'uses of class orgapachetapestryrecordchangekey tapestry 402 api'

distance = 601
spam score = 54
title = 'orgapachetapestryl10n tapestry 416 api'

distance = 601
spam score = 72
title = 'orgapachetapestrytest tapestry 403 api'

distance = 602
spam score = 48
title = 'orgapachetapestryengineencoders class hierarchy tapestry 416 api'

distance = 603
spam score = 55
title = 'orgapachetapestry5uploadservices tapestry 5 project 5018 api'

distance = 604
spam score = 57
title = 'orgapachetapestry5hibernate class hierarchy tapestry 5 project 5018 api'

distance = 605
spam score = 48
title = 'orgapachetapestryportletbindings tapestry 416 test api'

distance = 605
spam score = 54
title = 'uses of interface orgapachetapestry5servicesbeanblockoverridesource tapestry 5 project 5018 api'

distance = 609
spam score = 52
title = 'orgapachetapestrycontribtreecomponents tapestry 416 api'

distance = 683
spam score = 58
title = 'uses of interface orgapachetapestryrecordpagerecordersource tapestry 402 api'

distance = 685
spam score = 61
title = 'orgapachetapestry5internalevents tapestry 5 project 5018 api'

distance = 689
spam score = 51
title = 'orgapachetapestryjunitutils tapestry 416 test api'

distance = 689
spam score = 62
title = 'uses of class orgapachetapestryformtranslatorabstracttranslator tapestry 403 api'

distance = 691
spam score = 68
title = 'orgapachetapestrycontribcomponents tapestry 416 api'

distance = 693
spam score = 55
title = 'uses of interface orgapachetapestry5gridgridsortmodel tapestry 5 project 5018 api'

distance = 695
spam score = 57
title = 'orgapachetapestry5validator tapestry 5 project 5018 api'

distance = 697
spam score = 66
title = 'orgapachetapestrywmlpages class hierarchy tapestry 403 api'

distance = 697
spam score = 66
title = 'uses of package orgapachetapestrymultipart tapestry 403 api'

distance = 703
spam score = 60
title = 'uses of package orgapachetapestryutilio tapestry 403 api'

distance = 756
spam score = 66
title = 'uses of package orgapachetapestryformvalidator tapestry 403 api'

distance = 756
spam score = 43
title = 'orgapachetapestry5internalgrid tapestry 5 project 5100 api'

distance = 759
spam score = 58
title = 'orgapachetapestrydojo tapestry 416 api'

distance = 761
spam score = 59
title = 'uses of class orgapachetapestryhtmlinserttextmode tapestry 416 api'

distance = 762
spam score = 57
title = 'orgapachetapestryerror tapestry 416 test api'

distance = 762
spam score = 54
title = 'orgapachetapestrycontribtablemodelognl tapestry 416 api'

distance = 762
spam score = 60
title = 'uses of interface orgapachetapestryannotationsclassannotationenhancementworker annotations 411snapshot api'

distance = 762
spam score = 60
title = 'uses of interface orgapachetapestryenginestatestateobjectmanager tapestry 403 api'

distance = 762
spam score = 46
title = 'orgapachetapestry5webflowservices tapestry 5 project 5100snapshot api'

distance = 764
spam score = 59
title = 'uses of class orgapachetapestrybindingexception tapestry 403 api'

distance = 827
spam score = 64
title = 'orgapachetapestryutil tapestry 416 test api'

distance = 830
spam score = 59
title = 'orgapachetapestry5grid tapestry 5 project 5018 api'

distance = 830
spam score = 51
title = 'uses of interface orgapachetapestry5iocservicesaspectinterceptorbuilder tapestry 5 project 5018 api'

distance = 833
spam score = 51
title = 'orgapachetapestrydojoform tapestry 416 test api'

distance = 833
spam score = 61
title = 'orgapachetapestrycomponents tapestry 416 test api'

distance = 836
spam score = 62
title = 'orgapachetapestry5hibernate tapestry 5 project 5018 api'

distance = 837
spam score = 45
title = 'orgapachetapestry5corelibpages tapestry 5 project 5100 api'

distance = 840
spam score = 61
title = 'orgapachetapestrycontribtreemodel tapestry 416 api'

distance = 841
spam score = 46
title = 'uses of interface orgapachetapestryscriptaculouslistitemrenderer tapestry 416 api'

distance = 846
spam score = 48
title = 'orgapachetapestry5internalbeaneditor tapestry 5 project 5100 api'

distance = 924
spam score = 63
title = 'uses of interface orgapachetapestryutiliosqueezeadaptor tapestry 403 api'

distance = 927
spam score = 55
title = 'orgapachetapestryservices class hierarchy tapestry 402 api'

distance = 928
spam score = 48
title = 'orgapachetapestry5internalpageload tapestry 5 project 5101snapshot api'

distance = 934
spam score = 46
title = 'orgapachetapestry5validator tapestry 5 project 5100 api'

distance = 935
spam score = 57
title = 'orgapachetapestry5internalspring tapestry 5 project 5101snapshot api'

distance = 937
spam score = 72
title = 'uses of package orgapachetapestryrequest tapestry 403 api'

distance = 940
spam score = 62
title = 'uses of interface orgapachetapestryeventpagebeginrenderlistener tapestry 403 api'

distance = 940
spam score = 51
title = 'orgapachetapestryioc tapestry core library 500snapshot api'

distance = 951
spam score = 59
title = 'orgapachetapestrycallback tapestry 416 test api'

distance = 952
spam score = 46
title = 'orgapachetapestry5test tapestry 5 project 5100 api'

distance = 1129
spam score = 58
title = 'uses of package orgapachetapestry5grid tapestry 5 project 5018 api'

distance = 1132
spam score = 54
title = 'uses of class orgapachetapestry5gridsortconstraint tapestry 5 project 5018 api'

distance = 1167
spam score = 54
title = 'uses of package orgapachetapestry5dom tapestry 5 project 5018 api'

distance = 1198
spam score = 53
title = 'orgapachetapestry5dom tapestry 5 project 5101snapshot api'

distance = 1208
spam score = 56
title = 'orgapachetapestryenhance tapestry 416 test api'

distance = 1211
spam score = 46
title = 'orgapachetapestry5internalbindings tapestry 5 project 5100snapshot api'

distance = 1254
spam score = 63
title = 'orgapachetapestryannotations tapestry 416 test api'

distance = 1600
spam score = 68
title = 'uses of package orgapachejuddidatatype juddiparent 20rc5 api'

distance = 33
spam score = 65
title = ''

distance = 33
spam score = 61
title = ''

distance = 68
spam score = 68
title = ''

distance = 1333
spam score = 72
title = ''

distance = 226
spam score = 52
title = 'uses of package orgjagareproductionproteinlocation jaga java api for genetic algorithms'

distance = 227
spam score = 65
title = 'uses of package orgjagaexampleapplications jaga java api for genetic algorithms'

distance = 254
spam score = 60
title = 'uses of package orgjagareproductiongreycodednumbers jaga java api for genetic algorithms'

distance = 256
spam score = 51
title = 'uses of class orgjagaexampleapplicationsexample2 jaga java api for genetic algorithms'

distance = 261
spam score = 53
title = 'uses of class orgjagaexampleapplicationsmultiplexerevolution jaga java api for genetic algorithms'

distance = 263
spam score = 47
title = 'uses of class orgjagautilsimplecollectionofindividuals jaga java api for genetic algorithms'

distance = 274
spam score = 49
title = 'uses of class orgjagaselectionclassifierfitness jaga java api for genetic algorithms'

distance = 275
spam score = 47
title = 'uses of class orgjagaselectionroulettewheelselection jaga java api for genetic algorithms'

distance = 278
spam score = 46
title = 'uses of class orgjagaselectiontwotournamentprobabalisticselection jaga java api for genetic algorithms'

distance = 289
spam score = 52
title = 'uses of class orgjagautildefaultrandomgenerator jaga java api for genetic algorithms'

distance = 292
spam score = 50
title = 'uses of class orgjagamasteralgorithminitialpopulationga jaga java api for genetic algorithms'

distance = 301
spam score = 56
title = 'uses of package orgjagafitnessevaluationproteinlocation jaga java api for genetic algorithms'

distance = 302
spam score = 59
title = 'uses of package orgjagareproductionbooleanformulas jaga java api for genetic algorithms'

distance = 304
spam score = 48
title = 'uses of class orgjagahooksanalysisgraphpanel jaga java api for genetic algorithms'

distance = 305
spam score = 60
title = 'uses of package orgjagaselection jaga java api for genetic algorithms'

distance = 306
spam score = 68
title = 'deprecated list jaga java api for genetic algorithms'

distance = 307
spam score = 48
title = 'uses of class orgjagareproductiongreycodednumberssimplebinarymutation jaga java api for genetic algorithms'

distance = 308
spam score = 50
title = 'uses of class orgjagaexampleapplicationsexample1 jaga java api for genetic algorithms'

distance = 308
spam score = 49
title = 'uses of class orgjagahooksbetterresulthook jaga java api for genetic algorithms'

distance = 309
spam score = 51
title = 'uses of class orgjagareproductionproteinlocationpolypeptidepatternxover jaga java api for genetic algorithms'

distance = 326
spam score = 48
title = 'uses of class orgjagaexampleapplicationsexample1fitness jaga java api for genetic algorithms'

distance = 332
spam score = 49
title = 'uses of class orgjagamasteralgorithmelitistga jaga java api for genetic algorithms'

distance = 337
spam score = 49
title = 'uses of class orgjagaindividualrepresentationproteinlocationaminoacidpropertyfactory jaga java api for genetic algorithms'

distance = 338
spam score = 66
title = 'orgjagafitnessevaluationproteinlocation jaga java api for genetic algorithms'

distance = 341
spam score = 45
title = 'uses of class orgjagareproductiongreycodednumberssimplebinaryxover jaga java api for genetic algorithms'

distance = 342
spam score = 37
title = 'qindex jaga java api for genetic algorithms'

distance = 342
spam score = 44
title = 'uses of class orgjagahooksdebughook jaga java api for genetic algorithms'

distance = 353
spam score = 52
title = 'uses of class orgjagareproductioncombinedreproductionalgorithm jaga java api for genetic algorithms'

distance = 356
spam score = 48
title = 'uses of class orgjagafitnessevaluationmultiplexermultiplexerfitness jaga java api for genetic algorithms'

distance = 356
spam score = 51
title = 'uses of class orgjagareproductionbooleanformulasnodesnandnode jaga java api for genetic algorithms'

distance = 358
spam score = 45
title = 'uses of class orgjagaindividualrepresentationproteinlocationproteinlocationclassifierfactory jaga java api for genetic algorithms'

distance = 360
spam score = 50
title = 'uses of class orgjagareproductionbooleanformulasnodesnotnode jaga java api for genetic algorithms'

distance = 362
spam score = 49
title = 'uses of class orgjagareproductionbooleanformulasnodesfalsenode jaga java api for genetic algorithms'

distance = 362
spam score = 47
title = 'uses of class orgjagaindividualrepresentationproteinlocationsimplifiedfastafileparser jaga java api for genetic algorithms'

distance = 371
spam score = 50
title = 'uses of class orgjagaindividualrepresentationproteinlocationaminoacidfactory jaga java api for genetic algorithms'

distance = 372
spam score = 47
title = 'uses of class orgjagareproductiongreycodednumberssimplebinaryxoverwithmutation jaga java api for genetic algorithms'

distance = 378
spam score = 68
title = 'orgjagafitnessevaluationlargernumbers jaga java api for genetic algorithms'

distance = 379
spam score = 62
title = 'uses of package orgjagafitnessevaluationmultiplexer jaga java api for genetic algorithms'

distance = 384
spam score = 52
title = 'uses of class orgjagafitnessevaluationlargernumberslargerdecimals jaga java api for genetic algorithms'

distance = 384
spam score = 50
title = 'uses of class orgjagareproductionbooleanformulasnodesandnode jaga java api for genetic algorithms'

distance = 403
spam score = 51
title = 'uses of class orgjagareproductionbooleanformulasnodestertiaryoperatornode jaga java api for genetic algorithms'

distance = 404
spam score = 45
title = 'uses of class orgjagareproductionbooleanformulasnodestruenode jaga java api for genetic algorithms'

distance = 404
spam score = 55
title = 'uses of class orgjagaindividualrepresentationgreycodednumbersnnumbersgreycodedindivudual jaga java api for genetic algorithms'

distance = 405
spam score = 47
title = 'uses of class orgjagareproductionbooleanformulasnodesnornode jaga java api for genetic algorithms'

distance = 407
spam score = 63
title = 'orgjagareproductionbooleanformulas jaga java api for genetic algorithms'

distance = 410
spam score = 45
title = 'uses of class orgjagareproductionbooleanformulasnodesterminalnode jaga java api for genetic algorithms'

distance = 413
spam score = 47
title = 'uses of class orgjagareproductionbooleanformulasnodesunaryoperatornode jaga java api for genetic algorithms'

distance = 414
spam score = 63
title = 'orgjagareproduction jaga java api for genetic algorithms'

distance = 417
spam score = 46
title = 'uses of class orgjagareproductionbooleanformulasnodesimplnode jaga java api for genetic algorithms'

distance = 423
spam score = 47
title = 'uses of class orgjagamasteralgorithmreusablesimplega jaga java api for genetic algorithms'

distance = 474
spam score = 72
title = 'orgjagafitnessevaluationlargernumbers class hierarchy jaga java api for genetic algorithms'

distance = 475
spam score = 53
title = 'uses of class orgjagaindividualrepresentationbooleanformulasbooleanformulatreefactory jaga java api for genetic algorithms'

distance = 477
spam score = 51
title = 'uses of class orgjagautilfittestindividualresult jaga java api for genetic algorithms'

distance = 483
spam score = 66
title = 'orgjagareproductiongreycodednumbers jaga java api for genetic algorithms'

distance = 484
spam score = 48
title = 'uses of class orgjagafitnessevaluationmultiplexermultiplexerfitnesstestentry jaga java api for genetic algorithms'

distance = 488
spam score = 66
title = 'orgjagareproduction class hierarchy jaga java api for genetic algorithms'

distance = 502
spam score = 59
title = 'orgjagareproductionproteinlocation jaga java api for genetic algorithms'

distance = 507
spam score = 65
title = 'orgjagautil jaga java api for genetic algorithms'

distance = 512
spam score = 61
title = 'orgjagamasteralgorithm jaga java api for genetic algorithms'

distance = 516
spam score = 60
title = 'uses of package orgjagaindividualrepresentationbooleanformulas jaga java api for genetic algorithms'

distance = 561
spam score = 61
title = 'orgjagaindividualrepresentationbooleanformulas class hierarchy jaga java api for genetic algorithms'

distance = 564
spam score = 67
title = 'orgjagaselection jaga java api for genetic algorithms'

distance = 567
spam score = 67
title = 'orgjagaexampleapplications jaga java api for genetic algorithms'

distance = 569
spam score = 72
title = 'orgjagafitnessevaluationmultiplexer class hierarchy jaga java api for genetic algorithms'

distance = 588
spam score = 63
title = 'orgjagareproductionproteinlocation class hierarchy jaga java api for genetic algorithms'

distance = 590
spam score = 65
title = 'orgjagahooks jaga java api for genetic algorithms'

distance = 593
spam score = 61
title = 'orgjagadefinitions class hierarchy jaga java api for genetic algorithms'

distance = 597
spam score = 63
title = 'orgjagaexampleapplications class hierarchy jaga java api for genetic algorithms'

distance = 604
spam score = 57
title = 'uses of class orgjagahooksgaanalysisframe jaga java api for genetic algorithms'

distance = 613
spam score = 61
title = 'uses of package orgjagautil jaga java api for genetic algorithms'

distance = 643
spam score = 60
title = 'uses of package orgjagareproduction jaga java api for genetic algorithms'

distance = 665
spam score = 72
title = 'orgjagaindividualrepresentationgreycodednumbers class hierarchy jaga java api for genetic algorithms'

distance = 672
spam score = 72
title = 'orgjagaselection class hierarchy jaga java api for genetic algorithms'

distance = 676
spam score = 67
title = 'uses of package orgjagaindividualrepresentationgreycodednumbers jaga java api for genetic algorithms'

distance = 678
spam score = 49
title = 'uses of class orgjagareproductionxover jaga java api for genetic algorithms'

distance = 691
spam score = 55
title = 'uses of package orgjagareproductionbooleanformulasnodes jaga java api for genetic algorithms'

distance = 698
spam score = 52
title = 'uses of class orgjagafitnessevaluationmultiplexermultiplexer jaga java api for genetic algorithms'

distance = 698
spam score = 49
title = 'uses of class orgjagareproductionbooleanformulasnodesbinaryoperatornode jaga java api for genetic algorithms'

distance = 708
spam score = 77
title = 'overview jaga java api for genetic algorithms'

distance = 724
spam score = 72
title = 'orgjagaindividualrepresentationgreycodednumbers jaga java api for genetic algorithms'

distance = 792
spam score = 67
title = 'orgjagadefinitions jaga java api for genetic algorithms'

distance = 794
spam score = 48
title = 'uses of class orgjagahooksanalysishookentry jaga java api for genetic algorithms'

distance = 796
spam score = 55
title = 'uses of interface orgjagaindividualrepresentationproteinlocationproteinfileparser jaga java api for genetic algorithms'

distance = 797
spam score = 72
title = 'orgjagaindividualrepresentationproteinlocation class hierarchy jaga java api for genetic algorithms'

distance = 802
spam score = 66
title = 'orgjagareproductionbooleanformulasnodes jaga java api for genetic algorithms'

distance = 815
spam score = 52
title = 'uses of class orgjagahookssimplegahook jaga java api for genetic algorithms'

distance = 843
spam score = 58
title = 'uses of class orgjagaindividualrepresentationgreycodednumbersrangeconstraint jaga java api for genetic algorithms'

distance = 854
spam score = 57
title = 'uses of class orgjagahooksanalysishook jaga java api for genetic algorithms'

distance = 884
spam score = 51
title = 'uses of class orgjagaindividualrepresentationproteinlocationaminoacidproperty jaga java api for genetic algorithms'

distance = 901
spam score = 52
title = 'uses of class orgjagareproductionbooleanformulasnodesoperatornode jaga java api for genetic algorithms'

distance = 953
spam score = 52
title = 'uses of package orgjagaindividualrepresentationproteinlocation jaga java api for genetic algorithms'

distance = 970
spam score = 47
title = 'uses of interface orgjagadefinitionsselectionalgorithm jaga java api for genetic algorithms'

distance = 1030
spam score = 49
title = 'lindex jaga java api for genetic algorithms'

distance = 1037
spam score = 51
title = 'uses of class orgjagaindividualrepresentationproteinlocationprotein jaga java api for genetic algorithms'

distance = 1085
spam score = 51
title = 'uses of interface orgjagadefinitionsrandomgenerator jaga java api for genetic algorithms'

distance = 1107
spam score = 52
title = 'uses of interface orgjagadefinitionsindividualsfactory jaga java api for genetic algorithms'

distance = 1126
spam score = 50
title = 'serialized form jaga java api for genetic algorithms'

distance = 1135
spam score = 42
title = 'uindex jaga java api for genetic algorithms'

distance = 1140
spam score = 54
title = 'uses of interface orgjagadefinitionsfitnessevaluationalgorithm jaga java api for genetic algorithms'

distance = 1179
spam score = 83
title = 'garesult jaga java api for genetic algorithms'

distance = 1362
spam score = 40
title = 'bindex jaga java api for genetic algorithms'

distance = 1424
spam score = 64
title = 'uses of package orgjagadefinitions jaga java api for genetic algorithms'

distance = 1515
spam score = 55
title = 'uses of interface orgjagadefinitionsfitness jaga java api for genetic algorithms'

distance = 1575
spam score = 54
title = 'uses of class orgjagamasteralgorithmsimplega jaga java api for genetic algorithms'

distance = 1872
spam score = 34
title = 'dblp llew mason'

distance = 216
spam score = 89
title = 'testi'

distance = 223
spam score = 89
title = 'jtristatetreetest wired base 40rc1 api'

distance = 224
spam score = 88
title = 'aboutpanel'

distance = 254
spam score = 95
title = 'infopanel mars simulation project v 284 api specification'

distance = 256
spam score = 87
title = 'capturedevicepanel'

distance = 257
spam score = 87
title = 'jmdshortcutmenu standalone drawingprogram in java 036 api'

distance = 257
spam score = 89
title = 'labeledseparator'

distance = 263
spam score = 89
title = 'figure1'

distance = 263
spam score = 87
title = 'simpleformpanel mactor 202 api'

distance = 266
spam score = 87
title = 'simplerowpanel mactor 202 api'

distance = 269
spam score = 86
title = 'tablesymbolconfiggui jsky api docs'

distance = 272
spam score = 95
title = 'viewdata geoxygene 13 api documentation'

distance = 273
spam score = 88
title = 'sharedtoolbarpanel lobo 0984 java browser api documentation'

distance = 274
spam score = 90
title = 'step1'

distance = 275
spam score = 86
title = 'jacobianpanel'

distance = 277
spam score = 94
title = 'highscorevisualization'

distance = 277
spam score = 90
title = 'statusmessagepanel'

distance = 280
spam score = 88
title = 'helpsearchpanel jedit api'

distance = 281
spam score = 85
title = 'jwelcomepanel'

distance = 292
spam score = 88
title = 'statusbarpanel lobo 0984 java browser api documentation'

distance = 475
spam score = 89
title = 'throttlepview clack v16 api specification'

distance = 475
spam score = 75
title = 'jpopupmenuseparator java platform se 6'

distance = 476
spam score = 91
title = 'sourcetrackerpopup clack v16 api specification'

distance = 476
spam score = 88
title = 'topopopup clack v16 api specification'

distance = 476
spam score = 80
title = 'parampanel ethos simulation framework api'

distance = 477
spam score = 85
title = 'saveasgui testdox 01snapshot api'

distance = 477
spam score = 87
title = 'topopopup clack v16 api specification'

distance = 478
spam score = 83
title = 'interfacepopup clack v16 api specification'

distance = 478
spam score = 89
title = 'repastparampanel repastj api documentation'

distance = 478
spam score = 91
title = 'topopopup clack v16 api specification'

distance = 523
spam score = 88
title = 'basicpanel javaunidu'

distance = 524
spam score = 89
title = 'treepanel wired 40 api'

distance = 524
spam score = 91
title = 'languagepage venice 07beta'

distance = 524
spam score = 93
title = 'plotformatter'

distance = 524
spam score = 91
title = 'genepanel'

distance = 524
spam score = 89
title = 'shapepopupmenu'

distance = 525
spam score = 90
title = 'tuningpage venice 07beta'

distance = 525
spam score = 77
title = 'jpopupmenuseparator java 2 platform se v142'

distance = 525
spam score = 91
title = 'europepaneltoeuropepanel freecol code documentation'

distance = 526
spam score = 93
title = 'valueobjectpropertyinfopanel mapperxml presentation framework 198ga'

distance = 575
spam score = 85
title = 'etherealpopup clack v16 api specification'

distance = 575
spam score = 84
title = 'flowbytequeuepopup clack v16 api specification'

distance = 576
spam score = 87
title = 'authpanel'

distance = 576
spam score = 90
title = 'etherealpopup clack v16 api specification'

distance = 576
spam score = 83
title = 'flowbytequeuepopup clack v16 api specification'

distance = 576
spam score = 90
title = 'flowbytequeuepopup clack v16 api specification'

distance = 576
spam score = 89
title = 'proxypage venice 07beta'

distance = 576
spam score = 89
title = 'numerictextfield jedit api'

distance = 576
spam score = 86
title = 'etherealpopup clack v16 api specification'

distance = 577
spam score = 85
title = 'skinnedjcombobox jets3t api amazon s3 toolkit'

distance = 623
spam score = 88
title = 'genericpopupdatalistwithicons mucommander api'

distance = 623
spam score = 90
title = 'realgraphcellrenderer clack v16 api specification'

distance = 623
spam score = 86
title = 'encodingsoptionpane jedit api'

distance = 623
spam score = 86
title = 'realgraphcellrenderer clack v16 api specification'

distance = 624
spam score = 91
title = 'modellist'

distance = 625
spam score = 89
title = 'displayfootfall'

distance = 625
spam score = 91
title = 'modellist'

distance = 626
spam score = 95
title = 'menubar apache excalibur api'

distance = 626
spam score = 86
title = 'syntaxhiliteoptionpane jedit api'

distance = 627
spam score = 91
title = 'serverpanel core distributed message service'

distance = 690
spam score = 92
title = 'ybrowser'

distance = 690
spam score = 91
title = 'examplesourceconfigurationwizarddatatable rapidminer class documentation'

distance = 692
spam score = 92
title = 'filepreview quaqua 501 20081116'

distance = 693
spam score = 96
title = 'announcementwindow mars simulation project v 284 api specification'

distance = 694
spam score = 86
title = 'search'

distance = 694
spam score = 86
title = 'pdbbankformpanel'

distance = 695
spam score = 92
title = 'socialcommitmentjlist'

distance = 695
spam score = 88
title = 'notespane javaneuralnet api'

distance = 695
spam score = 91
title = 'bboxeditor'

distance = 696
spam score = 89
title = 'preftextfield mucommander api'

distance = 753
spam score = 86
title = 'pircbotpanel xnap api'

distance = 753
spam score = 86
title = 'aitree javaneuralnet api'

distance = 754
spam score = 90
title = 'propertytextfield repastj api documentation'

distance = 754
spam score = 84
title = 'graychooser quaqua 501 20081116'

distance = 755
spam score = 95
title = 'goodstabpanel mars simulation project v 284 api specification'

distance = 755
spam score = 92
title = 'settlementwindow mars simulation project v 284 api specification'

distance = 756
spam score = 89
title = 'textfieldint jemboss api'

distance = 756
spam score = 92
title = 'missionwindow mars simulation project v 284 api specification'

distance = 757
spam score = 87
title = 'hsbchooser quaqua 501 20081116'

distance = 758
spam score = 90
title = 'outputpane czt gaffe2 10 api'

distance = 815
spam score = 69
title = 'continuoustrackrenderer cytoscape 261 api'

distance = 815
spam score = 94
title = 'audiomixeroptionui freecol code documentation'

distance = 816
spam score = 88
title = 'sqlpanel'

distance = 816
spam score = 64
title = 'metalcomboboxuimetalcombopopup java 2 platform se v141'

distance = 816
spam score = 92
title = 'boxpanel'

distance = 816
spam score = 85
title = 'effectspanel'

distance = 817
spam score = 95
title = 'camerainspector'

distance = 817
spam score = 92
title = 'europepaneltransactionlog freecol code documentation'

distance = 817
spam score = 90
title = 'textareasink jemboss api'

distance = 817
spam score = 87
title = 'testplanwindow clif 130 api documentation'

distance = 893
spam score = 92
title = 'bifurcationoutputpanel fractalj'

distance = 893
spam score = 85
title = 'garulespage venice 07beta'

distance = 893
spam score = 95
title = 'maintview'

distance = 894
spam score = 91
title = 'editpanel limited petri nets and agility'

distance = 894
spam score = 89
title = 'addresourcepanel'

distance = 895
spam score = 94
title = 'spanlabeler'

distance = 896
spam score = 88
title = 'capadibujo libreria grafica 10 api'

distance = 898
spam score = 86
title = 'matrixplot3d'

distance = 898
spam score = 90
title = 'propsneuron'

distance = 898
spam score = 90
title = 'filelist mucommander api'

distance = 1108
spam score = 90
title = 'simplebrowserframe cobra 0984 java html toolkit api documentation'

distance = 1128
spam score = 90
title = 'junbulletinboardviewswing jun for java jun713'

distance = 1137
spam score = 80
title = 'minimzeheader'

distance = 1145
spam score = 91
title = 'chartgenerator'

distance = 1161
spam score = 86
title = 'counter'

distance = 1182
spam score = 87
title = 'inspector'

distance = 1183
spam score = 89
title = 'inspector'

distance = 1311
spam score = 68
title = 'worldtview'

distance = 1730
spam score = 24
title = 'complangjavagui'

distance = 193
spam score = 72
title = 'uses of package orgapacheavalonexcaliburtestcase apache excalibur api'

distance = 216
spam score = 63
title = 'uses of class orgapacheavalonexcaliburcomponentcomponentproxygenerator apache excalibur api'

distance = 218
spam score = 61
title = 'uses of class orgapacheavalonexcaliburmonitorresourcewriter apache excalibur api'

distance = 219
spam score = 58
title = 'uses of class orgapacheavalonexcaliburcomponentthreadsafecomponenthandler apache excalibur api'

distance = 220
spam score = 58
title = 'uses of class orgapacheavalonexcaliburcomponentexcaliburcomponentmanagercreator apache excalibur api'

distance = 222
spam score = 59
title = 'uses of class orgapacheavalonexcaliburmonitordirectoryresource apache excalibur api'

distance = 223
spam score = 58
title = 'uses of class orgapacheavalonexcaliburmonitormonitorableurlsource apache excalibur api'

distance = 224
spam score = 58
title = 'uses of class orgapacheavalonexcaliburcomponentdefaultcomponenthandler apache excalibur api'

distance = 224
spam score = 57
title = 'uses of class orgapacheavalonexcaliburcomponentdefaultcomponentpoolcontroller apache excalibur api'

distance = 225
spam score = 65
title = 'uses of class orgapacheavalonexcaliburcomponentdefaultcomponentmanager apache excalibur api'

distance = 227
spam score = 58
title = 'uses of class orgapacheavalonexcaliburcomponentdefaultcomponentpool apache excalibur api'

distance = 229
spam score = 60
title = 'uses of class orgapacheavalonexcaliburcomponentdefaultrolemanager apache excalibur api'

distance = 229
spam score = 59
title = 'uses of class orgapacheavalonexcaliburcomponentpoolablecomponenthandler apache excalibur api'

distance = 233
spam score = 71
title = 'uses of package orgapacheavalonexcaliburcomponentservlet apache excalibur api'

distance = 235
spam score = 58
title = 'uses of class orgapacheavalonexcaliburmonitorfileresource apache excalibur api'

distance = 235
spam score = 59
title = 'uses of class orgapacheavalonexcaliburpoolsinglethreadedpool apache excalibur api'

distance = 236
spam score = 61
title = 'uses of class orgapacheavalonexcaliburdatasourceresourcelimitingjdbcconnectionpool apache excalibur api'

distance = 239
spam score = 62
title = 'uses of class orgapacheavalonexcaliburpoolresourcelimitingpool apache excalibur api'

distance = 240
spam score = 62
title = 'uses of class orgapacheavalonexcaliburmonitorresourceoutputstream apache excalibur api'

distance = 242
spam score = 60
title = 'uses of class orgapacheavalonexcaliburmonitoractivemonitor apache excalibur api'

distance = 371
spam score = 57
title = 'uses of class orgapacheavalonexcaliburloggerfactorysmtptargetfactory apache excalibur api'

distance = 372
spam score = 61
title = 'uses of class orgapacheexcaliburxmlsaxdocumenthandleradapter apache excalibur api'

distance = 373
spam score = 64
title = 'uses of class orgapacheavalonframeworkloggercommonslogger apache excalibur api'

distance = 375
spam score = 60
title = 'uses of class orgapacheexcalibursourceimplhttpsclientsourcefactory apache excalibur api'

distance = 376
spam score = 70
title = 'uses of class orgapacheavalonexcaliburdatasourceclusterdefaulthasheddatasourcecluster apache excalibur api'

distance = 376
spam score = 61
title = 'uses of class orgapacheavalonfortresstestcasefortresstestcase apache excalibur api'

distance = 376
spam score = 64
title = 'uses of class orgapacheavalonframeworkloggeravalonformatter apache excalibur api'

distance = 378
spam score = 73
title = 'uses of package orgapacheavalonfortressimpllookup apache excalibur api'

distance = 380
spam score = 65
title = 'uses of class orgapacheavalonexcaliburdatasourcejdbcconnectionpool apache excalibur api'

distance = 383
spam score = 58
title = 'uses of interface orgapacheexcaliburmpoolresettable apache excalibur api'

distance = 417
spam score = 57
title = 'uses of class orgapacheavaloncornerstoneblocksthreadsdefaultthreadmanager apache excalibur api'

distance = 417
spam score = 57
title = 'uses of class orgapachelogutilstackintrospector apache excalibur api'

distance = 419
spam score = 70
title = 'uses of class orgapacheavalonframeworkavailabilityunavailableexception apache excalibur api'

distance = 420
spam score = 59
title = 'uses of interface orgapacheexcaliburxmlsaxxmlizable apache excalibur api'

distance = 421
spam score = 68
title = 'uses of class orgapacheexcaliburxmlxsltxsltprocessorimpl apache excalibur api'

distance = 421
spam score = 57
title = 'uses of class orgapacheavaloncornerstoneblocksschedulermonitorabletimescheduler apache excalibur api'

distance = 421
spam score = 57
title = 'uses of class orgapacheavaloncornerstoneservicesconnectiondefaulthandlerfactory apache excalibur api'

distance = 421
spam score = 60
title = 'uses of interface orgapacheexcaliburxmldomxmlfragment apache excalibur api'

distance = 421
spam score = 78
title = 'uses of package orgapacheavalonexcaliburcomponentexampleim apache excalibur api'

distance = 423
spam score = 59
title = 'uses of class orgapacheavaloncornerstoneblockssocketsdefaultserversocketfactory apache excalibur api'

distance = 458
spam score = 55
title = 'uses of class orgapacheavalonfortressimplhandlerthreadsafecomponenthandler apache excalibur api'

distance = 459
spam score = 78
title = 'uses of class orgapacheexcaliburxmlxpathsaxon7processorimpl apache excalibur api'

distance = 459
spam score = 75
title = 'orgapacheavalonframeworkthread class hierarchy apache excalibur api'

distance = 460
spam score = 60
title = 'uses of class orgapacheavaloncornerstoneblocksmasterstoreextensionfilefilter apache excalibur api'

distance = 461
spam score = 59
title = 'uses of class orgapacheavaloncornerstoneblocksmasterstorecdifilepersistentstreamrepository apache excalibur api'

distance = 461
spam score = 61
title = 'uses of class orgapacheexcalibureventcommandnullcommandfailurehandler apache excalibur api'

distance = 462
spam score = 71
title = 'uses of class orgapacheexcalibursourceimplvaliditynopvalidity apache excalibur api'

distance = 462
spam score = 60
title = 'uses of class orgapacheavaloncornerstoneblocksconnectionavalonloggerconnectionmonitor apache excalibur api'

distance = 463
spam score = 75
title = 'uses of package orgapacheavalonexamplesjdbcdatasource apache excalibur api'

distance = 463
spam score = 60
title = 'uses of class orgapacheavalonfortressexamplesswingswingcontainer apache excalibur api'

distance = 530
spam score = 58
title = 'uses of class orgapachelogoutputiorotaterotatingfiletarget apache excalibur api'

distance = 531
spam score = 67
title = 'orgapacheexcaliburxml apache excalibur api'

distance = 532
spam score = 56
title = 'uses of class orgapachelogoutputiorotateuniquefilestrategy apache excalibur api'

distance = 537
spam score = 60
title = 'uses of interface orgapacheavalonframeworkactivitysuspendable apache excalibur api'

distance = 539
spam score = 77
title = 'uses of class orgapacheexcalibursourceimplhttpclientsourcefactory apache excalibur api'

distance = 542
spam score = 73
title = 'uses of package orgapacheavalonexcaliburdatasourceids apache excalibur api'

distance = 545
spam score = 71
title = 'orgapacheavalonframeworkactivity class hierarchy apache excalibur api'

distance = 545
spam score = 56
title = 'uses of interface orgapacheavalonfortressimplfactorywrapperclass apache excalibur api'

distance = 547
spam score = 75
title = 'orgapacheavalonexcaliburthreadimpl apache excalibur api'

distance = 548
spam score = 57
title = 'uses of class orgapachelogoutputiorotaterotatestrategybydate apache excalibur api'

distance = 625
spam score = 61
title = 'uses of interface orgapacheavalonexcaliburloggerlogkitmanageable apache excalibur api'

distance = 627
spam score = 63
title = 'uses of interface orgapacheavalonfortressimplhandlerreleasablecomponent apache excalibur api'

distance = 629
spam score = 70
title = 'uses of package orgapacheavalonfortressexamplesextendedextensions apache excalibur api'

distance = 637
spam score = 76
title = 'uses of class orgapacheavaloncornerstoneblocksconnectionabstractconnectionmanager apache excalibur api'

distance = 639
spam score = 67
title = 'uses of class orgapachelogutilloggerlistener apache excalibur api'

distance = 640
spam score = 70
title = 'uses of package orgapacheavalonfortressutildag apache excalibur api'

distance = 643
spam score = 59
title = 'uses of interface orgapacheexcaliburinstrumentmanagerdefaultinstrumentmanagerconnector apache excalibur api'

distance = 643
spam score = 79
title = 'uses of interface orgapacheavalonexcaliburmonitormonitor apache excalibur api'

distance = 643
spam score = 80
title = 'uses of interface orgapacheavalonexcaliburdatasourceclusterhasheddatasourcecluster apache excalibur api'

distance = 644
spam score = 69
title = 'uses of class orgapacheavaloncornerstoneblocksthreadsabstractthreadmanager apache excalibur api'

distance = 726
spam score = 74
title = 'orgapacheexcaliburxml class hierarchy apache excalibur api'

distance = 727
spam score = 62
title = 'uses of class orgapacheavalonfortressimplroleabstractrolemanager apache excalibur api'

distance = 727
spam score = 66
title = 'uses of interface orgapacheavaloncornerstoneservicesconnectionconnectionmanager apache excalibur api'

distance = 728
spam score = 61
title = 'uses of class orgapacheavalonexcaliburpoolsoftresourcelimitingpool apache excalibur api'

distance = 729
spam score = 75
title = 'orgapacheavalonfortressimplfactory class hierarchy apache excalibur api'

distance = 729
spam score = 74
title = 'uses of interface orgapacheavalonexcaliburdatasourceidsidgenerator apache excalibur api'

distance = 730
spam score = 72
title = 'uses of class orgapacheavalonframeworkversion apache excalibur api'

distance = 732
spam score = 80
title = 'orgapacheavalonfortressimplextensions class hierarchy apache excalibur api'

distance = 733
spam score = 60
title = 'uses of interface orgapacheexcaliburinstrumentclientinstrumentmanagerdata apache excalibur api'

distance = 735
spam score = 62
title = 'uses of interface orgapacheavalonfortressexamplesextendedextensionssecuritymanageable apache excalibur api'

distance = 851
spam score = 75
title = 'uses of class orgapacheavalonfortressimplcomponenthandlermetadata apache excalibur api'

distance = 854
spam score = 77
title = 'orgapacheexcaliburutilsystem apache excalibur api'

distance = 857
spam score = 62
title = 'uses of class orgapacheavalonframeworkvaluedenum apache excalibur api'

distance = 857
spam score = 67
title = 'uses of interface orgapacheavalonexcaliburpoolresizable apache excalibur api'

distance = 858
spam score = 79
title = 'uses of class orgapacheexcaliburstoreimplabstractreadwritestore apache excalibur api'

distance = 859
spam score = 62
title = 'uses of class orgapacheexcalibursourceimplabstractsource apache excalibur api'

distance = 859
spam score = 60
title = 'uses of class orgapacheavaloncornerstoneblockssocketssslfactorybuilder apache excalibur api'

distance = 860
spam score = 63
title = 'uses of class orgapacheavalonexcaliburcomponentdefaultcomponentfactory apache excalibur api'

distance = 860
spam score = 78
title = 'orgapacheavaloncornerstoneblocksmasterstorexml apache excalibur api'

distance = 861
spam score = 60
title = 'uses of interface orgapacheavalonexcaliburloggerlogkitmanager apache excalibur api'

distance = 1029
spam score = 64
title = 'uses of class orgapacheavalonframeworkconfigurationdefaultconfiguration apache excalibur api'

distance = 1029
spam score = 83
title = 'orgapacheavalonframeworkactivity apache excalibur api'

distance = 1031
spam score = 72
title = 'uses of interface orgapacheexcalibureventcommandcommand apache excalibur api'

distance = 1032
spam score = 58
title = 'uses of interface orgapacheavaloncornerstoneservicesschedulertriggerfailurelistener apache excalibur api'

distance = 1035
spam score = 66
title = 'uses of class orgapacheavaloncornerstoneblocksschedulertimescheduledentry apache excalibur api'

distance = 1035
spam score = 66
title = 'uses of interface orgapacheexcaliburmpoolpool apache excalibur api'

distance = 1036
spam score = 60
title = 'frgouvculturesdxresolverentity class hierarchy sdx 23b1 api'

distance = 1046
spam score = 65
title = 'uses of interface orgapacheexcalibureventcommandeventpipeline apache excalibur api'

distance = 1051
spam score = 63
title = 'uses of interface orgapacheavalonframeworkloggerloggable apache excalibur api'

distance = 1052
spam score = 70
title = 'orgapacheavalonexcaliburcomponent apache excalibur api'

distance = 1321
spam score = 85
title = 'orgapacheexcalibureventcommand apache excalibur api'

distance = 1332
spam score = 78
title = 'uses of package orgapacheexcalibursource apache excalibur api'

distance = 1379
spam score = 77
title = 'uses of package orgapachelogformat apache excalibur api'

distance = 1399
spam score = 61
title = 'uses of package orgapacheavalonexcaliburpool apache excalibur api'

distance = 1438
spam score = 57
title = 'uses of package orgapacheexcaliburevent apache excalibur api'

distance = 1448
spam score = 73
title = 'uses of class orgapacheavalonexcaliburdatasourceidsidexception apache excalibur api'

distance = 1458
spam score = 66
title = 'uses of package orgapacheexcaliburinstrumentmanager apache excalibur api'

distance = 1476
spam score = 74
title = 'uses of interface orgapacheavalonexcaliburpoolobjectfactory apache excalibur api'

distance = 280
spam score = 73
title = ''

distance = 317
spam score = 70
title = ''

distance = 329
spam score = 70
title = ''

distance = 334
spam score = 73
title = ''

distance = 338
spam score = 69
title = ''

distance = 344
spam score = 72
title = ''

distance = 350
spam score = 69
title = ''

distance = 356
spam score = 66
title = ''

distance = 360
spam score = 66
title = ''

distance = 368
spam score = 67
title = ''

distance = 377
spam score = 63
title = ''

distance = 385
spam score = 71
title = ''

distance = 401
spam score = 70
title = ''

distance = 414
spam score = 60
title = ''

distance = 415
spam score = 71
title = ''

distance = 416
spam score = 64
title = ''

distance = 417
spam score = 71
title = ''

distance = 435
spam score = 69
title = ''

distance = 435
spam score = 67
title = ''

distance = 443
spam score = 68
title = ''

distance = 470
spam score = 67
title = ''

distance = 477
spam score = 63
title = ''

distance = 480
spam score = 67
title = ''

distance = 491
spam score = 65
title = ''

distance = 492
spam score = 65
title = ''

distance = 493
spam score = 69
title = ''

distance = 506
spam score = 63
title = ''

distance = 506
spam score = 59
title = ''

distance = 507
spam score = 64
title = ''

distance = 507
spam score = 69
title = ''

distance = 518
spam score = 73
title = ''

distance = 556
spam score = 65
title = ''

distance = 580
spam score = 67
title = ''

distance = 613
spam score = 67
title = ''

distance = 614
spam score = 72
title = ''

distance = 674
spam score = 64
title = ''

distance = 674
spam score = 69
title = ''

distance = 683
spam score = 70
title = ''

distance = 687
spam score = 68
title = ''

distance = 687
spam score = 71
title = ''

distance = 693
spam score = 63
title = ''

distance = 693
spam score = 75
title = ''

distance = 694
spam score = 71
title = ''

distance = 705
spam score = 69
title = ''

distance = 753
spam score = 70
title = ''

distance = 767
spam score = 74
title = ''

distance = 804
spam score = 69
title = ''

distance = 836
spam score = 62
title = ''

distance = 936
spam score = 51
title = ''

distance = 943
spam score = 72
title = ''

distance = 1024
spam score = 68
title = ''

distance = 1025
spam score = 70
title = ''

distance = 1054
spam score = 57
title = ''

distance = 1069
spam score = 57
title = ''

distance = 1120
spam score = 62
title = ''

distance = 1282
spam score = 61
title = ''

distance = 1337
spam score = 59
title = ''

distance = 1358
spam score = 56
title = ''

distance = 190
spam score = 52
title = 'uses of class javarminaming java 2 platform se 50'

distance = 201
spam score = 56
title = 'uses of class javarmimarshalexception java 2 platform se 50'

distance = 205
spam score = 56
title = 'uses of class javalanginheritablethreadlocal java 2 platform se 50'

distance = 225
spam score = 56
title = 'uses of class javaiobytearrayinputstream java 2 platform se 50'

distance = 225
spam score = 53
title = 'uses of class javaiofilewriter java 2 platform se 50'

distance = 226
spam score = 56
title = 'uses of class javalangstringindexoutofboundsexception java 2 platform se 50'

distance = 227
spam score = 54
title = 'uses of class javautilformatflagsconversionmismatchexception java 2 platform se 50'

distance = 227
spam score = 52
title = 'uses of class javautilillegalformatflagsexception java 2 platform se 50'

distance = 227
spam score = 68
title = 'uses of class javalangsystem java 2 platform se 50'

distance = 229
spam score = 54
title = 'uses of class javautilstringtokenizer java 2 platform se 50'

distance = 229
spam score = 54
title = 'uses of class javaiochararrayreader java 2 platform se 50'

distance = 231
spam score = 50
title = 'uses of class javasecurityaccesscontroller java 2 platform se 50'

distance = 237
spam score = 52
title = 'uses of class javautilformattableflags java 2 platform se 50'

distance = 237
spam score = 53
title = 'uses of class javabeanspropertyeditorsupport java 2 platform se 50'

distance = 238
spam score = 73
title = 'uses of class javautilidentityhashmap java 2 platform se 50'

distance = 238
spam score = 51
title = 'uses of class javasecurityauthprovider java 2 platform se 50'

distance = 238
spam score = 53
title = 'uses of class javalangarithmeticexception java 2 platform se 50'

distance = 239
spam score = 52
title = 'uses of class javalangassertionerror java 2 platform se 50'

distance = 239
spam score = 73
title = 'uses of class javalangoverride java 2 platform se 50'

distance = 240
spam score = 54
title = 'uses of class javautilweakhashmap java 2 platform se 50'

distance = 400
spam score = 52
title = 'uses of class javautilconcurrentatomicatomicboolean java 2 platform se 50'

distance = 400
spam score = 62
title = 'uses of class javaawtawteventmulticaster java platform se 6'

distance = 401
spam score = 58
title = 'uses of class javanetmulticastsocket java platform se 6'

distance = 401
spam score = 62
title = 'uses of class javalangtypenotpresentexception java platform se 6'

distance = 401
spam score = 59
title = 'uses of class javasecurityspecrsakeygenparameterspec java 2 platform se 50'

distance = 401
spam score = 59
title = 'uses of interface javasecurityinterfacesdsaprivatekey java 2 platform se 50'

distance = 401
spam score = 60
title = 'uses of class javautiljarpack200 java 2 platform se 50'

distance = 402
spam score = 52
title = 'uses of class orgomgcorbaactivitycompleted java 2 platform se 50'

distance = 402
spam score = 57
title = 'uses of class javalangoutofmemoryerror java 2 platform se 50'

distance = 402
spam score = 51
title = 'uses of class javaxswingjspinnerdateeditor java 2 platform se 50'

distance = 450
spam score = 52
title = 'uses of class javaioinputstreamreader java 2 platform se 50'

distance = 450
spam score = 54
title = 'uses of class orgomgcorbaidltypehelper java 2 platform se v142'

distance = 450
spam score = 55
title = 'uses of class javarmiactivationactivatefailedexception java 2 platform se 50'

distance = 450
spam score = 54
title = 'uses of class javautilformatterclosedexception java 2 platform se 50'

distance = 450
spam score = 52
title = 'uses of class javalangmanagementmanagementfactory java 2 platform se 50'

distance = 451
spam score = 53
title = 'uses of class javaawtbuttonaccessibleawtbutton java 2 platform se 50'

distance = 451
spam score = 71
title = 'uses of class javaxswingtextstylededitorkititalicaction java 2 platform se 50'

distance = 452
spam score = 51
title = 'uses of class javaxmanagementremotermirmiconnectionimpl java 2 platform se 50'

distance = 452
spam score = 55
title = 'uses of interface javasecurityaclacl java 2 platform se 50'

distance = 452
spam score = 60
title = 'uses of class javaawttextareaaccessibleawttextarea java platform se 6'

distance = 502
spam score = 71
title = 'javaawtimspi class hierarchy java 2 platform se 50'

distance = 503
spam score = 57
title = 'uses of class javautilconcurrentatomicatomicmarkablereference java platform se 6'

distance = 503
spam score = 50
title = 'uses of interface javabeansbeancontextbeancontextproxy java 2 platform se 50'

distance = 503
spam score = 57
title = 'javaxswingfilechooser class hierarchy java 2 platform se 50'

distance = 504
spam score = 58
title = 'uses of class orgomgcorbacurrenthelper java platform se 6'

distance = 504
spam score = 62
title = 'uses of class javaawtgeomroundrectangle2dfloat java platform se 6'

distance = 505
spam score = 65
title = 'uses of class javaxprintattributestandardmediasizeiso java 2 platform se v142'

distance = 506
spam score = 57
title = 'uses of class javasecurityalgorithmparametersspi java 2 platform se v142'

distance = 506
spam score = 69
title = 'javalanginstrument class hierarchy java 2 platform se 50'

distance = 506
spam score = 59
title = 'uses of class javaawtgeomquadcurve2ddouble java platform se 6'

distance = 564
spam score = 55
title = 'javaniocharsetspi class hierarchy java 2 platform se 50'

distance = 565
spam score = 55
title = 'uses of class orgxmlsaxhelpersparserfactory java 2 platform se 50'

distance = 566
spam score = 53
title = 'uses of class javaawtfontshapegraphicattribute java 2 platform se 50'

distance = 567
spam score = 53
title = 'uses of class javasecurityacllastownerexception java 2 platform se 50'

distance = 567
spam score = 52
title = 'uses of class javarmiserveruid java 2 platform se v142'

distance = 567
spam score = 71
title = 'uses of class javaawtcoloriccprofilegray java 2 platform se 50'

distance = 567
spam score = 59
title = 'uses of class orgomgportableserverpoamanagerpackageadapterinactivehelper java 2 platform se 50'

distance = 567
spam score = 62
title = 'uses of interface javaappletappletstub java 2 platform se 50'

distance = 567
spam score = 52
title = 'uses of class javautilzipcrc32 java 2 platform se 50'

distance = 567
spam score = 55
title = 'uses of class javautilconcurrentatomicatomicreferencearray java 2 platform se 50'

distance = 649
spam score = 60
title = 'uses of class javautilconcurrentatomicatomiclongfieldupdater java 2 platform se 50'

distance = 650
spam score = 60
title = 'uses of class javaawttextcomponentaccessibleawttextcomponent java 2 platform se 50'

distance = 650
spam score = 44
title = 'java 2 platform se v131 uses of class javaawtborderlayout'

distance = 650
spam score = 62
title = 'uses of class javaawtcanvas java platform se 6'

distance = 653
spam score = 60
title = 'javaawtimspi class hierarchy java 2 platform se 50'

distance = 653
spam score = 54
title = 'uses of interface javalangmanagementoperatingsystemmxbean java 2 platform se 50'

distance = 655
spam score = 53
title = 'uses of class javaxmanagementmbeanserverdelegate java 2 platform se 50'

distance = 656
spam score = 57
title = 'uses of interface javabeanspropertyeditor java 2 platform se v142'

distance = 656
spam score = 51
title = 'uses of interface javautilloggingloggingmxbean java 2 platform se 50'

distance = 656
spam score = 62
title = 'uses of class javaawtcheckboxmenuitem java platform se 6'

distance = 741
spam score = 47
title = 'java 2 platform se v131 uses of class orgomgcorbacurrenthelper'

distance = 742
spam score = 56
title = 'uses of class javaxsecurityauthcallbackunsupportedcallbackexception java 2 platform se 50'

distance = 743
spam score = 63
title = 'uses of class javalangannotationretentionpolicy java 2 platform se 50'

distance = 745
spam score = 63
title = 'uses of class javaawttrayicon java platform se 6'

distance = 745
spam score = 48
title = 'uses of class javaxswingplafbasicbasiccomboboxuipropertychangehandler java 2 platform se 50'

distance = 746
spam score = 60
title = 'deprecated java 2 platform se 50'

distance = 746
spam score = 80
title = 'uses of class javalanginstrumentunmodifiableclassexception java platform se 6'

distance = 746
spam score = 61
title = 'uses of class javaioserializablepermission java 2 platform se 50'

distance = 747
spam score = 50
title = 'java 2 platform se v131 uses of class javarmiactivationactivationgroup'

distance = 747
spam score = 58
title = 'uses of class javaiopipedinputstream java 2 platform se 50'

distance = 829
spam score = 55
title = 'uses of interface javarmiserverrmifailurehandler java 2 platform se 50'

distance = 829
spam score = 75
title = 'uses of class javalangstacktraceelement java 2 platform se v142'

distance = 829
spam score = 58
title = 'uses of class javarmiserverrmisocketfactory java platform se 6'

distance = 830
spam score = 58
title = 'uses of class javautilzipdataformatexception java 2 platform se 50'

distance = 830
spam score = 60
title = 'uses of class javaawtiminputcontext java 2 platform se 50'

distance = 831
spam score = 67
title = 'uses of interface orgw3cdomcharacterdata java 2 platform se 50'

distance = 831
spam score = 65
title = 'uses of class javaawtiminputcontext java platform se 6'

distance = 832
spam score = 59
title = 'uses of class javautilprefsnodechangeevent java 2 platform se 50'

distance = 836
spam score = 50
title = 'uses of class javaxmanagementinvalidapplicationexception java 2 platform se 50'

distance = 837
spam score = 46
title = 'java 2 platform se v131 uses of package orgomgstubjavarmi'

distance = 981
spam score = 55
title = 'uses of class javatextnumberformatfield java 2 platform se 50'

distance = 982
spam score = 59
title = 'uses of class javautiluuid java 2 platform se 50'

distance = 982
spam score = 62
title = 'uses of class javaawtwindowaccessibleawtwindow java 2 platform se 50'

distance = 987
spam score = 48
title = 'java 2 platform se v131 uses of class javaawtiminputcontext'

distance = 987
spam score = 59
title = 'uses of class javaawtgeomroundrectangle2d java platform se 6'

distance = 988
spam score = 47
title = 'java 2 platform se v131 uses of class javarmialreadyboundexception'

distance = 989
spam score = 72
title = 'uses of interface javasecuritycertcertpathbuilderresult java 2 platform se v142'

distance = 990
spam score = 60
title = 'uses of class javabeansbeancontextbeancontextserviceavailableevent java 2 platform se v142'

distance = 991
spam score = 58
title = 'uses of class javalangbyte java 2 platform se 50'

distance = 993
spam score = 64
title = 'inherited java 2 platform se 50'

distance = 191
spam score = 48
title = 'uses of package orgapachetiles tiles 2 207 test api'

distance = 216
spam score = 49
title = 'uses of package orgapachetilesreflect tiles 2 207 api'

distance = 224
spam score = 56
title = 'uses of package orgapachetilesreflect tiles 2 212snapshot api'

distance = 226
spam score = 49
title = 'uses of package orgapachetilesutil tiles 2 207 api'

distance = 238
spam score = 45
title = 'uses of package orgapachetilescontext tiles 2 207 test api'

distance = 243
spam score = 45
title = 'uses of package orgapachetilespreparer tiles 2 207 test api'

distance = 256
spam score = 55
title = 'uses of package orgapachetilesaccess tiles 2 212snapshot api'

distance = 261
spam score = 59
title = 'uses of package orgapachetilesaccess tiles 2 207 api'

distance = 261
spam score = 54
title = 'uses of package orgapachetileswebutil tiles 2 207 api'

distance = 265
spam score = 46
title = 'uses of package orgapachetilesdefinition tiles 2 207 test api'

distance = 273
spam score = 48
title = 'uses of package orgapachetilesdefinitiondigester tiles 2 207 api'

distance = 277
spam score = 48
title = 'uses of package orgapachetilesjspcontext tiles 2 207 api'

distance = 277
spam score = 50
title = 'uses of package orgapachetilescontextenhanced tiles 2 207 api'

distance = 281
spam score = 43
title = 'uses of package orgapachetilesfactory tiles 2 207 test api'

distance = 282
spam score = 52
title = 'uses of package orgapachetilesdefinitionutil tiles 2 207 api'

distance = 288
spam score = 51
title = 'uses of package orgapachetilesaccess tiles 2 207 test api'

distance = 289
spam score = 47
title = 'orgapachetiles tiles 2 207 test api'

distance = 291
spam score = 51
title = 'orgapachetilesaccess tiles 2 207 test api'

distance = 298
spam score = 47
title = 'uses of package orgapachetileslocaleimpl tiles 2 207 api'

distance = 303
spam score = 53
title = 'uses of package orgapachetilesservletcontext tiles 2 207 test api'

distance = 401
spam score = 57
title = 'uses of class orgapachetilesservletcontextservletutil tiles 2 212snapshot api'

distance = 403
spam score = 48
title = 'uses of class orgapachetileswebutiltilesdispatchservlet tiles 2 207 api'

distance = 403
spam score = 47
title = 'uses of class orgapachetilesfactorytilescontainerfactorytesttestfactory tiles 2 207 test api'

distance = 404
spam score = 52
title = 'uses of class orgapachetilesfactorybasictilescontainerfactory tiles 2 212snapshot api'

distance = 406
spam score = 55
title = 'uses of class orgapachetileswebutilservletcontextadapter tiles 2 212snapshot api'

distance = 407
spam score = 47
title = 'uses of class orgapachetilesservletcontextservletsessionscopemaptest tiles 2 207 test api'

distance = 408
spam score = 43
title = 'uses of class orgapachetilesjspcontextjsptilescontextfactory tiles 2 207 api'

distance = 409
spam score = 59
title = 'orgapachetilesfactory class hierarchy tiles 2 207 api'

distance = 410
spam score = 60
title = 'orgapachetileslocale class hierarchy'

distance = 410
spam score = 51
title = 'uses of class orgapachetilescontextmapentry tiles 2 212snapshot api'

distance = 470
spam score = 53
title = 'uses of class orgapachetilesevaluatorelelcontextimpl tiles 2 212snapshot api'

distance = 470
spam score = 52
title = 'orgapachetilesdefinitiondigester class hierarchy tiles 2 207 api'

distance = 471
spam score = 61
title = 'orgapachetilesaccess class hierarchy'

distance = 471
spam score = 58
title = 'uses of interface orgapachetilesbeansmenuitem tiles 2 212snapshot api'

distance = 472
spam score = 49
title = 'uses of class orgapachetilescompatpreparercompatibilitypreparerfactory tiles 2 212snapshot api'

distance = 472
spam score = 61
title = 'orgapachetiles'

distance = 473
spam score = 57
title = 'uses of class orgapachetilesportletcontextwildcardwildcardportlettilesapplicationcontext tiles 2 212snapshot api'

distance = 473
spam score = 58
title = 'uses of class orgapachetilescompatdefinitiondigestercompatibilitydigesterdefinitionsreader tiles 2 212snapshot api'

distance = 478
spam score = 65
title = 'orgapachetileslocaleimpl class hierarchy tiles 2 207 api'

distance = 478
spam score = 53
title = 'uses of class orgapachetilesrendererimpltemplateattributerenderer tiles 2 212snapshot api'

distance = 542
spam score = 58
title = 'uses of package orgapachetilesservletcontext tiles 2 212snapshot api'

distance = 543
spam score = 63
title = 'orgapachetilesbeans tiles 2 207 api'

distance = 544
spam score = 58
title = 'uses of class orgapachetilescontextchainedtilescontextfactory tiles 2 207 api'

distance = 545
spam score = 57
title = 'orgapachetilesservletcontextwildcard'

distance = 550
spam score = 53
title = 'uses of interface orgapachetilesdefinitionreloadabledefinitionsfactory tiles 2 207 api'

distance = 551
spam score = 58
title = 'orgapachetilesjspcontext'

distance = 552
spam score = 52
title = 'uses of class orgapachelog4jlf5appenderfinalizer apache log4j 1215 api'

distance = 553
spam score = 57
title = 'orgapachetilesevaluatorimpl class hierarchy'

distance = 556
spam score = 58
title = 'uses of package orgapachehttpnioprotocol httpcore nio 40beta4snapshot test api'

distance = 556
spam score = 63
title = 'orgapachetilescompatdefinitiondigester class hierarchy'

distance = 612
spam score = 57
title = 'uses of package orgapachelog4jvaria apache log4j 1215 api'

distance = 612
spam score = 57
title = 'orgapachetilesutil class hierarchy'

distance = 613
spam score = 65
title = 'deprecated list fulcrum quartz 11snapshot test api'

distance = 613
spam score = 55
title = 'uses of class orgapachexmlrpcserializerobjectarrayserializer apache xmlrpc 311 api'

distance = 614
spam score = 58
title = 'uses of package orgapachetilesservletcontext tiles 2 207 api'

distance = 614
spam score = 56
title = 'uses of class orgapachetilesportletcontextportlettilesapplicationcontext tiles 2 212snapshot api'

distance = 616
spam score = 53
title = 'uses of class orgapachetilespreparerbasicpreparerfactory tiles 2 212snapshot api'

distance = 616
spam score = 62
title = 'orgapachetilesjspevaluatorel class hierarchy'

distance = 617
spam score = 60
title = 'orgapachetilesportletcontext class hierarchy tiles 2 207 api'

distance = 617
spam score = 62
title = 'orgapachetilesaccess tiles 2 212snapshot api'

distance = 663
spam score = 71
title = 'uses of class orgapachelog4jhelpersdatelayout apache log4j 1215 api'

distance = 663
spam score = 60
title = 'uses of class orgapachehttpmockuptesthttpsslserver httpcore nio 40beta4snapshot test api'

distance = 664
spam score = 50
title = 'uses of class orgapachelog4jlf5viewerconfiguremrufilemanager apache log4j 1215 api'

distance = 665
spam score = 67
title = 'orgapachelog4jjdbc apache log4j 1215 api'

distance = 666
spam score = 62
title = 'uses of class orgapachetilesjsptaglibinsertattributetag tiles 2 212snapshot api'

distance = 671
spam score = 57
title = 'uses of interface orgapachetilesjsptaglibaddattributetagparent tiles 2 207 api'

distance = 674
spam score = 66
title = 'uses of package orgapachetilesmgmt tiles 2 212snapshot api'

distance = 674
spam score = 62
title = 'orgapachetilesjspevaluatorel tiles 2 212snapshot api'

distance = 674
spam score = 52
title = 'uses of class orgapachelog4jlf5lf5appender apache log4j 1215 api'

distance = 677
spam score = 52
title = 'uses of class orgapachelog4jlf5viewercategoryexplorercategorynodeeditorrenderer apache log4j 1215 api'

distance = 726
spam score = 47
title = 'orgapacheplutotestsuitetestjsr286 pluto testsuite portlet 200snapshot api'

distance = 727
spam score = 52
title = 'uses of class orgapachehttpconnschemeplainsocketfactory httpclient 40beta2 api'

distance = 732
spam score = 61
title = 'orgapachetilesservletcontext class hierarchy'

distance = 733
spam score = 73
title = 'orgapachetilesjspcontext tiles 2 212snapshot api'

distance = 735
spam score = 57
title = 'orgapachetilesdefinition class hierarchy tiles 2 207 test api'

distance = 737
spam score = 73
title = 'orgapachetilesrenderer tiles 2 212snapshot api'

distance = 744
spam score = 57
title = 'uses of class orgapachehttpclientmethodshttpentityenclosingrequestbase httpclient 40beta2 api'

distance = 747
spam score = 54
title = 'uses of package orgapachehttpauthparams httpclient 40beta2 api'

distance = 747
spam score = 53
title = 'uses of interface orgapachehttpparamscoreprotocolpnames httpcore 40beta4snapshot api'

distance = 752
spam score = 49
title = 'uses of class orgapachetilesimplmgmtdefinitionmanager tiles 2 207 api'

distance = 806
spam score = 64
title = 'uses of class orgapachetilesdefinitionlocaledefinitionsfactory tiles 2 212snapshot api'

distance = 808
spam score = 53
title = 'uses of class orgapachejamespostagestartupexception apache james postage 01snapshot api'

distance = 812
spam score = 53
title = 'uses of class orgapachetilesfactorytilescontainerfactory tiles 2 212snapshot api'

distance = 816
spam score = 56
title = 'uses of class orgapachehttpimplauthrfc2617scheme httpclient 40beta2 api'

distance = 818
spam score = 77
title = 'orgapachetilesrendererimpl tiles 2 212snapshot api'

distance = 818
spam score = 54
title = 'uses of package orgapachelog4jlf5viewerconfigure apache log4j 1215 api'

distance = 819
spam score = 58
title = 'orgapachetilesevaluatorel'

distance = 825
spam score = 75
title = 'orgapachetilesimplmgmt tiles 2 212snapshot api'

distance = 828
spam score = 50
title = 'uses of interface orgapachehttpcookieparamscookiespecpnames httpclient 40beta2 api'

distance = 829
spam score = 63
title = 'orgapachetilesdefinitiondao class hierarchy'

distance = 954
spam score = 73
title = 'orgapachetilesdefinition tiles 2 207 api'

distance = 955
spam score = 60
title = 'uses of package orgapachexmlrpcutil apache xmlrpc 311 api'

distance = 959
spam score = 77
title = 'orgapachetilesjsptaglibdefinition tiles 2 212snapshot api'

distance = 959
spam score = 71
title = 'orgapachetilespreparer tiles 2 207 api'

distance = 961
spam score = 56
title = 'uses of class orgapachehttpimplconntsccmbasicpoolentryref httpclient 40beta2 api'

distance = 964
spam score = 60
title = 'uses of package orgapachehttpimplniocodecs httpcore nio 40beta4snapshot api'

distance = 965
spam score = 63
title = 'uses of interface orgapachetilesawarenesstilesrequestcontextfactoryaware tiles 2 212snapshot api'

distance = 967
spam score = 60
title = 'overview httpclient 40beta2 test api'

distance = 968
spam score = 51
title = 'uses of package orgapachexmlrpcmetadata apache xmlrpc 311 api'

distance = 969
spam score = 73
title = 'orgapachetilespreparer tiles 2 212snapshot api'

distance = 1196
spam score = 57
title = 'uses of interface orgapachetilesdefinitiondefinitionsreader tiles 2 212snapshot api'

distance = 1220
spam score = 60
title = 'uses of class orgapachetilesdefinitionnosuchdefinitionexception tiles 2 207 api'

distance = 1226
spam score = 63
title = 'uses of interface orgapachehttpnioentityconsumingnhttpentity httpcore nio 40beta4snapshot api'

distance = 1299
spam score = 69
title = 'uses of interface orgapachetilesdefinitiondaodefinitiondao tiles 2 212snapshot api'

distance = 1304
spam score = 60
title = 'uses of class orgapachetilesimplbasictilescontainer tiles 2 207 api'

distance = 1346
spam score = 66
title = 'uses of interface orgapachetilesawarenesstilesapplicationcontextaware tiles 2 212snapshot api'

distance = 1423
spam score = 58
title = 'uses of class orgapachelog4jappenderskeleton apache log4j 1215 api'

distance = 1774
spam score = 80
title = 'conservation of 147the ram in the thicket148 university of pennsylvania museum of archaeology and anthropology'

distance = 189
spam score = 57
title = 'uses of package defaucswww8jadeowlcodecexamplesowlengageexample jadeowlcodec v08 api'

distance = 195
spam score = 49
title = 'uses of package defaucswww8jadeowlcodectest jadeowlcodec v08 api'

distance = 211
spam score = 48
title = 'uses of class defaucswww8jadeowlcodectboxmergingtboxmerger jadeowlcodec v08 api'

distance = 215
spam score = 58
title = 'uses of package defaucswww8jadeowlcodectboxmerging jadeowlcodec v08 api'

distance = 218
spam score = 50
title = 'uses of class defaucswww8jadeowlcodecbuiltinclassdescriptions jadeowlcodec v08 api'

distance = 219
spam score = 57
title = 'uses of package defaucswww8jadeowlcodecgenerator jadeowlcodec v08 api'

distance = 226
spam score = 47
title = 'uses of class defaucswww8jadeowlcodecaboxrollbackbuffer jadeowlcodec v08 api'

distance = 231
spam score = 50
title = 'uses of class defaucswww8jadeowlcodeccheckedcumulatingasetupdater jadeowlcodec v08 api'

distance = 233
spam score = 48
title = 'uses of class defaucswww8jadeowlcodecdummyindividualsetexpander jadeowlcodec v08 api'

distance = 252
spam score = 49
title = 'uses of class defaucswww8jadeowlcodecabstractindividualwrapper jadeowlcodec v08 api'

distance = 254
spam score = 56
title = 'uses of package defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexample jadeowlcodec v08 api'

distance = 259
spam score = 54
title = 'uses of class defaucswww8jadeowlcodectooldebughelper jadeowlcodec v08 api'

distance = 263
spam score = 48
title = 'uses of class defaucswww8jadeowlcodectesttestabox jadeowlcodec v08 api'

distance = 270
spam score = 48
title = 'uses of class defaucswww8jadeowlcodectooldebugwriter jadeowlcodec v08 api'

distance = 271
spam score = 52
title = 'uses of package defaucswww8jadeowlcodecexamplesowlengageexampleontology jadeowlcodec v08 api'

distance = 280
spam score = 51
title = 'uses of class defaucswww8jadeowlcodectoolsparsebitfield jadeowlcodec v08 api'

distance = 281
spam score = 59
title = 'uses of package defaucswww8jadeowlcodecexamplesjadeoriginalontology jadeowlcodec v08 api'

distance = 286
spam score = 48
title = 'uses of class defaucswww8jadeowlcodectesturibuffertest jadeowlcodec v08 api'

distance = 291
spam score = 57
title = 'uses of package defaucswww8jadeowlcodecrendering jadeowlcodec v08 api'

distance = 291
spam score = 50
title = 'uses of class defaucswww8jadeowlcodectestrunstuff jadeowlcodec v08 api'

distance = 327
spam score = 49
title = 'uses of class defaucswww8jadeowlcodectestowl2dig jadeowlcodec v08 api'

distance = 331
spam score = 53
title = 'uses of package defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexamplejadebehaviours jadeowlcodec v08 api'

distance = 332
spam score = 55
title = 'uses of package defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlbehaviour jadeowlcodec v08 api'

distance = 332
spam score = 61
title = 'defaucswww8jadeowlcodecexamplesowlengageexampleontology jadeowlcodec v08 api'

distance = 333
spam score = 57
title = 'defaucswww8jadeowlcodecrendering jadeowlcodec v08 api'

distance = 338
spam score = 53
title = 'defaucswww8jadeowlcodecrendering class hierarchy jadeowlcodec v08 api'

distance = 342
spam score = 51
title = 'uses of class defaucswww8jadeowlcodecexamplesjadeoriginalontologyengageragent jadeowlcodec v08 api'

distance = 346
spam score = 47
title = 'uses of class defaucswww8jadeowlcodectoolhelpersimpleiterator jadeowlcodec v08 api'

distance = 349
spam score = 49
title = 'uses of class defaucswww8jadeowlcodecexamplesowlengageexampleontologyuriconstants jadeowlcodec v08 api'

distance = 353
spam score = 57
title = 'uses of class defaucswww8jadeowlcodecexamplesjadeoriginalontologyrequesteragent jadeowlcodec v08 api'

distance = 382
spam score = 55
title = 'uses of class defaucswww8jadeowlcodecexamplesjadeoriginalontologyemploymentengage jadeowlcodec v08 api'

distance = 386
spam score = 51
title = 'uses of class defaucswww8jadeowlcodectooldig11extendedclassaxiomrenderingvisitor jadeowlcodec v08 api'

distance = 388
spam score = 49
title = 'uses of class defaucswww8jadeowlcodecexamplesjadeoriginalontologyemploymentpersontooold jadeowlcodec v08 api'

distance = 393
spam score = 67
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlontology jadeowlcodec v08 api'

distance = 395
spam score = 46
title = 'uses of class defaucswww8jadeowlcodectooldig11extendeddescriptionsrenderer jadeowlcodec v08 api'

distance = 396
spam score = 48
title = 'uses of class defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlbehaviourowlhandleengagebehaviour jadeowlcodec v08 api'

distance = 398
spam score = 55
title = 'uses of package defaucswww8jadeowlcodecaboxupdater jadeowlcodec v08 api'

distance = 398
spam score = 49
title = 'uses of class defaucswww8jadeowlcodectooldig11extendedpropertyaxiomrenderingvisitor jadeowlcodec v08 api'

distance = 401
spam score = 49
title = 'uses of class defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlbehaviourowlcheckalreadyworkingbehaviour jadeowlcodec v08 api'

distance = 404
spam score = 48
title = 'defaucswww8jadeowlcodectboxmerging jadeowlcodec v08 api'

distance = 427
spam score = 54
title = 'uses of class defaucswww8jadeowlcodectriplestoreabstriple jadeowlcodec v08 api'

distance = 431
spam score = 68
title = 'defaucswww8jadeowlcodectboxmerging jadeowlcodec v08 api'

distance = 431
spam score = 68
title = 'defaucswww8jadeowlcodectest jadeowlcodec v08 api'

distance = 432
spam score = 51
title = 'uses of class defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexamplejadebehaviourshandleengagebehaviour jadeowlcodec v08 api'

distance = 435
spam score = 50
title = 'uses of class defaucswww8jadeowlcodectoolabsbitfield jadeowlcodec v08 api'

distance = 435
spam score = 59
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlontology class hierarchy jadeowlcodec v08 api'

distance = 435
spam score = 47
title = 'uses of class defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlontologyfaidfactory jadeowlcodec v08 api'

distance = 440
spam score = 50
title = 'uses of class defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexamplejadebehaviourshandleengagementbehaviour jadeowlcodec v08 api'

distance = 441
spam score = 50
title = 'defaucswww8jadeowlcodecgenerator jadeowlcodec v08 api'

distance = 442
spam score = 52
title = 'uses of class defaucswww8jadeowlcodecdatatypesdatatypemanagerclassnotregisteredexception jadeowlcodec v08 api'

distance = 537
spam score = 46
title = 'defaucswww8jadeowlcodecexamplesjadeoriginalontologyemployment jadeowlcodec v08 api'

distance = 544
spam score = 52
title = 'defaucswww8jadeowlcodecexamplesowlengageexampleontologyowl class hierarchy jadeowlcodec v08 api'

distance = 546
spam score = 52
title = 'uses of class defaucswww8jadeowlcodecgeneratorwrappergenerator jadeowlcodec v08 api'

distance = 553
spam score = 66
title = 'defaucswww8jadeowlcodecexamplesjadeoriginalontologyemployment jadeowlcodec v08 api'

distance = 556
spam score = 62
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexamplejadeontology jadeowlcodec v08 api'

distance = 556
spam score = 51
title = 'defaucswww8jadeowlcodecgenerator class hierarchy jadeowlcodec v08 api'

distance = 565
spam score = 57
title = 'defaucswww8jadeowlcodectboxmerging class hierarchy jadeowlcodec v08 api'

distance = 573
spam score = 60
title = 'defaucswww8jadeowlcodecexamplesowlengageexample class hierarchy jadeowlcodec v08 api'

distance = 580
spam score = 43
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexamplejadeontology jadeowlcodec v08 api'

distance = 581
spam score = 55
title = 'uses of package defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlontologyowl jadeowlcodec v08 api'

distance = 618
spam score = 64
title = 'defaucswww8jadeowlcodectest class hierarchy jadeowlcodec v08 api'

distance = 621
spam score = 53
title = 'uses of package defaucswww8jadeowlcodectooldig11extended jadeowlcodec v08 api'

distance = 622
spam score = 61
title = 'deprecated list jadeowlcodec v08 api'

distance = 623
spam score = 50
title = 'uses of class defaucswww8jadeowlcodecdatatypesdatatypemanagerurinotregisteredexception jadeowlcodec v08 api'

distance = 624
spam score = 51
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlontologyowl class hierarchy jadeowlcodec v08 api'

distance = 627
spam score = 61
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexample class hierarchy jadeowlcodec v08 api'

distance = 629
spam score = 67
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlontologyowl jadeowlcodec v08 api'

distance = 629
spam score = 70
title = 'defaucswww8jadeowlcodecexamplesjadeoriginalontology jadeowlcodec v08 api'

distance = 635
spam score = 56
title = 'defaucswww8jadeowlcodecaboxupdater jadeowlcodec v08 api'

distance = 651
spam score = 53
title = 'defaucswww8jadeowlcodecaboxupdater class hierarchy jadeowlcodec v08 api'

distance = 720
spam score = 48
title = 'defaucswww8jadeowlcodecexamplesowlengageexampleontologyf class hierarchy jadeowlcodec v08 api'

distance = 734
spam score = 51
title = 'uses of class defaucswww8jadeowlcodecowlclassdescription jadeowlcodec v08 api'

distance = 739
spam score = 57
title = 'uses of class defaucswww8jadeowlcodectboxnormalisationnormalizedimplications jadeowlcodec v08 api'

distance = 751
spam score = 65
title = 'defaucswww8jadeowlcodectboxnormalisation class hierarchy jadeowlcodec v08 api'

distance = 753
spam score = 45
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlbehaviour jadeowlcodec v08 api'

distance = 755
spam score = 55
title = 'defaucswww8jadeowlcodecdatatypes class hierarchy jadeowlcodec v08 api'

distance = 768
spam score = 57
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlbehaviour jadeowlcodec v08 api'

distance = 771
spam score = 72
title = 'overview jadeowlcodec v08 api'

distance = 772
spam score = 56
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexamplejadeontology class hierarchy jadeowlcodec v08 api'

distance = 777
spam score = 48
title = 'defaucswww8jadeowlcodecexamplesowlengageexampleontologyowl jadeowlcodec v08 api'

distance = 844
spam score = 54
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlbehaviour class hierarchy jadeowlcodec v08 api'

distance = 847
spam score = 55
title = 'uses of class defaucswww8jadeowlcodectoolcanonicalizedimmutable jadeowlcodec v08 api'

distance = 850
spam score = 53
title = 'uses of class defaucswww8jadeowlcodecaboxupdatersolution jadeowlcodec v08 api'

distance = 876
spam score = 49
title = 'uses of interface defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexampleowlontologyowlalldifferent jadeowlcodec v08 api'

distance = 881
spam score = 59
title = 'defaucswww8jadeowlcodecexamplestransformationjadeontology2owlexamplejadebehaviours class hierarchy jadeowlcodec v08 api'

distance = 896
spam score = 54
title = 'uses of package defaucswww8jadeowlcodecexamplesowlengageexampleontologyf jadeowlcodec v08 api'

distance = 896
spam score = 50
title = 'uses of class defaucswww8jadeowlcodectboxnormalisationabsmultijoined jadeowlcodec v08 api'

distance = 901
spam score = 50
title = 'uses of class defaucswww8jadeowlcodecdatatypesdatatypehandlerxsdrangeexception jadeowlcodec v08 api'

distance = 906
spam score = 55
title = 'uses of class defaucswww8jadeowlcodectboxnormalisationinverseconcept jadeowlcodec v08 api'

distance = 914
spam score = 49
title = 'uses of class defaucswww8jadeowlcodecabstractasetupdater jadeowlcodec v08 api'

distance = 982
spam score = 56
title = 'uses of class defaucswww8jadeowlcodectboxnormalisationonlyroleconcept jadeowlcodec v08 api'

distance = 990
spam score = 48
title = 'uses of class defaucswww8jadeowlcodectboxnormalisationnamedconcept jadeowlcodec v08 api'

distance = 1002
spam score = 54
title = 'defaucswww8jadeowlcodectriplestore jadeowlcodec v08 api'

distance = 1005
spam score = 56
title = 'defaucswww8jadeowlcodecdatatypes jadeowlcodec v08 api'

distance = 1008
spam score = 66
title = 'defaucswww8jadeowlcodecdatatypes jadeowlcodec v08 api'

distance = 1008
spam score = 64
title = 'defaucswww8jadeowlcodectriplestore jadeowlcodec v08 api'

distance = 1029
spam score = 44
title = 'uses of class defaucswww8jadeowlcodecbooleandignodehandling jadeowlcodec v08 api'

distance = 1031
spam score = 45
title = 'defaucswww8jadeowlcodectool jadeowlcodec v08 api'

distance = 1041
spam score = 53
title = 'uses of class defaucswww8jadeowlcodecdatatypesdatatypemanager jadeowlcodec v08 api'

distance = 1041
spam score = 63
title = 'defaucswww8jadeowlcodectool jadeowlcodec v08 api'

distance = 1760
spam score = 44
title = 'cs123support hierarchical index'

distance = 1875
spam score = 12
title = 'artwork of d wholesale picture frame oil painting moulding mirror d006'

distance = 1887
spam score = 43
title = 'ecological archives e086020a2'

distance = 70
spam score = 59
title = 'uses of package comuwynrife rife api 161'

distance = 122
spam score = 60
title = 'uses of package comuwynrifeservlet rife api 161'

distance = 137
spam score = 55
title = 'uses of class comuwynrifeversion rife api 161'

distance = 192
spam score = 53
title = 'uses of class comuwynrifexmlexceptionsparserexecutionerrorexception rife api 161'

distance = 194
spam score = 52
title = 'comuwynrife class hierarchy rife api 161'

distance = 195
spam score = 60
title = 'uses of package comuwynrifesiteinstrument rife api 161'

distance = 196
spam score = 61
title = 'uses of package comuwynrifeswingdocuments rife api 161'

distance = 200
spam score = 59
title = 'uses of package comuwynrifeschedulertaskmanagersexceptions rife api 161'

distance = 202
spam score = 61
title = 'uses of package comuwynrifefeedelements rife api 161'

distance = 209
spam score = 54
title = 'uses of class comuwynrifexmlexceptionscantfindentityexception rife api 161'

distance = 209
spam score = 53
title = 'uses of class comuwynrifexmlexceptionscantfindresourceexception rife api 161'

distance = 209
spam score = 57
title = 'uses of package comuwynrifeengineelements rife api 161'

distance = 210
spam score = 61
title = 'uses of package comuwynrifeschedulertaskoptionmanagersexceptions rife api 161'

distance = 211
spam score = 54
title = 'uses of class comuwynrifetemplateexceptionsattributenotendedexception rife api 161'

distance = 211
spam score = 54
title = 'uses of class comuwynrifeconfigexceptionscantfindxmlpathexception rife api 161'

distance = 211
spam score = 61
title = 'uses of package comuwynriferepparticipants rife api 161'

distance = 211
spam score = 53
title = 'uses of class comuwynrifexmlexceptionsfatalparsingerrorsexception rife api 161'

distance = 212
spam score = 55
title = 'uses of class comuwynrifetemplateexceptionsblockunknownexception rife api 161'

distance = 212
spam score = 53
title = 'uses of class comuwynriferepexceptionsparticipantnotfoundexception rife api 161'

distance = 212
spam score = 60
title = 'uses of package comuwynrifeswingactions rife api 161'

distance = 244
spam score = 56
title = 'uses of class comuwynrifeschedulerexceptionsexecutoralreadyregisteredexception rife api 161'

distance = 245
spam score = 53
title = 'uses of class comuwynriferesourcesexceptionsresourceupdateerrorexception rife api 161'

distance = 247
spam score = 53
title = 'uses of class comuwynrifeinstrumentinitialtransformer rife api 161'

distance = 255
spam score = 54
title = 'uses of class comuwynrifemailexceptionsinstallmailqueueerrorexception rife api 161'

distance = 264
spam score = 61
title = 'uses of package comuwynrifetestexceptions rife api 161'

distance = 265
spam score = 59
title = 'uses of package comuwynrifecmfloaderimage rife api 161'

distance = 267
spam score = 48
title = 'uses of interface comuwynrifetemplatevaluerenderer rife api 161'

distance = 269
spam score = 57
title = 'uses of package comuwynrifeconfig rife api 161'

distance = 276
spam score = 54
title = 'uses of class comuwynrifecmfdamexceptionsordinalrestrictioncantbenullexception rife api 161'

distance = 280
spam score = 54
title = 'uses of class comuwynrifecmfdamexceptionsunknownordinalrestrictionexception rife api 161'

distance = 308
spam score = 53
title = 'uses of class comuwynrifemaildamdatabasemailqueuefactory rife api 161'

distance = 308
spam score = 53
title = 'uses of interface comuwynrifefeedentryprovider rife api 161'

distance = 309
spam score = 55
title = 'uses of class comuwynrifeschedulerschedulermanagersexceptionsschedulernotfoundexception rife api 161'

distance = 309
spam score = 56
title = 'uses of class comuwynrifeauthenticationsessionmanagersexceptionseraseusersessionserrorexception rife api 161'

distance = 310
spam score = 54
title = 'uses of class comuwynrifeschedulerschedulermanagersexceptionsmodificationtimeerrorexception rife api 161'

distance = 310
spam score = 56
title = 'uses of class comuwynrifeauthenticationsessionmanagersexceptionsinstallsessionserrorexception rife api 161'

distance = 310
spam score = 52
title = 'uses of class comuwynrifeschedulertaskoptionmanagersexceptionsremovetaskoptionerrorexception rife api 161'

distance = 310
spam score = 54
title = 'uses of class comuwynrifeauthenticationsessionmanagersexceptionspurgesessionserrorexception rife api 161'

distance = 312
spam score = 52
title = 'uses of class comuwynrifeschedulertaskoptionmanagersexceptionsinstalltaskoptionserrorexception rife api 161'

distance = 313
spam score = 50
title = 'uses of class comuwynrifecmfformatimageformatter rife api 161'

distance = 376
spam score = 52
title = 'uses of class comuwynrifedatabasequerymanagersgenericabstractcallbacks rife api 161'

distance = 376
spam score = 52
title = 'uses of class comuwynrifeschedulerschedulermanagersxml2memoryscheduler rife api 161'

distance = 376
spam score = 52
title = 'uses of class comuwynrifecmfdamcontentstoresdatabasetextstorefactory rife api 161'

distance = 378
spam score = 53
title = 'uses of class comuwynrifecmfdamcontentstoresexceptionshascontentdataerrorexception rife api 161'

distance = 378
spam score = 54
title = 'uses of class comuwynrifedatabasequerymanagersgenericexceptionsmissingmanytoonemainpropertyexception rife api 161'

distance = 379
spam score = 51
title = 'uses of class comuwynrifedatabasequerymanagersgenericexceptionsunsupportedmanytoonevaluetypeexception rife api 161'

distance = 379
spam score = 54
title = 'uses of class comuwynrifecmfdamcontentstoresexceptionsdeletecontentdataerrorexception rife api 161'

distance = 381
spam score = 50
title = 'uses of class comuwynrifedatabasequerymanagersgenericgenericquerymanagerrelationalutils rife api 161'

distance = 382
spam score = 59
title = 'comuwynrifesiteinstrument class hierarchy rife api 161'

distance = 382
spam score = 56
title = 'uses of class comuwynrifecmfdamcontentstoresexceptionsretrievesizeerrorexception rife api 161'

distance = 527
spam score = 54
title = 'uses of class comuwynrifecmfloaderxhtmlcontentloaderbackend rife api 161'

distance = 530
spam score = 56
title = 'comuwynrifesiteexceptions class hierarchy rife api 161'

distance = 533
spam score = 56
title = 'comuwynrifecmfvalidation class hierarchy rife api 161'

distance = 537
spam score = 62
title = 'uses of package comuwynrifecmfdamcontentmanagers rife api 161'

distance = 538
spam score = 66
title = 'uses of package comuwynrifeauthenticationsessionvalidators rife api 161'

distance = 542
spam score = 72
title = 'comuwynrifeschedulerschedulermanagers rife api 161'

distance = 543
spam score = 72
title = 'comuwynrifemaildam rife api 161'

distance = 543
spam score = 70
title = 'comuwynrifeschedulerexceptions rife api 161'

distance = 543
spam score = 56
title = 'comuwynrifeselector class hierarchy rife api 161'

distance = 546
spam score = 53
title = 'uses of class comuwynrifeschedulertaskoptionmanagersdatabasetaskoptions rife api 161'

distance = 627
spam score = 56
title = 'uses of class comuwynrifedatabasequeriessequencevalueoperation rife api 161'

distance = 632
spam score = 57
title = 'uses of interface comuwynrifesitetextualidentifiergenerator rife api 161'

distance = 632
spam score = 57
title = 'comuwynrifemailexceptions class hierarchy rife api 161'

distance = 638
spam score = 66
title = 'uses of class comuwynrifecontinuationsinstrumentcontinuationstransformer rife api 161'

distance = 639
spam score = 64
title = 'comuwynrifecmfelements rife api 161'

distance = 648
spam score = 59
title = 'comuwynrifecontinuationsinstrument class hierarchy rife api 161'

distance = 650
spam score = 52
title = 'uses of class comuwynrifedatabasequerymanagersgenericexceptionsincompatiblemanytoonevaluetypeexception rife api 161'

distance = 650
spam score = 55
title = 'comuwynrifecmfloader class hierarchy rife api 161'

distance = 654
spam score = 58
title = 'uses of interface comuwynrifeschedulertaskoptionmanager rife api 161'

distance = 655
spam score = 54
title = 'comuwynrifexmlexceptions class hierarchy rife api 161'

distance = 744
spam score = 52
title = 'uses of class comuwynrifeenginebeandeclaration rife api 161'

distance = 747
spam score = 59
title = 'comuwynrifeauthenticationremembermanagers class hierarchy rife api 161'

distance = 749
spam score = 58
title = 'comuwynrifeschedulertaskoptionmanagers class hierarchy rife api 161'

distance = 751
spam score = 59
title = 'comuwynrifeauthenticationelementsexceptions class hierarchy rife api 161'

distance = 751
spam score = 61
title = 'comuwynriferepparticipants class hierarchy rife api 161'

distance = 752
spam score = 63
title = 'comuwynrifeauthenticationsessionmanagersexceptions class hierarchy rife api 161'

distance = 755
spam score = 66
title = 'comuwynrifeengineelements rife api 161'

distance = 757
spam score = 57
title = 'uses of interface comuwynrifeauthenticationcredentialsrememberme rife api 161'

distance = 759
spam score = 54
title = 'comuwynriferesources class hierarchy rife api 161'

distance = 760
spam score = 58
title = 'uses of interface comuwynrifecmfdamcontentmanager rife api 161'

distance = 896
spam score = 52
title = 'comuwynrifecmfdam class hierarchy rife api 161'

distance = 897
spam score = 53
title = 'uses of class comuwynrifedatabasequeriesqueryparametertype rife api 161'

distance = 898
spam score = 74
title = 'comuwynrifeauthenticationcredentialsmanagersexceptions rife api 161'

distance = 902
spam score = 54
title = 'comuwynrifetemplateexceptions class hierarchy rife api 161'

distance = 904
spam score = 56
title = 'uses of class comuwynrifecmfdamcontentstoresdatabaserawstore rife api 161'

distance = 906
spam score = 57
title = 'uses of class comuwynrifeschedulerexceptionsschedulermanagerexception rife api 161'

distance = 906
spam score = 71
title = 'comuwynrifecontinuationsinstrument rife api 161'

distance = 907
spam score = 61
title = 'comuwynrifeselector rife api 161'

distance = 912
spam score = 61
title = 'uses of package comuwynrifeschedulerexceptions rife api 161'

distance = 913
spam score = 51
title = 'uses of interface comuwynrifeauthenticationsessionvalidatorssessionvalidatorfactory rife api 161'

distance = 1084
spam score = 59
title = 'uses of package comuwynrifeauthenticationelements rife api 161'

distance = 1095
spam score = 57
title = 'uses of class comuwynrifeschedulerexceptionsschedulerexception rife api 161'

distance = 1098
spam score = 53
title = 'uses of class comuwynrifeschedulerscheduler rife api 161'

distance = 1106
spam score = 62
title = 'uses of package comuwynriferep rife api 161'

distance = 1107
spam score = 53
title = 'uses of class comuwynrifecmfdamordinalmanagerdirection rife api 161'

distance = 1108
spam score = 66
title = 'comuwynrifetest rife api 161'

distance = 1114
spam score = 60
title = 'uses of class comuwynrifeschedulerexecutor rife api 161'

distance = 1119
spam score = 56
title = 'comuwynrifetools class hierarchy rife api 161'

distance = 1121
spam score = 57
title = 'comuwynrifedatabasequerymanagersgeneric class hierarchy rife api 161'

distance = 1122
spam score = 69
title = 'uses of package comuwynrifedatastructures rife api 161'

distance = 1485
spam score = 57
title = 'uses of class comuwynrifeschedulerexceptionstaskmanagerexception rife api 161'

distance = 1557
spam score = 81
title = 'comuwynrifeauthenticationelements rife api 161'

distance = 1589
spam score = 58
title = 'comuwynrifeengineannotations rife api 161'

distance = 1722
spam score = 41
title = 'eusqoosswsclientws alitheia 080 api'

distance = 358
spam score = 82
title = ''

distance = 408
spam score = 72
title = ''

distance = 410
spam score = 77
title = ''

distance = 412
spam score = 77
title = ''

distance = 414
spam score = 73
title = ''

distance = 416
spam score = 77
title = ''

distance = 450
spam score = 77
title = ''

distance = 451
spam score = 76
title = ''

distance = 451
spam score = 72
title = ''

distance = 456
spam score = 77
title = ''

distance = 466
spam score = 83
title = ''

distance = 469
spam score = 78
title = ''

distance = 473
spam score = 75
title = ''

distance = 481
spam score = 80
title = ''

distance = 481
spam score = 86
title = ''

distance = 482
spam score = 70
title = ''

distance = 483
spam score = 79
title = ''

distance = 484
spam score = 84
title = ''

distance = 484
spam score = 76
title = ''

distance = 484
spam score = 79
title = ''

distance = 487
spam score = 82
title = ''

distance = 493
spam score = 78
title = ''

distance = 495
spam score = 79
title = ''

distance = 495
spam score = 73
title = ''

distance = 496
spam score = 80
title = ''

distance = 497
spam score = 80
title = ''

distance = 505
spam score = 74
title = ''

distance = 506
spam score = 83
title = ''

distance = 506
spam score = 79
title = ''

distance = 506
spam score = 73
title = ''

distance = 507
spam score = 83
title = ''

distance = 509
spam score = 80
title = ''

distance = 510
spam score = 75
title = ''

distance = 511
spam score = 80
title = ''

distance = 511
spam score = 66
title = ''

distance = 512
spam score = 64
title = ''

distance = 517
spam score = 82
title = ''

distance = 522
spam score = 81
title = ''

distance = 522
spam score = 80
title = ''

distance = 522
spam score = 75
title = ''

distance = 533
spam score = 79
title = ''

distance = 533
spam score = 81
title = ''

distance = 536
spam score = 72
title = ''

distance = 536
spam score = 77
title = ''

distance = 559
spam score = 70
title = ''

distance = 578
spam score = 69
title = ''

distance = 583
spam score = 68
title = ''

distance = 584
spam score = 83
title = ''

distance = 643
spam score = 69
title = ''

distance = 666
spam score = 75
title = ''

distance = 677
spam score = 86
title = ''

distance = 679
spam score = 78
title = ''

distance = 692
spam score = 81
title = ''

distance = 710
spam score = 86
title = ''

distance = 711
spam score = 87
title = ''

distance = 715
spam score = 84
title = ''

distance = 716
spam score = 83
title = ''

distance = 719
spam score = 82
title = ''

distance = 723
spam score = 80
title = ''

distance = 724
spam score = 74
title = ''

distance = 725
spam score = 70
title = ''

distance = 726
spam score = 82
title = ''

distance = 728
spam score = 82
title = ''

distance = 731
spam score = 80
title = ''

distance = 732
spam score = 78
title = ''

distance = 735
spam score = 77
title = ''

distance = 737
spam score = 70
title = ''

distance = 746
spam score = 70
title = ''

distance = 752
spam score = 85
title = ''

distance = 755
spam score = 79
title = ''

distance = 760
spam score = 72
title = ''

distance = 761
spam score = 70
title = ''

distance = 761
spam score = 72
title = ''

distance = 766
spam score = 78
title = ''

distance = 766
spam score = 80
title = ''

distance = 769
spam score = 82
title = ''

distance = 779
spam score = 84
title = ''

distance = 782
spam score = 76
title = ''

distance = 783
spam score = 66
title = ''

distance = 788
spam score = 83
title = ''

distance = 791
spam score = 66
title = ''

distance = 805
spam score = 66
title = ''

distance = 812
spam score = 80
title = ''

distance = 817
spam score = 79
title = ''

distance = 878
spam score = 81
title = ''

distance = 895
spam score = 82
title = ''

distance = 909
spam score = 65
title = ''

distance = 966
spam score = 77
title = ''

distance = 1028
spam score = 82
title = ''

distance = 1205
spam score = 53
title = ''

distance = 1233
spam score = 61
title = ''

distance = 1246
spam score = 58
title = ''

distance = 1248
spam score = 63
title = ''

distance = 1250
spam score = 62
title = ''

distance = 0
spam score = 55
title = ''

distance = 0
spam score = 56
title = ''

distance = 0
spam score = 55
title = ''

distance = 0
spam score = 56
title = ''

distance = 0
spam score = 56
title = ''

distance = 0
spam score = 56
title = ''

distance = 660
spam score = 56
title = ''

distance = 660
spam score = 55
title = ''

distance = 1821
spam score = 73
title = ''

distance = 395
spam score = 74
title = ''

distance = 398
spam score = 72
title = ''

distance = 399
spam score = 70
title = ''

distance = 412
spam score = 74
title = ''

distance = 412
spam score = 72
title = ''

distance = 413
spam score = 74
title = ''

distance = 413
spam score = 72
title = ''

distance = 419
spam score = 71
title = ''

distance = 427
spam score = 72
title = ''

distance = 430
spam score = 73
title = ''

distance = 433
spam score = 73
title = ''

distance = 447
spam score = 69
title = ''

distance = 448
spam score = 65
title = ''

distance = 449
spam score = 66
title = ''

distance = 470
spam score = 70
title = ''

distance = 479
spam score = 73
title = ''

distance = 480
spam score = 73
title = ''

distance = 485
spam score = 69
title = ''

distance = 485
spam score = 73
title = ''

distance = 489
spam score = 75
title = ''

distance = 500
spam score = 71
title = ''

distance = 536
spam score = 75
title = ''

distance = 540
spam score = 77
title = ''

distance = 547
spam score = 68
title = ''

distance = 574
spam score = 67
title = ''

distance = 583
spam score = 67
title = ''

distance = 641
spam score = 72
title = ''

distance = 681
spam score = 83
title = ''

distance = 682
spam score = 80
title = ''

distance = 689
spam score = 85
title = ''

distance = 701
spam score = 78
title = ''

distance = 713
spam score = 84
title = ''

distance = 718
spam score = 72
title = ''

distance = 726
spam score = 69
title = ''

distance = 727
spam score = 66
title = ''

distance = 734
spam score = 81
title = ''

distance = 735
spam score = 85
title = ''

distance = 741
spam score = 86
title = ''

distance = 744
spam score = 83
title = ''

distance = 749
spam score = 80
title = ''

distance = 757
spam score = 82
title = ''

distance = 774
spam score = 85
title = ''

distance = 778
spam score = 84
title = ''

distance = 781
spam score = 79
title = ''

distance = 782
spam score = 80
title = ''

distance = 787
spam score = 84
title = ''

distance = 787
spam score = 87
title = ''

distance = 809
spam score = 67
title = ''

distance = 816
spam score = 79
title = ''

distance = 820
spam score = 81
title = ''

distance = 859
spam score = 80
title = ''

distance = 882
spam score = 82
title = ''

distance = 888
spam score = 83
title = ''

distance = 943
spam score = 81
title = ''

distance = 958
spam score = 74
title = ''

distance = 962
spam score = 68
title = ''

distance = 963
spam score = 71
title = ''

distance = 1059
spam score = 71
title = ''

distance = 1190
spam score = 77
title = ''

distance = 132
spam score = 62
title = ''

distance = 175
spam score = 63
title = ''

distance = 205
spam score = 61
title = ''

distance = 230
spam score = 62
title = ''

distance = 244
spam score = 62
title = ''

distance = 249
spam score = 62
title = ''

distance = 251
spam score = 62
title = ''

distance = 257
spam score = 64
title = ''

distance = 259
spam score = 62
title = ''

distance = 262
spam score = 63
title = ''

distance = 271
spam score = 63
title = ''

distance = 273
spam score = 62
title = ''

distance = 299
spam score = 66
title = ''

distance = 315
spam score = 65
title = ''

distance = 319
spam score = 69
title = ''

distance = 322
spam score = 60
title = ''

distance = 326
spam score = 63
title = ''

distance = 334
spam score = 60
title = ''

distance = 339
spam score = 65
title = ''

distance = 343
spam score = 61
title = ''

distance = 383
spam score = 61
title = ''

distance = 562
spam score = 69
title = ''

distance = 565
spam score = 64
title = ''

distance = 571
spam score = 67
title = ''

distance = 599
spam score = 71
title = ''

distance = 789
spam score = 69
title = ''

distance = 904
spam score = 61
title = ''

distance = 941
spam score = 67
title = ''

distance = 1005
spam score = 65
title = ''

distance = 1022
spam score = 63
title = ''

distance = 1023
spam score = 63
title = ''

distance = 1026
spam score = 61
title = ''

distance = 1038
spam score = 67
title = ''

distance = 1063
spam score = 63
title = ''

distance = 1151
spam score = 68
title = ''

distance = 1178
spam score = 65
title = ''

distance = 1198
spam score = 64
title = ''

distance = 1403
spam score = 88
title = ''

distance = 253
spam score = 55
title = 'uses of package orgspringframeworksecurityuix509 spring security 204 api'

distance = 255
spam score = 47
title = 'uses of package orgspringframeworksecurityrunas spring security 204 api'

distance = 285
spam score = 49
title = 'uses of class orgspringframeworksecuritylockedexception spring security 204 api'

distance = 285
spam score = 48
title = 'uses of class orgspringframeworksecurityauthenticationserviceexception spring security 204 api'

distance = 286
spam score = 50
title = 'uses of class orgspringframeworksecuritygrantedauthoritiescontainerimpl spring security 204 api'

distance = 286
spam score = 47
title = 'uses of class orgspringframeworksecuritymockauthenticationmanager spring security 204 api'

distance = 286
spam score = 53
title = 'uses of class orgspringframeworksecuritygrantedauthoritiescontainerimpl spring security 204 api'

distance = 295
spam score = 47
title = 'uses of class orgspringframeworksecurityauthenticationtrustresolverimpl spring security 204 api'

distance = 296
spam score = 47
title = 'uses of class orgspringframeworksecurityconfigattributeeditor spring security 204 api'

distance = 299
spam score = 47
title = 'uses of class orgspringframeworksecuritydisabledexception spring security 204 api'

distance = 305
spam score = 46
title = 'uses of class orgspringframeworksecurityauthorizationserviceexception spring security 204 api'

distance = 324
spam score = 55
title = 'uses of package orgspringframeworksecurityprovidersanonymous spring security 204 api'

distance = 328
spam score = 45
title = 'uses of package orgspringframeworksecurityprovidersx509populator spring security 204 api'

distance = 329
spam score = 46
title = 'uses of package orgspringframeworksecurityconfig spring security 204 api'

distance = 333
spam score = 53
title = 'uses of package orgspringframeworksecurityadapterscatalina spring security 204 api'

distance = 333
spam score = 50
title = 'uses of class orgspringframeworksecurityutilfilterinvocationutils spring security 204 api'

distance = 336
spam score = 52
title = 'uses of package orgspringframeworksecurityldapsearch spring security 204 api'

distance = 342
spam score = 47
title = 'uses of class orgspringframeworksecuritycontextsecuritycontextholder spring security 204 api'

distance = 342
spam score = 48
title = 'uses of class orgspringframeworksecurityconfiganonymousbeandefinitionparser spring security 204 api'

distance = 344
spam score = 46
title = 'uses of package orgspringframeworksecurityuserdetailschecker spring security 204 api'

distance = 470
spam score = 56
title = 'uses of class orgspringframeworkremotinghttpinvokerhttpinvokerproxyfactorybean spring framework api 20'

distance = 470
spam score = 50
title = 'uses of package orgspringframeworksecurityuintlmldapauthenticator spring security 204 api'

distance = 471
spam score = 47
title = 'uses of class orgspringframeworksecurityuipreauthj2eej2eepreauthenticatedprocessingfilter spring security 204 api'

distance = 471
spam score = 64
title = 'uses of package orgspringframeworkdaoannotation spring framework api 25'

distance = 471
spam score = 64
title = 'uses of package orgspringframeworkcoreannotation spring framework api 25'

distance = 476
spam score = 59
title = 'uses of class orgspringframeworkormhibernatehibernatetransactionmanager spring framework api 20'

distance = 478
spam score = 59
title = 'uses of package orgspringframeworkinstrument spring framework api 20'

distance = 478
spam score = 48
title = 'uses of class orgspringframeworksecurityinterceptmethodaopalliancemethoddefinitionsourceadvisor spring security 204 api'

distance = 479
spam score = 56
title = 'uses of class orgspringframeworkutilclassloaderutils spring framework api 25'

distance = 479
spam score = 46
title = 'uses of class orgspringframeworksecurityinterceptmethodaspectjaspectjsecurityinterceptor spring security 204 api'

distance = 549
spam score = 65
title = 'uses of class orgspringframeworkcontextsupportclasspathxmlapplicationcontext spring framework api 25'

distance = 549
spam score = 59
title = 'uses of package orgspringframeworkinstrumentclassloadingweblogic spring framework api 25'

distance = 549
spam score = 59
title = 'uses of class orgspringframeworkcontexteventeventpublicationinterceptor spring framework api 25'

distance = 550
spam score = 52
title = 'orgspringframeworksecurityprovidersldap class hierarchy spring security 204 api'

distance = 551
spam score = 59
title = 'uses of package orgspringframeworkjcasupport spring framework api 25'

distance = 551
spam score = 60
title = 'uses of class orgspringframeworktransactioninterceptortransactionattributeeditor spring framework api 25'

distance = 551
spam score = 64
title = 'uses of class orgspringframeworkaopaspectjaspectjafterreturningadvice spring framework api 25'

distance = 551
spam score = 52
title = 'orgspringframeworksecurityuiopenidconsumers class hierarchy spring security 204 api'

distance = 552
spam score = 59
title = 'uses of class orgspringframeworkschedulingquartzjobmethodinvocationfailedexception spring framework api 25'

distance = 552
spam score = 54
title = 'uses of package orgspringframeworksecurityuidigestauth spring security 204 api'

distance = 584
spam score = 58
title = 'uses of class orgspringframeworkjcacontextresourceadapterapplicationcontext spring framework api 25'

distance = 584
spam score = 69
title = 'uses of interface orgspringframeworkcontextmessagesourceaware spring framework api 25'

distance = 586
spam score = 61
title = 'uses of class orgspringframeworkaoptargetabstractlazycreationtargetsource spring framework api 25'

distance = 587
spam score = 59
title = 'uses of package orgspringframeworkdaoannotation spring framework api 25'

distance = 587
spam score = 55
title = 'uses of class orgspringframeworkwebservlethandlerbeannameurlhandlermapping spring framework api 25'

distance = 587
spam score = 58
title = 'uses of class orgspringframeworkwebservletviewfreemarkerfreemarkerconfigurer spring framework api 20'

distance = 588
spam score = 62
title = 'orgspringframeworkwebportletsample spring security 204 api'

distance = 588
spam score = 56
title = 'uses of class orgspringframeworkremotingcauchoburlapproxyfactorybean spring framework api 25'

distance = 589
spam score = 60
title = 'uses of class orgspringframeworkwebservletviewjasperreportsjasperreportsmultiformatview spring framework api 20'

distance = 589
spam score = 62
title = 'uses of class orgspringframeworkbeansfactoryconfigcustomscopeconfigurer spring framework api 25'

distance = 624
spam score = 55
title = 'uses of class orgspringframeworkbeansfactoryconfigfieldretrievingfactorybean spring framework api 25'

distance = 624
spam score = 60
title = 'uses of package orgspringframeworkinstrumentclassloadingtomcat spring framework api 20'

distance = 624
spam score = 60
title = 'uses of class orgspringframeworkwebportletcontextxmlportletapplicationcontext spring framework api 25'

distance = 625
spam score = 62
title = 'uses of class orgspringframeworkaopaspectjannotationlazysingletonaspectinstancefactorydecorator spring framework api 25'

distance = 625
spam score = 57
title = 'uses of class orgspringframeworkjmxexportannotationannotationmbeanexporter spring framework api 25'

distance = 626
spam score = 44
title = 'orgspringframeworksecurityuintlmldapauthenticator spring security 204 api'

distance = 627
spam score = 51
title = 'uses of interface orgspringframeworksecurityaclsauditableaccesscontrolentry spring security 204 api'

distance = 628
spam score = 58
title = 'uses of class orgspringframeworkjdbcsupportloboraclelobhandler spring framework api 25'

distance = 628
spam score = 64
title = 'uses of class orgspringframeworkejbsupportabstractjmsmessagedrivenbean spring framework api 20'

distance = 628
spam score = 60
title = 'uses of package orgspringframeworkstereotype spring framework api 25'

distance = 677
spam score = 50
title = 'orgspringframeworksecurityproviderscascache spring security 204 api'

distance = 678
spam score = 51
title = 'orgspringframeworkmetadatacommons spring framework'

distance = 680
spam score = 44
title = 'orgspringframeworkwebportletsample class hierarchy spring security 204 api'

distance = 680
spam score = 58
title = 'uses of class orgspringframeworksecurityadaptersabstractadapterauthenticationtoken spring security 204 api'

distance = 681
spam score = 60
title = 'uses of class orgspringframeworkjdbcsupportincrementerdb2sequencemaxvalueincrementer spring framework api 25'

distance = 681
spam score = 51
title = 'uses of package orgspringframeworksecuritysecurechannel spring security 204 api'

distance = 683
spam score = 63
title = 'uses of class orgspringframeworktestcontextjunit38abstracttransactionaljunit38springcontexttests spring framework api 25'

distance = 684
spam score = 72
title = 'orgspringframeworksecurityprovidersrememberme spring security 204 api'

distance = 685
spam score = 60
title = 'uses of class orgspringframeworkaopframeworkabstractsingletonproxyfactorybean spring framework api 20'

distance = 687
spam score = 58
title = 'uses of class orgspringframeworkejbaccesssimpleremoteslsbinvokerinterceptor spring framework api 25'

distance = 759
spam score = 65
title = 'uses of class orgspringframeworkwebjsfdelegatingvariableresolver spring framework api 25'

distance = 759
spam score = 61
title = 'uses of class orgspringframeworkwebservletmvcabstracturlviewcontroller spring framework api 25'

distance = 760
spam score = 62
title = 'uses of class orgspringframeworkcoreenumsstaticlabeledenumresolver spring framework api 25'

distance = 761
spam score = 53
title = 'uses of package orgspringframeworkjcacciconnection spring framework api 25'

distance = 762
spam score = 67
title = 'orgspringframeworksecurityuiportlet spring security 204 api'

distance = 764
spam score = 66
title = 'orgspringframeworksecurityuserdetailsjdbc spring security 204 api'

distance = 764
spam score = 68
title = 'orgspringframeworksecurityprovidersdaosalt spring security 204 api'

distance = 764
spam score = 66
title = 'orgspringframeworkinstrumentclassloadingtomcat spring framework api 20'

distance = 764
spam score = 75
title = 'orgspringframeworkinstrumentclassloadingoc4j spring framework api 25'

distance = 765
spam score = 56
title = 'uses of class orgspringframeworkaopaspectjannotationbeanfactoryaspectinstancefactory spring framework api 25'

distance = 829
spam score = 63
title = 'orgspringframeworkinstrumentclassloadingglassfish spring framework api 25'

distance = 829
spam score = 57
title = 'uses of class orgspringframeworksecurityeventauthorizationabstractauthorizationevent spring security 204 api'

distance = 830
spam score = 61
title = 'uses of interface orgspringframeworkaopmethodbeforeadvice spring framework api 20'

distance = 830
spam score = 62
title = 'uses of package orgspringframeworksecurityvote spring security 204 api'

distance = 830
spam score = 64
title = 'uses of class orgspringframeworkormjpaabstractentitymanagerfactorybean spring framework api 20'

distance = 831
spam score = 59
title = 'uses of interface orgspringframeworkaopbeforeadvice spring framework api 25'

distance = 831
spam score = 61
title = 'uses of class orgspringframeworksecurityvoteabstractaccessdecisionmanager spring security 204 api'

distance = 831
spam score = 57
title = 'uses of interface orgspringframeworkwebportlethandlerexceptionresolver spring framework api 25'

distance = 833
spam score = 58
title = 'uses of class orgspringframeworktransactionsupportabstractplatformtransactionmanagersuspendedresourcesholder spring framework api 20'

distance = 834
spam score = 71
title = 'uses of package orgspringframeworkaopinterceptor spring framework api 25'

distance = 911
spam score = 68
title = 'uses of class orgspringframeworktransactioninterceptorabstractfallbacktransactionattributesource spring framework api 25'

distance = 914
spam score = 74
title = 'uses of class orgspringframeworkbeansfactoryannotationautowiredannotationbeanpostprocessor spring framework api 25'

distance = 917
spam score = 43
title = 'orgspringframeworkflexmessagingremoting'

distance = 917
spam score = 59
title = 'uses of package orgspringframeworksecurityproviderscas spring security 204 api'

distance = 918
spam score = 70
title = 'orgspringframeworkjcaworkjboss spring framework api 25'

distance = 920
spam score = 61
title = 'uses of interface orgspringframeworkjdbccorestatementcallback spring framework api 25'

distance = 921
spam score = 59
title = 'uses of package orgspringframeworkjcawork spring framework api 25'

distance = 921
spam score = 71
title = 'orgspringframeworkbeansfactoryaccessel spring framework api 25'

distance = 923
spam score = 59
title = 'uses of package orgspringframeworkjcacci spring framework api 25'

distance = 923
spam score = 54
title = 'uses of class orgspringframeworkbeansfactoryannotationautowire spring framework api 25'

distance = 1154
spam score = 74
title = 'orgspringframeworksecuritysecurechannel spring security 204 api'

distance = 1216
spam score = 64
title = 'orgspringframeworksecurityeventauthentication spring security 204 api'

distance = 1224
spam score = 77
title = 'orgspringframeworksecurityeventauthentication spring security 204 api'

distance = 1257
spam score = 53
title = 'orgspringframeworkremotingcaucho spring framework api 20'

distance = 1597
spam score = 55
title = 'uses of package orgmactorframework mactor 202 api'

distance = 1792
spam score = 54
title = 'tables'

distance = 293
spam score = 54
title = 'objecthelper java 2 platform se 50'

distance = 307
spam score = 60
title = 'objecthelper java 2 platform se 50'

distance = 322
spam score = 56
title = 'objecthelper java 2 platform se v142'

distance = 358
spam score = 64
title = 'policyerrorcodehelper java 2 platform se 50'

distance = 375
spam score = 62
title = 'fieldnamehelper java 2 platform se 50'

distance = 376
spam score = 60
title = 'identifierhelper java 2 platform se 50'

distance = 381
spam score = 59
title = 'bindinglisthelper java 2 platform se 50'

distance = 385
spam score = 57
title = 'policyerrorcodehelper java platform se 6'

distance = 385
spam score = 57
title = 'addresshelper java 2 platform se 50'

distance = 392
spam score = 65
title = 'identifierhelper java 2 platform se 50'

distance = 392
spam score = 67
title = 'policyerrorhelper java 2 platform se 50'

distance = 393
spam score = 63
title = 'fieldnamehelper java 2 platform se v142'

distance = 394
spam score = 63
title = 'adapternamehelper java 2 platform se 50'

distance = 397
spam score = 60
title = 'policyerrorcodehelper java 2 platform se v142'

distance = 397
spam score = 64
title = 'policyerrorcodehelper java 2 platform se v142'

distance = 402
spam score = 66
title = 'policyerrorhelper java 2 platform se 50'

distance = 403
spam score = 66
title = 'fieldnamehelper java platform se 6'

distance = 410
spam score = 61
title = 'bindinglisthelper java 2 platform se 50'

distance = 412
spam score = 57
title = 'urlstringhelper java 2 platform se 50'

distance = 415
spam score = 58
title = 'identifierhelper java platform se 6'

distance = 444
spam score = 66
title = 'objectidhelper java 2 platform se 50'

distance = 445
spam score = 59
title = 'addresshelper java 2 platform se v142'

distance = 446
spam score = 56
title = 'iorhelper java 2 platform se 50'

distance = 448
spam score = 56
title = 'orbidhelper java platform se 6'

distance = 448
spam score = 60
title = 'charseqhelper java 2 platform se 50'

distance = 450
spam score = 60
title = 'booleanseqhelper java 2 platform se 50'

distance = 450
spam score = 64
title = 'longseqhelper java 2 platform se 50'

distance = 450
spam score = 62
title = 'longseqhelper java 2 platform se 50'

distance = 452
spam score = 60
title = 'floatseqhelper java 2 platform se 50'

distance = 453
spam score = 67
title = 'octetseqhelper java 2 platform se 50'

distance = 465
spam score = 61
title = 'charseqhelper java 2 platform se v141'

distance = 466
spam score = 61
title = 'booleanseqhelper java 2 platform se v141'

distance = 467
spam score = 63
title = 'policyerrorhelper java 2 platform se v142'

distance = 469
spam score = 62
title = 'objectidhelper java platform se 6'

distance = 471
spam score = 59
title = 'addresshelper java 2 platform se v142'

distance = 472
spam score = 61
title = 'octetseqhelper java 2 platform se v142'

distance = 473
spam score = 62
title = 'floatseqhelper java 2 platform se v142'

distance = 474
spam score = 63
title = 'ulongseqhelper java 2 platform se v142'

distance = 475
spam score = 62
title = 'doubleseqhelper java 2 platform se v142'

distance = 477
spam score = 51
title = 'addresshelper java 2 platform se v141'

distance = 546
spam score = 55
title = 'bindingiteratorhelper java 2 platform se v141'

distance = 548
spam score = 68
title = 'adaptermanageridhelper java 2 platform se 50'

distance = 549
spam score = 57
title = 'namingcontextexthelper java 2 platform se v141'

distance = 556
spam score = 62
title = 'dynarrayhelper java 2 platform se 50'

distance = 558
spam score = 46
title = 'java 2 platform se v131 class bindinglisthelper'

distance = 559
spam score = 50
title = 'java 2 platform se v13 class bindingtypehelper'

distance = 559
spam score = 65
title = 'adaptermanageridhelper java 2 platform se 50'

distance = 561
spam score = 61
title = 'dynstructhelper java 2 platform se 50'

distance = 561
spam score = 61
title = 'poahelper java platform se 6'

distance = 567
spam score = 49
title = 'java 2 platform se v13 class namehelper'

distance = 600
spam score = 65
title = 'dynfixedhelper java 2 platform se 50'

distance = 601
spam score = 59
title = 'dynunionhelper java 2 platform se 50'

distance = 603
spam score = 42
title = 'java 2 platform se v131 class namecomponenthelper'

distance = 608
spam score = 44
title = 'java 2 platform se v131 class alreadyboundhelper'

distance = 611
spam score = 44
title = 'java 2 platform se v131 class bindingiteratorhelper'

distance = 616
spam score = 60
title = 'dynunionhelper java 2 platform se 50'

distance = 616
spam score = 48
title = 'java 2 platform se v131 class alreadyboundhelper'

distance = 621
spam score = 49
title = 'java 2 platform se v13 class namingcontexthelper'

distance = 622
spam score = 64
title = 'dynfixedhelper java platform se 6'

distance = 622
spam score = 48
title = 'java 2 platform se v13 class alreadyboundhelper'

distance = 656
spam score = 41
title = 'javatm 2 platform standard edition v122 api specification class namehelper'

distance = 663
spam score = 46
title = 'javatm 2 platform standard edition v122 api specification class bindinghelper'

distance = 663
spam score = 75
title = 'currenthelper java 2 platform se 50'

distance = 665
spam score = 36
title = 'java platform 12 api specification class bindingtypehelper'

distance = 667
spam score = 39
title = 'java platform 12 api specification class bindingtypehelper'

distance = 667
spam score = 61
title = 'alreadyboundhelper'

distance = 667
spam score = 46
title = 'javatm 2 platform standard edition v122 api specification class bindingtypehelper'

distance = 669
spam score = 63
title = 'cannotproceedhelper'

distance = 671
spam score = 68
title = 'currenthelper java platform se 6'

distance = 673
spam score = 64
title = 'currenthelper java 2 platform se v141'

distance = 702
spam score = 57
title = 'unknownencodinghelper'

distance = 709
spam score = 48
title = 'javatm 2 platform standard edition v122 api specification class alreadyboundhelper'

distance = 710
spam score = 43
title = 'javatm 2 platform standard edition v122 api specification class cannotproceedhelper'

distance = 714
spam score = 39
title = 'java platform 12 api specification class alreadyboundhelper'

distance = 714
spam score = 63
title = 'dynvaluehelper java platform se 6'

distance = 716
spam score = 38
title = 'java platform 12 api specification class cannotproceedhelper'

distance = 717
spam score = 39
title = 'java platform 12 api specification class alreadyboundhelper'

distance = 717
spam score = 45
title = 'javatm 2 platform standard edition v122 api specification class cannotproceedhelper'

distance = 718
spam score = 44
title = 'javatm 2 platform standard edition v122 api specification class invalidnamehelper'

distance = 718
spam score = 44
title = 'javatm 2 platform standard edition v122 api specification class notemptyhelper'

distance = 853
spam score = 63
title = 'transactionservice 140 class inactivehelper'

distance = 855
spam score = 51
title = 'heprepactionhelper heprep interfaces 203 api'

distance = 855
spam score = 70
title = 'transactionservice 140 class heuristicrollbackhelper'

distance = 859
spam score = 71
title = 'transactionservice 140 class propagationcontexthelper'

distance = 861
spam score = 62
title = 'transactionservice 140 class notpreparedhelper'

distance = 866
spam score = 57
title = 'transactionservice 140 class xidhelper'

distance = 866
spam score = 63
title = 'transactionservice 140 class votehelper'

distance = 870
spam score = 63
title = 'transactionservice 140 class subtransactionsunavailablehelper'

distance = 871
spam score = 53
title = 'transactionservice 140 class unavailablehelper'

distance = 879
spam score = 56
title = 'transactionservice 140 class specificdatahelper'

distance = 918
spam score = 60
title = 'transactionservice 140 class octettabhelper'

distance = 926
spam score = 59
title = 'transactionservice 140 class octetseqhelper'

distance = 931
spam score = 73
title = 'transactionservice 140 class subtransactionawareresourcehelper'

distance = 933
spam score = 70
title = 'transactionservice 140 class controlhelper'

distance = 935
spam score = 64
title = 'transactionservice 140 class synchronizationhelper'

distance = 938
spam score = 75
title = 'transactionservice 140 class currenthelper'

distance = 938
spam score = 62
title = 'transactionservice 140 class terminatorhelper'

distance = 943
spam score = 74
title = 'transactionservice 140 class recoverycoordinatorhelper'

distance = 946
spam score = 64
title = 'transactionservice 140 class transactionfactoryhelper'

distance = 946
spam score = 75
title = 'transactionservice 140 class resourcehelper'

distance = 1225
spam score = 56
title = 'java 2 platform se v131 class outputstream'

distance = 1482
spam score = 64
title = 'refln openmms v151 std model api documentation'

distance = 1582
spam score = 56
title = 'heuristics activemath api'

distance = 1861
spam score = 18
title = 'spojen krlovstv'

distance = 195
spam score = 49
title = 'eclipse platform api specification uses of package orgeclipseuimodel'

distance = 215
spam score = 47
title = 'eclipse platform api specification uses of package orgeclipsesearchui'

distance = 218
spam score = 53
title = 'eclipse platform api specification uses of package orgeclipseuiplugin'

distance = 222
spam score = 50
title = 'eclipse platform api specification uses of package orgeclipseteamui'

distance = 243
spam score = 49
title = 'eclipse platform api specification uses of class orgeclipsehelpappserver'

distance = 243
spam score = 53
title = 'eclipse platform api specification uses of package orgeclipseantcore'

distance = 246
spam score = 49
title = 'eclipse platform api specification uses of package orgeclipsecorelauncher'

distance = 254
spam score = 50
title = 'eclipse platform api specification uses of package orgeclipseswtlayout'

distance = 255
spam score = 47
title = 'eclipse platform api specification uses of interface orgeclipsehelpihelp'

distance = 256
spam score = 48
title = 'eclipse platform api specification uses of interface orgeclipsehelpicontext'

distance = 256
spam score = 48
title = 'eclipse platform api specification uses of interface orgeclipseuiiactionbars'

distance = 256
spam score = 48
title = 'eclipse platform api specification uses of interface orgeclipseuiiviewsite'

distance = 258
spam score = 49
title = 'eclipse platform api specification uses of package orgeclipsehelpuibrowser'

distance = 259
spam score = 54
title = 'eclipse platform api specification uses of class orgeclipseuihelpworkbenchhelp'

distance = 261
spam score = 49
title = 'eclipse platform api specification uses of interface orgeclipseuiiworkbenchpage'

distance = 262
spam score = 46
title = 'eclipse platform api specification uses of interface orgeclipseuiistartup'

distance = 264
spam score = 51
title = 'eclipse platform api specification uses of class orgeclipseuiactionsopenfileaction'

distance = 267
spam score = 48
title = 'eclipse platform api specification uses of class orgeclipseuihelpviewcontextcomputer'

distance = 270
spam score = 47
title = 'eclipse platform api specification uses of interface orgeclipsehelpiappserver'

distance = 272
spam score = 48
title = 'eclipse platform api specification uses of class orgeclipsecompareresourcenode'

distance = 377
spam score = 52
title = 'eclipse platform api specification uses of class orgeclipsejfaceviewerscolumnpixeldata'

distance = 377
spam score = 47
title = 'eclipse platform api specification uses of interface orgeclipsehelpuibrowseribrowserfactory'

distance = 378
spam score = 47
title = 'eclipse platform api specification uses of class orgeclipseuitexteditorincrementalfindaction'

distance = 378
spam score = 47
title = 'eclipse platform api specification uses of class orgeclipseuiwizardsnewresourcebasicnewfileresourcewizard'

distance = 379
spam score = 49
title = 'eclipse platform api specification uses of class orgeclipseswtlayoutformdata'

distance = 380
spam score = 48
title = 'eclipse platform api specification uses of class orgeclipsejfacetextchilddocumentmanager'

distance = 381
spam score = 49
title = 'eclipse platform api specification uses of class orgeclipseuiactionscopyprojectoperation'

distance = 381
spam score = 49
title = 'eclipse platform api specification uses of class orgeclipseuiactionscreatefileaction'

distance = 381
spam score = 51
title = 'eclipse platform api specification uses of class orgeclipsejfaceutilopenstrategy'

distance = 381
spam score = 47
title = 'eclipse platform api specification uses of class orgeclipsedebuguicommontab'

distance = 419
spam score = 43
title = 'eclipse platform api specification uses of interface orgeclipsesearchuiisearchresultview'

distance = 419
spam score = 51
title = 'eclipse platform api specification uses of class orgeclipseuieditorstextfiledocumentproviderfileinfo'

distance = 419
spam score = 52
title = 'eclipse platform api specification uses of class orgeclipseswtaccessibilityaccessibleevent'

distance = 420
spam score = 47
title = 'eclipse platform api specification uses of class orgeclipseuiwizardsnewresourcebasicnewfolderresourcewizard'

distance = 420
spam score = 59
title = 'eclipse platform api specification uses of class orgeclipsejfaceutilpropertychangeevent'

distance = 423
spam score = 50
title = 'eclipse platform api specification uses of class orgeclipseswtdnddroptargetevent'

distance = 424
spam score = 50
title = 'eclipse platform api specification uses of class orgeclipsejfacetextsourceverticalruler'

distance = 424
spam score = 47
title = 'eclipse platform api specification uses of interface orgeclipsedebuguiilaunchconfigurationdialog'

distance = 428
spam score = 50
title = 'eclipse platform api specification uses of class orgeclipseswtgraphicsfont'

distance = 429
spam score = 49
title = 'eclipse platform api specification uses of interface orgeclipsecoreruntimepreferencesipropertychangelistener'

distance = 477
spam score = 48
title = 'eclipse platform api specification uses of interface orgeclipsejfacetextcontentassisticontextinformationextension'

distance = 478
spam score = 49
title = 'eclipse platform api specification uses of class orgeclipsejfacetextreconcilerdirtyregion'

distance = 479
spam score = 49
title = 'eclipse platform api specification uses of package orgeclipsecomparerangedifferencer'

distance = 487
spam score = 46
title = 'eclipse platform api specification uses of interface orgeclipsejfacetextidocumentextensionireplace'

distance = 487
spam score = 46
title = 'eclipse platform api specification uses of interface orgeclipsecoreresourcesifilemodificationvalidator'

distance = 487
spam score = 47
title = 'eclipse platform api specification uses of interface orgeclipsedebugcoremodeliexpression'

distance = 490
spam score = 57
title = 'uses of package orgeclipsejfacecontexts eclipse platform api specification'

distance = 496
spam score = 57
title = 'uses of class orgeclipseswtaccessibilityacc eclipse platform api specification'

distance = 496
spam score = 47
title = 'eclipse platform api specification uses of interface orgeclipsejfacetextsourceiannotationmodellistenerextension'

distance = 498
spam score = 48
title = 'eclipse platform api specification uses of class orgeclipsejfacetextrulesrulebasedpartitioner'

distance = 586
spam score = 49
title = 'eclipse platform api specification uses of interface orgeclipseuiiselectionservice'

distance = 588
spam score = 57
title = 'eclipse platform api specification uses of package orgeclipseuiwizardsnewresource'

distance = 591
spam score = 62
title = 'eclipse platform api specification uses of class orgeclipsejfacetextabstractdocument'

distance = 591
spam score = 51
title = 'uses of package orgeclipseswt eclipse platform api specification'

distance = 593
spam score = 51
title = 'uses of package orgeclipseltkcorerefactoringmodel eclipse platform api specification'

distance = 600
spam score = 49
title = 'eclipse platform api specification uses of interface orgeclipseupdatecoreiarchivereference'

distance = 601
spam score = 67
title = 'eclipse platform api specification uses of interface orgeclipsecoreruntimeipath'

distance = 602
spam score = 49
title = 'eclipse platform api specification uses of interface orgeclipsejfacetextformattericontentformatter'

distance = 603
spam score = 55
title = 'eclipse platform api specification uses of interface orgeclipseuipartisetselectiontarget'

distance = 603
spam score = 60
title = 'eclipse platform api specification orgeclipsedebuguiactions class hierarchy'

distance = 654
spam score = 48
title = 'eclipse platform api specification uses of interface orgeclipsecorebootiplatformrunnable'

distance = 655
spam score = 50
title = 'eclipse platform api specification uses of class orgeclipsejfacetextreconcilerabstractreconciler'

distance = 656
spam score = 49
title = 'eclipse platform api specification uses of class orgeclipsedebuguiabstractlaunchconfigurationtab'

distance = 657
spam score = 49
title = 'orgeclipsesearchuiactions class hierarchy eclipse platform api specification'

distance = 657
spam score = 49
title = 'eclipse platform api specification uses of class orgeclipsecomparestructuremergeviewerdiffcontainer'

distance = 658
spam score = 56
title = 'eclipse platform api specification uses of class orgeclipseuiactionsmoveresourceaction'

distance = 659
spam score = 57
title = 'eclipse platform api specification uses of package orgeclipsejfacetextreconciler'

distance = 659
spam score = 54
title = 'eclipse platform api specification uses of package orgeclipseuiviewsnavigator'

distance = 662
spam score = 50
title = 'eclipse platform api specification orgeclipsejfacetextpresentation class hierarchy'

distance = 663
spam score = 57
title = 'eclipse platform api specification uses of class orgeclipsejfaceresourceimagedescriptor'

distance = 743
spam score = 57
title = 'eclipse platform api specification uses of class orgeclipsejfacetextabstractinformationcontrolmanager'

distance = 746
spam score = 48
title = 'eclipse platform api specification orgeclipsesearchui class hierarchy'

distance = 752
spam score = 46
title = 'eclipse platform api specification orgeclipseuimodel class hierarchy'

distance = 754
spam score = 54
title = 'orgeclipsecorelauncher class hierarchy eclipse platform api specification'

distance = 756
spam score = 51
title = 'eclipse platform api specification orgeclipseteamcore class hierarchy'

distance = 757
spam score = 49
title = 'eclipse platform api specification uses of interface orgeclipsecomparecontentmergevieweridocumentrange'

distance = 765
spam score = 52
title = 'orgeclipsejfacecontexts eclipse platform api specification'

distance = 769
spam score = 53
title = 'orgeclipseswtprintingeclipse platform api specification'

distance = 771
spam score = 66
title = 'eclipse platform api specification orgeclipseuiviewsframelist class hierarchy'

distance = 773
spam score = 58
title = 'orgeclipsecoreruntimeadaptor eclipse platform api specification'

distance = 865
spam score = 54
title = 'eclipse platform api specification uses of interface orgeclipseuitexteditoridocumentprovider'

distance = 866
spam score = 50
title = 'orgeclipsecorefilebuffers class hierarchy eclipse platform api specification'

distance = 867
spam score = 60
title = 'orgeclipsedebuguiactionseclipse platform api specification'

distance = 868
spam score = 51
title = 'eclipse platform api specification uses of interface orgeclipseuitexteditoritexteditor'

distance = 869
spam score = 49
title = 'eclipse platform api specification uses of package orgeclipsedebugcore'

distance = 876
spam score = 49
title = 'eclipse platform api specification uses of package orgeclipsejfacetextcontentassist'

distance = 883
spam score = 55
title = 'orgeclipsecoreexpressions class hierarchy eclipse platform api specification'

distance = 885
spam score = 58
title = 'orgeclipseosgiservicedatalocation eclipse platform api specification'

distance = 885
spam score = 58
title = 'eclipse platform api specification uses of interface orgeclipsejfacetextsourceiverticalrulerinfo'

distance = 891
spam score = 59
title = 'uses of package orgeclipsecoreresourcesteam eclipse platform api specification'

distance = 1019
spam score = 57
title = 'eclipse platform api specification uses of package orgeclipsejfacetextpresentation'

distance = 1020
spam score = 53
title = 'eclipse platform api specification uses of interface orgeclipsecoreruntimeistatus'

distance = 1021
spam score = 50
title = 'orgeclipsehyadesloggingadaptermodelinternaladapterutil'

distance = 1031
spam score = 60
title = 'orgeclipsecorebooteclipse platform api specification'

distance = 1035
spam score = 66
title = 'eclipse platform api specification xindex'

distance = 1038
spam score = 44
title = 'overview emf model transaction javadoc'

distance = 1048
spam score = 46
title = 'overview emf model transaction javadoc'

distance = 1053
spam score = 52
title = 'eclipse platform api specification orgeclipseupdatecoremodel class hierarchy'

distance = 1059
spam score = 45
title = 'overview emf model transaction javadoc'

distance = 1060
spam score = 72
title = 'eclipse platform api specification uses of class orgeclipsecoreruntimeplugin'

distance = 1269
spam score = 53
title = 'uses of package orgeclipsecoreruntimemodel eclipse platform api specification'

distance = 1281
spam score = 57
title = 'eclipse platform api specification uses of package orgeclipsedebugcoremodel'

distance = 1289
spam score = 64
title = 'orgeclipsecoreruntimemodeleclipse platform api specification'

distance = 1314
spam score = 66
title = 'uses of class orgeclipseltkuirefactoringtexteditchangenodechildnode eclipse platform api specification'

distance = 1331
spam score = 59
title = 'orgeclipsecomparecontentmergeviewereclipse platform api specification'

distance = 1384
spam score = 54
title = 'eclipse platform api specification uses of class orgeclipseupdatecoremodelinstallabortedexception'

distance = 1685
spam score = 57
title = 'eclipse second class cruisers'

distance = 208
spam score = 51
title = 'orgapachelucene class hierarchy lucene 200 api'

distance = 247
spam score = 61
title = 'orgapachelucene class hierarchy lucene 220 api'

distance = 255
spam score = 63
title = 'orgapacheluceneindex class hierarchy lucene 230 api'

distance = 303
spam score = 61
title = 'orgapachelucenebenchmark class hierarchy lucene 230 api'

distance = 304
spam score = 61
title = 'orgapachelucenebenchmark class hierarchy lucene 230 api'

distance = 304
spam score = 61
title = 'orgapacheregexp class hierarchy lucene 230 api'

distance = 314
spam score = 52
title = 'orgapacheluceneindex class hierarchy lucene 232 api'

distance = 317
spam score = 52
title = 'orgapachelucenewikipediaanalysis class hierarchy lucene 230 api'

distance = 322
spam score = 52
title = 'orgapacheluceneutil class hierarchy lucene 143 api'

distance = 325
spam score = 50
title = 'orgapachelucenewordnet class hierarchy lucene 200 api'

distance = 328
spam score = 56
title = 'class hierarchy lucene 230 api'

distance = 328
spam score = 55
title = 'class hierarchy lucene 230 api'

distance = 328
spam score = 57
title = 'orgapacheluceneanalysiscz class hierarchy lucene 230 api'

distance = 328
spam score = 53
title = 'orgapacheregexp class hierarchy lucene 200 api'

distance = 330
spam score = 58
title = 'orgapachelucenewordnet class hierarchy lucene 230 api'

distance = 337
spam score = 58
title = 'orgapacheregexp class hierarchy lucene 230 api'

distance = 348
spam score = 67
title = 'orgapachelucenebenchmark class hierarchy lucene 220 api'

distance = 349
spam score = 58
title = 'orgapachelucenequeryparseranalyzing class hierarchy lucene 230 api'

distance = 349
spam score = 50
title = 'orgapacheluceneanalysiscz class hierarchy lucene 220 api'

distance = 350
spam score = 55
title = 'orgapachelucenewordnet class hierarchy lucene 220 api'

distance = 438
spam score = 52
title = 'lucli class hierarchy lucene 232 api'

distance = 438
spam score = 53
title = 'orgapachenutchsummarylucene class hierarchy nutch 081 api'

distance = 439
spam score = 57
title = 'orgapacheluceneanalysiscn class hierarchy lucene 230 api'

distance = 440
spam score = 57
title = 'orgapacheluceneanalysisnl class hierarchy lucene 230 api'

distance = 442
spam score = 55
title = 'orgapachelucenewikipediaanalysis class hierarchy lucene 240 api'

distance = 442
spam score = 52
title = 'orgapachelucenesearchspell class hierarchy lucene 232 api'

distance = 445
spam score = 60
title = 'orgapachelucenebenchmarkbytaskutils class hierarchy lucene 230 api'

distance = 446
spam score = 63
title = 'orgapacheluceneutil class hierarchy lucene 220 api'

distance = 446
spam score = 61
title = 'orgapacheluceneanalysiscn class hierarchy lucene 220 api'

distance = 447
spam score = 52
title = 'orgapacheluceneanalysisde class hierarchy lucene 143 api'

distance = 497
spam score = 53
title = 'orgapacheluceneanalysisru class hierarchy lucene 200 api'

distance = 498
spam score = 53
title = 'orgapacheaxis2jaxbri class hierarchy axis2 api'

distance = 499
spam score = 53
title = 'orgapachelucenebenchmarkbytaskutils class hierarchy lucene 232 api'

distance = 502
spam score = 45
title = 'orgapacheabdera class hierarchy abdera bundle jar 040incubating api'

distance = 503
spam score = 57
title = 'orgapachelucenemisc class hierarchy lucene 220 api'

distance = 503
spam score = 67
title = 'orgapachesynapseendpointsutils class hierarchy apache synapse 12 api'

distance = 505
spam score = 51
title = 'class hierarchy lucene 230 api'

distance = 508
spam score = 55
title = 'orgapachelucenestoredb class hierarchy lucene 230 api'

distance = 509
spam score = 58
title = 'orgapacheluceneanalysisngram class hierarchy lucene 230 api'

distance = 513
spam score = 55
title = 'orgapachelucene class hierarchy lucene 20081220020442 api'

distance = 557
spam score = 56
title = 'orgapacheshaleclayfaces class hierarchy shale clay 104 api'

distance = 558
spam score = 49
title = 'orgapachelucenestoredb class hierarchy lucene 232 api'

distance = 560
spam score = 47
title = 'comsleepycatdb class hierarchy lucene 232 api'

distance = 560
spam score = 54
title = 'orgapacheactivemqtransportlogwriters class hierarchy activemq core 520 api'

distance = 563
spam score = 62
title = 'orgapachejasperxmlparser class hierarchy jasper internal api documentation'

distance = 564
spam score = 62
title = 'orgapachelog4jchainsawfavourites class hierarchy apache chainsaw 1990 api'

distance = 564
spam score = 50
title = 'orgapacheaxis2databindingtypemapping class hierarchy axis2 api'

distance = 566
spam score = 53
title = 'orgapachejorphanreflect class hierarchy apache jmeter api'

distance = 566
spam score = 65
title = 'orgapachelog4jchainsawosx class hierarchy apache chainsaw 1990 api'

distance = 569
spam score = 62
title = 'orgapacheturbinemodulesscreenserror class hierarchy turbine2 233 api'

distance = 603
spam score = 61
title = 'netsfsnowball class hierarchy lucene 230 api'

distance = 604
spam score = 59
title = 'orgapacheregexp class hierarchy lucene 20081220020442 api'

distance = 604
spam score = 62
title = 'orgapachelucenesearchspans class hierarchy lucene 220 api'

distance = 604
spam score = 51
title = 'class hierarchy lucene 231 api'

distance = 608
spam score = 51
title = 'netsfsnowball class hierarchy lucene 230 api'

distance = 609
spam score = 49
title = 'orgapachelucenegdatasearchconfig class hierarchy lucene 220 api'

distance = 609
spam score = 74
title = 'orgapacheluceneanalysis class hierarchy lucene 220 api'

distance = 610
spam score = 53
title = 'class hierarchy lucene 232 api'

distance = 610
spam score = 52
title = 'orgapacheshaletaglib class hierarchy shale core 104 api'

distance = 611
spam score = 55
title = 'orgapachelucenebenchmarkutils class hierarchy lucene 230 api'

distance = 650
spam score = 65
title = 'orgapachelucenequeryparseranalyzing class hierarchy lucene 20081220020442 api'

distance = 652
spam score = 57
title = 'orgapacheddlutilsplatformaxion class hierarchy ddlutils 10 api documentation'

distance = 654
spam score = 63
title = 'samplesutil class hierarchy apache synapse 12 api'

distance = 655
spam score = 56
title = 'orgapachelucenesearchregex class hierarchy lucene 230 api'

distance = 655
spam score = 52
title = 'orgapachederbytools class hierarchy apache derby 104 api documentation'

distance = 658
spam score = 61
title = 'orgapacheluceneanalysisth class hierarchy lucene 20081220020442 api'

distance = 658
spam score = 64
title = 'orgapachelucenegdataserverauthentication class hierarchy lucene 220 api'

distance = 660
spam score = 55
title = 'orgapacheddlutilsplatformmysql class hierarchy ddlutils 10 api documentation'

distance = 661
spam score = 58
title = 'orgapacheluceneswingmodels class hierarchy lucene 240 api'

distance = 664
spam score = 73
title = 'orgapachelucenesearchfunction class hierarchy lucene 220 api'

distance = 711
spam score = 64
title = 'orgapachenutchanalysis class hierarchy nutch 09 api'

distance = 712
spam score = 57
title = 'orgapacheddlutilsplatformhsqldb class hierarchy ddlutils 10 api documentation'

distance = 716
spam score = 52
title = 'orgapachederbymbeans class hierarchy apache derby 104 api documentation'

distance = 719
spam score = 59
title = 'orgapachemavendoxiamodulefml class hierarchy doxia 10alpha11 api'

distance = 720
spam score = 61
title = 'orgapachelucenebenchmarkstats class hierarchy lucene 20081220020442 api'

distance = 721
spam score = 57
title = 'orgapachelucenegdatautils class hierarchy lucene 220 api'

distance = 722
spam score = 44
title = 'orgapacheluceneanalysiscn class hierarchy lucene 200 api'

distance = 725
spam score = 54
title = 'orgapachejamestransportmailetsdebug class hierarchy apache james server 231snapshot api'

distance = 728
spam score = 55
title = 'orgapacheddlutilsplatformmaxdb class hierarchy ddlutils 10 api documentation'

distance = 728
spam score = 69
title = 'orgapachesynapseconfigxmlendpointsutils class hierarchy apache synapse 12 api'

distance = 830
spam score = 58
title = 'uses of package orgapachelucenegdatautils lucene 220 api'

distance = 831
spam score = 55
title = 'orgapachemavendoxiabookservicesrendererxhtml class hierarchy doxia 10alpha11 api'

distance = 835
spam score = 64
title = 'orgnuinintegrationjena class hierarchy nuin api documentation'

distance = 835
spam score = 67
title = 'orgtagneticcoreant class hierarchy tagneto javadoc'

distance = 835
spam score = 55
title = 'orgapachelucenequeryparsersurroundquery class hierarchy lucene 220 api'

distance = 835
spam score = 58
title = 'orgapachelucenexmlparserbuilders class hierarchy lucene 220 api'

distance = 836
spam score = 62
title = 'orgapachelucenebenchmarkbytaskfeeds class hierarchy lucene 220 api'

distance = 836
spam score = 51
title = 'orgapachelucenequeryparsersurroundquery class hierarchy lucene 200 api'

distance = 836
spam score = 56
title = 'orgapacheluceneanalysisshingle class hierarchy lucene 20081220020442 api'

distance = 838
spam score = 62
title = 'orgapachelucenegdatasearchindex class hierarchy lucene 220 api'

distance = 962
spam score = 57
title = 'orgjivesoftwareopenfirecommandsadminmuc class hierarchy openfire 363 javadoc'

distance = 964
spam score = 63
title = 'frgouvculturesdxsearchluceneanalysisfilter class hierarchy sdx 23b1 api'

distance = 973
spam score = 55
title = 'orgxmppmuc class hierarchy openfire 363 javadoc'

distance = 980
spam score = 66
title = 'orgapachelucenegdataserverregistry class hierarchy lucene 220 api'

distance = 981
spam score = 63
title = 'frgouvculturesdxapplication class hierarchy sdx 23b1 api'

distance = 982
spam score = 64
title = 'orgjivesoftwareopenfirevcard class hierarchy openfire 363 javadoc'

distance = 987
spam score = 59
title = 'orgapachelucenequeryparsersurroundquery class hierarchy lucene 20081220020442 api'

distance = 995
spam score = 50
title = 'orgjivesoftwaresmacksasl class hierarchy smack 310 documentation'

distance = 1003
spam score = 56
title = 'orgapachelucenebenchmarkbytasktasks class hierarchy lucene 240 api'

distance = 1005
spam score = 46
title = 'comjaliosjcmssearchspell class hierarchy jcms api'

distance = 1260
spam score = 51
title = 'uses of class orgapachelucenestoreindexinput lucene 230 api'

distance = 1263
spam score = 58
title = 'orgapachelucenestore lucene 20081220020442 api'

distance = 1265
spam score = 50
title = 'orgjivesoftwaresmackxworkgroupsettings class hierarchy smack 310 documentation'

distance = 1319
spam score = 52
title = 'gnuxmldomls hierarchy gnu jaxp library'

distance = 1326
spam score = 54
title = 'uses of package orgapachelucenegdatadata lucene 220 api'

distance = 1329
spam score = 47
title = 'orgw3cdomcss hierarchy gnu jaxp library'

distance = 1332
spam score = 56
title = 'uses of package orgapachelucenegdataserver lucene 220 api'

distance = 1343
spam score = 69
title = 'orgapacheluceneutil lucene 20081220020442 api'

distance = 180
spam score = 57
title = 'uses of package javaxrmi java 2 platform se v142'

distance = 193
spam score = 52
title = 'uses of package javaxtransaction java 2 platform se v142'

distance = 203
spam score = 60
title = 'uses of package javaxtransaction java 2 platform se v142'

distance = 205
spam score = 56
title = 'uses of package javaxrmi java 2 platform se v142'

distance = 211
spam score = 60
title = 'uses of package javaxrmi java 2 platform se v142'

distance = 255
spam score = 55
title = 'uses of class javaxtransactiontransactionrequiredexception java 2 platform se v142'

distance = 255
spam score = 59
title = 'uses of class javaxtransactiontransactionrequiredexception java 2 platform se v142'

distance = 260
spam score = 56
title = 'uses of class javaxrmiportableremoteobject java 2 platform se v142'

distance = 264
spam score = 60
title = 'uses of class javaxaccessibilityaccessibleresourcebundle java 2 platform se v142'

distance = 269
spam score = 54
title = 'uses of class javaxrmiportableremoteobject java 2 platform se v142'

distance = 277
spam score = 56
title = 'uses of class javaxaccessibilityaccessibleresourcebundle java 2 platform se v142'

distance = 278
spam score = 54
title = 'uses of class javaxtransactiontransactionrolledbackexception java 2 platform se v142'

distance = 279
spam score = 55
title = 'uses of class javaxaccessibilityaccessibleresourcebundle java 2 platform se v142'

distance = 279
spam score = 55
title = 'uses of class javaxtransactioninvalidtransactionexception java 2 platform se v142'

distance = 288
spam score = 54
title = 'uses of class javaxtransactiontransactionrolledbackexception java 2 platform se v142'

distance = 290
spam score = 64
title = 'javaxrmi class hierarchy java 2 platform se v142'

distance = 290
spam score = 64
title = 'javaxrmi class hierarchy java 2 platform se v142'

distance = 295
spam score = 62
title = 'uses of package javaxsoundsampledspi java 2 platform se v142'

distance = 298
spam score = 57
title = 'uses of package javaxactivity java 2 platform se 50'

distance = 300
spam score = 57
title = 'uses of package javaxsoundsampledspi java 2 platform se v142'

distance = 467
spam score = 51
title = 'javaxnet class hierarchy java 2 platform se v141'

distance = 467
spam score = 53
title = 'uses of interface javaxprintmultidocprintjob java 2 platform se v142'

distance = 468
spam score = 50
title = 'uses of interface javaxnamingspiresolver java 2 platform se 50'

distance = 468
spam score = 57
title = 'uses of class javaxcryptospecdhgenparameterspec java 2 platform se 50'

distance = 468
spam score = 57
title = 'uses of class javaxcryptospecpbeparameterspec java 2 platform se 50'

distance = 468
spam score = 56
title = 'javaxsecurityauthspi class hierarchy java 2 platform se v142'

distance = 468
spam score = 56
title = 'uses of class javaxsoundsampledspiaudiofilereader java 2 platform se 50'

distance = 469
spam score = 55
title = 'uses of interface javaxnamingeventobjectchangelistener java 2 platform se 50'

distance = 469
spam score = 52
title = 'uses of interface javaxprinturiexception java 2 platform se 50'

distance = 470
spam score = 53
title = 'uses of package javaxswingplafmulti java 2 platform se 50'

distance = 514
spam score = 51
title = 'uses of class javaxcryptospecdhprivatekeyspec java 2 platform se v141'

distance = 514
spam score = 65
title = 'uses of class javaawtframeaccessibleawtframe java 2 platform se v142'

distance = 515
spam score = 53
title = 'uses of interface javaxaccessibilityaccessibleextendedtext java 2 platform se 50'

distance = 515
spam score = 62
title = 'uses of package javaxsecurityauthx500 java 2 platform se v142'

distance = 515
spam score = 56
title = 'uses of class javalangabstractmethoderror java 2 platform se v142'

distance = 515
spam score = 60
title = 'javaxsecurityauthx500 class hierarchy java 2 platform se v142'

distance = 516
spam score = 59
title = 'uses of class javaxsoundmidispimidifilereader java 2 platform se 50'

distance = 516
spam score = 50
title = 'uses of class javaxswingplafbasicbasicdesktoppaneui java 2 platform se v141'

distance = 516
spam score = 51
title = 'uses of class javarmiactivationactivatefailedexception java 2 platform se v141'

distance = 517
spam score = 56
title = 'uses of interface javaxaccessibilityaccessiblestreamable java 2 platform se 50'

distance = 565
spam score = 57
title = 'uses of class orgomgportableserverpoapackageadapternonexistenthelper java 2 platform se v142'

distance = 567
spam score = 50
title = 'uses of class javaxswingplafbasicbasicsplitpaneuikeyboardhomehandler java 2 platform se v142'

distance = 567
spam score = 57
title = 'uses of class javaxprintattributestandardmediasizeiso java 2 platform se v141'

distance = 568
spam score = 58
title = 'uses of class javaxsoundmidimetamessage java 2 platform se v142'

distance = 569
spam score = 54
title = 'javaxxmltransformstream class hierarchy java 2 platform se v142'

distance = 569
spam score = 55
title = 'uses of class javaxprintattributestandardmediasizeengineering java 2 platform se 50'

distance = 569
spam score = 59
title = 'uses of class orgomgportableserverpoamanagerpackageadapterinactivehelper java 2 platform se v142'

distance = 569
spam score = 55
title = 'uses of class javaxswingjappletaccessiblejapplet java 2 platform se 50'

distance = 570
spam score = 57
title = 'uses of interface orgomgcorbaargout java 2 platform se v142'

distance = 570
spam score = 63
title = 'javaxswingtextrtf class hierarchy java 2 platform se v142'

distance = 613
spam score = 61
title = 'javaxsecuritycert class hierarchy java 2 platform se v142'

distance = 614
spam score = 61
title = 'javaximageiopluginsjpeg class hierarchy java 2 platform se v142'

distance = 615
spam score = 52
title = 'uses of class javaxprinteventprintjobattributeevent java 2 platform se v141'

distance = 615
spam score = 47
title = 'uses of interface javautilprefspreferencesfactory java 2 platform se v141'

distance = 615
spam score = 55
title = 'javarmiregistry class hierarchy java 2 platform se v142'

distance = 615
spam score = 56
title = 'uses of class javaxnetsslsslserversocketfactory java 2 platform se v142'

distance = 616
spam score = 52
title = 'uses of interface javasecurityaclgroup java 2 platform se v141'

distance = 617
spam score = 45
title = 'uses of interface javanetdatagramsocketimplfactory java 2 platform se v142'

distance = 617
spam score = 62
title = 'uses of class javaxswingtablejtableheaderaccessiblejtableheaderaccessiblejtableheaderentry java 2 platform se 50'

distance = 619
spam score = 53
title = 'javalangref class hierarchy java 2 platform se v141'

distance = 682
spam score = 50
title = 'uses of class orgomgportableserverpoamanagerpackageadapterinactivehelper java 2 platform se v141'

distance = 682
spam score = 61
title = 'uses of interface javasecuritycertificate java 2 platform se v142'

distance = 682
spam score = 63
title = 'javaxsql class hierarchy java 2 platform se v142'

distance = 682
spam score = 52
title = 'uses of class javaxswingborderbevelborder java 2 platform se v142'

distance = 682
spam score = 53
title = 'uses of class javaxswingtransferhandler java 2 platform se v142'

distance = 683
spam score = 63
title = 'uses of class javaxaccessibilityaccessiblebundle java 2 platform se v142'

distance = 683
spam score = 46
title = 'uses of interface javanetcontenthandlerfactory java 2 platform se v141'

distance = 683
spam score = 59
title = 'uses of interface javaxprinteventprintserviceattributelistener java 2 platform se v142'

distance = 683
spam score = 49
title = 'uses of class orgomgcosnamingnamingcontextextpackageaddresshelper java 2 platform se v141'

distance = 684
spam score = 63
title = 'orgomgstubjavarmi java 2 platform se v142'

distance = 748
spam score = 53
title = 'uses of class javautilprefsinvalidpreferencesformatexception java 2 platform se v141'

distance = 749
spam score = 59
title = 'javaxtransaction java 2 platform se v142'

distance = 749
spam score = 65
title = 'uses of class javaawttextcomponentaccessibleawttextcomponent java 2 platform se v142'

distance = 749
spam score = 58
title = 'uses of class javaxswingborderemptyborder java 2 platform se v142'

distance = 749
spam score = 56
title = 'uses of interface javaxswingundostateeditable java 2 platform se v142'

distance = 749
spam score = 61
title = 'uses of interface javaxswingundostateeditable java 2 platform se v142'

distance = 749
spam score = 60
title = 'uses of class javaxprintattributesize2dsyntax java 2 platform se 50'

distance = 749
spam score = 62
title = 'uses of class javaxswingborderemptyborder java 2 platform se v142'

distance = 750
spam score = 62
title = 'uses of class javaxaccessibilityaccessiblerelationset java 2 platform se v142'

distance = 750
spam score = 62
title = 'uses of class javaiorandomaccessfile java 2 platform se v142'

distance = 834
spam score = 47
title = 'java 2 platform se v131 uses of class javaappletappletaccessibleapplet'

distance = 835
spam score = 48
title = 'uses of interface javanetsocketimplfactory java 2 platform se v142'

distance = 835
spam score = 63
title = 'javaxnamingevent class hierarchy java 2 platform se 50'

distance = 837
spam score = 38
title = 'java 2 platform se v131 uses of class javaxnamingnameclasspair'

distance = 838
spam score = 59
title = 'uses of package javaxxmlparsers java 2 platform se v142'

distance = 838
spam score = 55
title = 'uses of class javaawtfontglyphjustificationinfo java 2 platform se v141'

distance = 839
spam score = 64
title = 'uses of class javaximageiospiimagewriterspi java 2 platform se 50'

distance = 840
spam score = 53
title = 'uses of interface javaawtimagerenderablerenderedimagefactory java 2 platform se v142'

distance = 841
spam score = 56
title = 'uses of class javautilregexmatcher java 2 platform se v142'

distance = 842
spam score = 60
title = 'uses of class javaximageiostreamiiobytebuffer java 2 platform se 50'

distance = 964
spam score = 56
title = 'uses of class javarminotboundexception java 2 platform se v142'

distance = 965
spam score = 63
title = 'uses of class javautiljarjarentry java 2 platform se v142'

distance = 965
spam score = 58
title = 'uses of package javaxswingtexthtmlparser java 2 platform se v141'

distance = 966
spam score = 61
title = 'uses of class javarmiaccessexception java 2 platform se v141'

distance = 967
spam score = 55
title = 'javaxsoundsampledspi java 2 platform se v142'

distance = 967
spam score = 59
title = 'uses of class javarmidgclease java 2 platform se v142'

distance = 968
spam score = 52
title = 'java 2 platform se v13 package javaxtransaction'

distance = 969
spam score = 53
title = 'uses of class javaximageiometadataiioinvalidtreeexception java 2 platform se 50'

distance = 969
spam score = 54
title = 'java 2 platform se v131 uses of class javaawtpanelaccessibleawtpanel'

distance = 970
spam score = 60
title = 'uses of class javarmiaccessexception java 2 platform se v142'

distance = 1859
spam score = 10
title = 'asian porn download movie asian pork recipe asian pride pics asian plants'

distance = 127
spam score = 60
title = 'uses of package orgapacheluceneindex lucene 230 api'

distance = 165
spam score = 54
title = 'uses of package orgapachelucene lucene 200 api'

distance = 171
spam score = 60
title = 'uses of package orgapachelucene lucene 220 api'

distance = 180
spam score = 57
title = 'uses of package orgapachelucenewordnet lucene 230 api'

distance = 184
spam score = 59
title = 'uses of package orgapachelucenemisc lucene 230 api'

distance = 203
spam score = 59
title = 'uses of package orgapachelucenemisc lucene 230 api'

distance = 204
spam score = 53
title = 'uses of package orgapachelucenedemo lucene 200 api'

distance = 205
spam score = 58
title = 'uses of package orgapachelucenedemo lucene 230 api'

distance = 217
spam score = 57
title = 'uses of package orgapachelucenemisc lucene 200 api'

distance = 223
spam score = 57
title = 'uses of class orgapachelucenewordnetsyns2index lucene 230 api'

distance = 224
spam score = 59
title = 'uses of package orgapachelucenebenchmarkutils lucene 230 api'

distance = 228
spam score = 57
title = 'uses of package orgapacheluceneanalysispayloads lucene 230 api'

distance = 234
spam score = 59
title = 'uses of class orgapacheluceneindexfieldnormmodifier lucene 230 api'

distance = 234
spam score = 57
title = 'uses of package orgapachelucenewordnet lucene 232 api'

distance = 239
spam score = 58
title = 'uses of package orgapacheluceneanalysissnowball lucene 230 api'

distance = 239
spam score = 56
title = 'uses of package orgapachelucenewordnet lucene 220 api'

distance = 240
spam score = 56
title = 'uses of class orgapachelucenedocumentnumbertools lucene 220 api'

distance = 241
spam score = 62
title = 'uses of package orgapacheluceneanalysiscjk lucene 230 api'

distance = 241
spam score = 58
title = 'uses of package orgapacheluceneanalysiscjk lucene 200 api'

distance = 243
spam score = 59
title = 'uses of package orgapacheluceneanalysisru lucene 230 api'

distance = 364
spam score = 49
title = 'uses of class orgapachelucenesearchsimilarsimilarityqueries lucene 200 api'

distance = 364
spam score = 55
title = 'uses of class orgapacheluceneanalysisczczechanalyzer lucene 230 api'

distance = 364
spam score = 54
title = 'uses of class orgapachelucenestorenativefslockfactory lucene 220 api'

distance = 364
spam score = 56
title = 'uses of class orgapachelucenexmlparserbuildersspanquerybuilderfactory lucene 230 api'

distance = 364
spam score = 53
title = 'uses of class orgapacheluceneanalysiselgreeklowercasefilter lucene 200 api'

distance = 365
spam score = 54
title = 'uses of class orgapacheluceneanalysisfrfrenchstemfilter lucene 200 api'

distance = 365
spam score = 56
title = 'uses of package orgapachelucenewordnet lucene 240 api'

distance = 365
spam score = 49
title = 'uses of class orgapachelucenesearchsimilarmorelikethis lucene 200 api'

distance = 365
spam score = 53
title = 'uses of class orgapachelucenesearchregexregexquery lucene 200 api'

distance = 365
spam score = 57
title = 'uses of class orgapachelucenexmlparserbuildersfuzzylikethisquerybuilder lucene 230 api'

distance = 423
spam score = 54
title = 'uses of class orgapacheluceneanalysisngramngramtokenfilter lucene 220 api'

distance = 424
spam score = 57
title = 'uses of class orgapachelucenebenchmarkbytaskutilsfileutils lucene 230 api'

distance = 425
spam score = 60
title = 'uses of class orgapacheluceneindexindexfilenamefilter lucene 230 api'

distance = 426
spam score = 67
title = 'overview lucene 230 api'

distance = 426
spam score = 66
title = 'overview lucene 232 api'

distance = 426
spam score = 47
title = 'uses of class orgapachelucenesearchspansspannotquery lucene 220 api'

distance = 426
spam score = 53
title = 'uses of class orgapachelucenebenchmarkbytasktasksopenreadertask lucene 230 api'

distance = 427
spam score = 56
title = 'uses of class orgapachelucenebenchmarkqualitytrectrec1mqreader lucene 230 api'

distance = 428
spam score = 65
title = 'deprecated list lucene 240 api'

distance = 429
spam score = 56
title = 'uses of class orgapachelucenequeryparsersurroundqueryandquery lucene 230 api'

distance = 507
spam score = 56
title = 'uses of class orgapachelucenesearchdefaultsimilarity lucene 230 api'

distance = 509
spam score = 61
title = 'orgapachelucenequeryparseranalyzing lucene 200 api'

distance = 510
spam score = 55
title = 'uses of class orgapachelucenestorebufferedindexoutput lucene 220 api'

distance = 511
spam score = 49
title = 'uses of class orgapachelucenegdataservlethandlerdeletefeedhandler lucene 220 api'

distance = 511
spam score = 59
title = 'uses of class orgapachelucenegdatagomcoregomdateconstructimpl lucene 220 api'

distance = 511
spam score = 54
title = 'uses of package comsleepycatdb lucene 220 api'

distance = 512
spam score = 51
title = 'uses of class orgapachelucenebenchmarkbytasktasksclosereadertask lucene 220 api'

distance = 512
spam score = 55
title = 'uses of package orgapachelucenegdatastoragelucenestoragerecover lucene 220 api'

distance = 513
spam score = 55
title = 'uses of package orgapacheluceneant lucene 240 api'

distance = 513
spam score = 75
title = 'uses of package orgapachelucenesearchpayloads lucene 220 api'

distance = 612
spam score = 59
title = 'orgapachelucenebenchmark lucene 240 api'

distance = 613
spam score = 55
title = 'uses of interface orgapachelucenegdatasearchsearchcomponent lucene 220 api'

distance = 613
spam score = 58
title = 'orgapacheluceneanalysisde lucene 240 api'

distance = 613
spam score = 52
title = 'comsleepycatdb lucene 232 api'

distance = 613
spam score = 51
title = 'uses of class orgapachelucenedocumentfield lucene 200 api'

distance = 613
spam score = 50
title = 'orgapachelucenebenchmarkutils lucene 232 api'

distance = 613
spam score = 62
title = 'orgapachelucenestoredb lucene 220 api'

distance = 614
spam score = 56
title = 'orgapachelucenebenchmarkbytaskutils lucene 230 api'

distance = 615
spam score = 65
title = 'orgapachelucenegdatasearch lucene 220 api'

distance = 616
spam score = 49
title = 'uses of class orgapachelucenebenchmarkqualityutilssubmissionreport lucene 230 api'

distance = 718
spam score = 61
title = 'uses of interface orgapacheluceneanalysisstandardstandardtokenizerconstants lucene 220 api'

distance = 718
spam score = 47
title = 'uses of class orgapachelucenesearchhighlighttokengroup lucene 220 api'

distance = 719
spam score = 54
title = 'orgapachelucenewikipediaanalysis lucene 20081220020442 api'

distance = 720
spam score = 61
title = 'orgapachelucenebenchmark lucene 211dev api'

distance = 720
spam score = 52
title = 'orgapachelucenesearchspell lucene 232 api'

distance = 721
spam score = 55
title = 'uses of class orgapachelucenequeryparserqueryparseroperator lucene 220 api'

distance = 721
spam score = 58
title = 'orgapacheregexp lucene 230 api'

distance = 721
spam score = 59
title = 'uses of class orgapacheluceneanalysisstandardstandardtokenizertokenmanager lucene 220 api'

distance = 721
spam score = 65
title = 'orgapacheluceneanalysismiscellaneous lucene 240 api'

distance = 722
spam score = 54
title = 'uses of class orgapachelucenesearchmultitermquery lucene 220 api'

distance = 795
spam score = 65
title = 'orgapacheluceneanalysisstandard lucene 230 api'

distance = 796
spam score = 59
title = 'deprecated list lucene 240 api'

distance = 796
spam score = 61
title = 'orgapachelucenegdatastoragedb4o lucene 220 api'

distance = 796
spam score = 57
title = 'uses of interface orgapachelucenesearchhighlightencoder lucene 230 api'

distance = 797
spam score = 65
title = 'orgapachelucenebenchmark lucene 20081220020442 api'

distance = 797
spam score = 51
title = 'orgapacheluceneswingmodels lucene 232 api'

distance = 798
spam score = 64
title = 'uses of package orgapachelucenestoreje lucene 230 api'

distance = 799
spam score = 50
title = 'orgapachelucenequeryparseranalyzing lucene 24dev api'

distance = 799
spam score = 50
title = 'orgapachelucenebenchmarkqualityutils lucene 231 api'

distance = 799
spam score = 55
title = 'orgapacheluceneanalysisbr lucene 24dev api'

distance = 901
spam score = 56
title = 'orgapachelucenexmlparser lucene 232 api'

distance = 901
spam score = 55
title = 'uses of class orgapacheluceneindexmemorysynonymmap lucene 200 api'

distance = 901
spam score = 56
title = 'orgapachelucenebenchmarkqualitytrec lucene 240 api'

distance = 903
spam score = 64
title = 'orgapacheluceneanalysisfr lucene 20081220020442 api'

distance = 903
spam score = 49
title = 'orgapachelucenestoredb lucene 240 api'

distance = 903
spam score = 69
title = 'orgapachelucenexmlparser lucene 230 api'

distance = 904
spam score = 57
title = 'uses of class orgapacheluceneantindextaskanalyzertype lucene 240 api'

distance = 906
spam score = 69
title = 'orgapacheluceneanalysisru lucene 220 api'

distance = 906
spam score = 70
title = 'orgapachelucenegdataserverregistryconfiguration lucene 220 api'

distance = 906
spam score = 62
title = 'orgapacheluceneanalysisel lucene 220 api'

distance = 1010
spam score = 59
title = 'orgapacheluceneindexmemory lucene 220 api'

distance = 1012
spam score = 58
title = 'orgapacheluceneindexmemory lucene 240 api'

distance = 1013
spam score = 65
title = 'orgapachelucenegdatagomcore lucene 220 api'

distance = 1013
spam score = 52
title = 'orgapacheluceneindexmemory lucene 232 api'

distance = 1013
spam score = 68
title = 'orgapachelucenesearchregex lucene 220 api'

distance = 1017
spam score = 65
title = 'orgapacheluceneanalysisstandard lucene 24dev api'

distance = 1018
spam score = 53
title = 'orgapacheluceneswingmodels lucene 240 api'

distance = 1019
spam score = 55
title = 'uses of class orgapachelucenestorejejedirectory lucene 230 api'

distance = 1020
spam score = 55
title = 'orgapacheluceneanalysisru lucene 220 api'

distance = 1021
spam score = 46
title = 'orgapachelucenesearchregex lucene 232 api'

distance = 1565
spam score = 46
title = 'uses of interface orgapachelucenegdatagomwritergomoutputwriter lucene 220 api'

distance = 1844
spam score = 36
title = 'santa clarita rose show results'

distance = 402
spam score = 23
title = ''

distance = 438
spam score = 23
title = ''

distance = 462
spam score = 20
title = ''

distance = 687
spam score = 25
title = ''

distance = 1171
spam score = 45
title = ''

distance = 373
spam score = 63
title = 'operation'

distance = 383
spam score = 63
title = 'priority'

distance = 390
spam score = 57
title = 'flag red5'

distance = 394
spam score = 44
title = 'confidence'

distance = 395
spam score = 66
title = 'orientation'

distance = 397
spam score = 66
title = 'jmscontroltype'

distance = 420
spam score = 57
title = 'errormessagetype waffle core 13 api'

distance = 422
spam score = 65
title = 'contextlevel waffle core 13 api'

distance = 430
spam score = 52
title = 'buffertype red5'

distance = 433
spam score = 55
title = 'streamfademode'

distance = 433
spam score = 54
title = 'honorific tapestry 5 project 5018 api'

distance = 434
spam score = 67
title = 'generationtime hibernate annotations api documentation'

distance = 435
spam score = 62
title = 'durationunit slf4j 156 api'

distance = 435
spam score = 67
title = 'httpcontrolmethod'

distance = 438
spam score = 61
title = 'xqueryversion'

distance = 439
spam score = 60
title = 'fuzzyedgepanelorigintype'

distance = 445
spam score = 72
title = 'lighttype'

distance = 446
spam score = 60
title = 'inside geomconverter 16 api'

distance = 448
spam score = 68
title = 'regionspecifiedkomaster combinatorial game suite 07'

distance = 448
spam score = 67
title = 'method solr nightly api'

distance = 546
spam score = 53
title = 'testrecordtesttype'

distance = 547
spam score = 35
title = 'joglcameraaxis croftsoft core'

distance = 547
spam score = 58
title = 'mqseriesconnectiontype'

distance = 548
spam score = 60
title = 'trailmeshupdatemode'

distance = 548
spam score = 50
title = 'bodycontent apache tobago 110snapshot api'

distance = 549
spam score = 61
title = 'texturecombineroperandalpha'

distance = 550
spam score = 70
title = 'resulttype'

distance = 550
spam score = 69
title = 'autolinkcontinuations rife api 161'

distance = 550
spam score = 53
title = 'modemvolume jhylafax 1310 api'

distance = 551
spam score = 61
title = 'zookeeperstates zookeeper 301 api'

distance = 576
spam score = 62
title = 'fsconstantsstartupoption hadoop 0172 api'

distance = 576
spam score = 74
title = 'texturerenderertarget'

distance = 577
spam score = 81
title = 'attributetype quark platform documentation'

distance = 577
spam score = 69
title = 'codestylewrapstyle java source'

distance = 577
spam score = 62
title = 'discriminatortype ejb 30 persistence api documentation'

distance = 579
spam score = 57
title = 'faceinfofaceimagetype jmrtd 042'

distance = 579
spam score = 59
title = 'keytype bigdata tm'

distance = 580
spam score = 69
title = 'updateunitprovidercategory auto update services'

distance = 580
spam score = 69
title = 'diffcontrollerdiffpane diff'

distance = 581
spam score = 57
title = 'columnsort tapestry 5 project 5018 api'

distance = 618
spam score = 45
title = 'homeviewsaveanswer sweet home 3d 151 api'

distance = 618
spam score = 71
title = 'enumerationaccess mondrian olap server version 30210775'

distance = 618
spam score = 56
title = 'conversationphase weblogic server 103 api reference'

distance = 618
spam score = 61
title = 'nullvaluesnullvaluedegree maltparser 12'

distance = 619
spam score = 58
title = 'textboxtextboxtype'

distance = 619
spam score = 64
title = 'filterlifecycleeventeventtype milyn smooks core 11 api'

distance = 620
spam score = 56
title = 'solrcachestate solr nightly api'

distance = 620
spam score = 68
title = 'cachedisposition abdera bundle jar 040incubating api'

distance = 620
spam score = 80
title = 'particlesystemparticletype'

distance = 621
spam score = 69
title = 'optimisticlocktype hibernate annotations api documentation'

distance = 652
spam score = 68
title = 'compilephase groovy 16rc2'

distance = 653
spam score = 75
title = 'fontscheme poi api documentation'

distance = 653
spam score = 68
title = 'classgraphalign'

distance = 653
spam score = 72
title = 'geocoderesultgeocodeaccuracy'

distance = 654
spam score = 67
title = 'icelandmarket jquantlib v012snapshot api javadocs'

distance = 655
spam score = 68
title = 'perclausekind aspectjtm aspectj5rt api'

distance = 655
spam score = 64
title = 'asyncutilwsspversion weblogic server 103 api reference'

distance = 655
spam score = 62
title = 'texturedepthtexturecomparemode'

distance = 657
spam score = 67
title = 'direction java learning to program with robots'

distance = 657
spam score = 66
title = 'musictrackqueuerepeattype'

distance = 692
spam score = 57
title = 'zlibcompressorcompressionlevel hadoop 0190 api'

distance = 692
spam score = 62
title = 'tabledlabelgrapherconfigkeys'

distance = 692
spam score = 59
title = 'taskcontrollerstatus plt utilities api plt20090208r4733'

distance = 692
spam score = 65
title = 'cascadetype hibernate annotations api documentation'

distance = 693
spam score = 70
title = 'cullstateface'

distance = 693
spam score = 65
title = 'sinkmode cascading'

distance = 694
spam score = 68
title = 'statistictype openfire 363 javadoc'

distance = 694
spam score = 51
title = 'beanpropertyaccessorpropertyset cojen 21 api'

distance = 694
spam score = 68
title = 'contenttype lucene 220 api'

distance = 695
spam score = 53
title = 'cnpjvalidatorrotina stella core 12 api'

distance = 737
spam score = 32
title = 'charttype'

distance = 737
spam score = 65
title = 'intervalconstraintintervalboundary elki environment for developing kddapplications supported by indexstructures'

distance = 739
spam score = 62
title = 'facesphaselistenerphaseid shale tiger extensions 104 api'

distance = 740
spam score = 65
title = 'calvaluedatatype quark platform documentation'

distance = 740
spam score = 67
title = 'abstractaspectjadvisorfactoryaspectjannotationtype spring framework api 25'

distance = 741
spam score = 62
title = 'fsaction hadoop 0172 api'

distance = 741
spam score = 59
title = 'helicaltrackfitterfitstatus orglcsim 110 api'

distance = 742
spam score = 55
title = 'configindexdirimplementation panfmp snapshot20090227 documentation'

distance = 742
spam score = 64
title = 'abstractaspectjadvisorfactoryaspectjannotationtype spring framework api 20'

distance = 743
spam score = 46
title = 'homeenvironmentproperty sweet home 3d 151 api'

distance = 790
spam score = 53
title = 'nodecapability bea weblogic portal server 102 javadoc overview'

distance = 790
spam score = 60
title = 'helicaltrackhitdriverhittype orglcsim 110 api'

distance = 790
spam score = 71
title = 'classindexsearchkind java source'

distance = 791
spam score = 59
title = 'assertionlevel cascading'

distance = 791
spam score = 65
title = 'whereusedqueryconstants java refactoring'

distance = 791
spam score = 61
title = 'fileparameterfiletype elki environment for developing kddapplications supported by indexstructures'

distance = 792
spam score = 52
title = 'channelchannelpattern weblogic server 103 api reference'

distance = 793
spam score = 58
title = 'zlibcompressorcompressionheader hadoop 0172 api'

distance = 793
spam score = 60
title = 'texturecombinerfunctionrgb'

distance = 794
spam score = 17
title = 'abstractaspectjadvisorfactoryaspectjannotationtype spring framework api 21 spring framework 210 api java c'

distance = 848
spam score = 74
title = 'topologycacheexceptiontype opends directory server api documentation'

distance = 849
spam score = 50
title = 'fieldnamingpolicy gson 123 api'

distance = 850
spam score = 49
title = 'chromosomesource bea weblogic portal server 102 javadoc overview'

distance = 851
spam score = 64
title = 'clearspacemuctranscripteventtype openfire 363 javadoc'

distance = 858
spam score = 78
title = 'desktoptypedesktoptypevalue bea weblogic portal server 100 javadoc overview'

distance = 862
spam score = 61
title = 'lockmodetype ejb 30 persistence api documentation'

distance = 862
spam score = 62
title = 'modifierparameterstype orglcsim 110 api'

distance = 866
spam score = 48
title = 'status echopoint api specification'

distance = 870
spam score = 67
title = 'eventprocessingtype visual library api'

distance = 871
spam score = 55
title = 'contentnodecontrolnodetype bea weblogic portal server 102 javadoc overview'

distance = 1181
spam score = 71
title = 'stabilitylevel opends directory server api documentation'

distance = 1201
spam score = 67
title = 'mp4esdsboxkind jaudiotagger user api v109'

distance = 1203
spam score = 73
title = 'tagfieldkey jaudiotagger user api v109'

distance = 1225
spam score = 62
title = 'specification geoapi 211 api'

distance = 1249
spam score = 80
title = 'specification geoapi interfaces 22snapshot api'

distance = 1264
spam score = 67
title = 'vorbiscommentfieldkey jaudiotagger user api v109'

distance = 1328
spam score = 56
title = 'imetadataquerysystemproperty bea weblogic portal server 102 javadoc overview'

distance = 1558
spam score = 47
title = 'frameidentifier aperture crawling and extraction framework api release 120'

distance = 1873
spam score = 5
title = 'darbe videos de darbe'

distance = 163
spam score = 61
title = 'uses of package orgapachevelocityconvert apache velocity 16 api'

distance = 163
spam score = 59
title = 'uses of package orgapachevelocityconvert apache velocity 161 api'

distance = 175
spam score = 60
title = 'uses of package orgapachevelocityservlet apache velocity 161 api'

distance = 175
spam score = 61
title = 'uses of package orgapachevelocityservlet apache velocity 16 api'

distance = 181
spam score = 59
title = 'uses of package orgapachevelocityio apache velocity 161 api'

distance = 183
spam score = 57
title = 'uses of package orgapachevelocityio apache velocity 16 api'

distance = 191
spam score = 58
title = 'uses of package orgapachevelocityutil apache velocity 16 test api'

distance = 192
spam score = 58
title = 'uses of package orgapachevelocityconvert apache velocity 17dev api'

distance = 209
spam score = 56
title = 'uses of package orgapachevelocityio apache velocity 16 test api'

distance = 215
spam score = 56
title = 'uses of package orgapachevelocityservlet apache velocity 17dev api'

distance = 218
spam score = 57
title = 'uses of package orgapachevelocitytestview apache velocity 16 test api'

distance = 222
spam score = 58
title = 'uses of package orgapachevelocityio apache velocity 17dev api'

distance = 223
spam score = 61
title = 'uses of package orgapachevelocitytexenant apache velocity 161 api'

distance = 228
spam score = 60
title = 'uses of package orgapachevelocitytexenutil apache velocity 161 api'

distance = 229
spam score = 55
title = 'uses of class orgapachevelocityvelocitycontext apache velocity 17dev api'

distance = 235
spam score = 57
title = 'uses of package orgapachevelocityutil apache velocity 17dev test api'

distance = 242
spam score = 60
title = 'uses of class orgapachevelocitytestclassloaderchangetestcase apache velocity 16 test api'

distance = 242
spam score = 56
title = 'uses of class orgapachevelocityappfieldmethodizer apache velocity 16 api'

distance = 243
spam score = 54
title = 'orgapachevelocitytexen apache velocity 16 api'

distance = 248
spam score = 61
title = 'uses of class orgapachevelocitytestvarargmethodstestcase apache velocity 16 test api'

distance = 365
spam score = 56
title = 'orgapachevelocityconvert apache velocity 15 api'

distance = 366
spam score = 57
title = 'uses of package orgapachevelocityappeventimplement apache velocity 16 api'

distance = 366
spam score = 55
title = 'uses of class orgapachevelocityappeventimplementescapehtmlreference apache velocity 161 api'

distance = 366
spam score = 54
title = 'uses of package orgapachevelocityappeventimplement apache velocity 161 api'

distance = 367
spam score = 62
title = 'uses of package orgapachevelocityapptools apache velocity 16 api'

distance = 369
spam score = 54
title = 'uses of interface orgapachevelocityutiltemplatenumber apache velocity 17dev api'

distance = 369
spam score = 55
title = 'orgapachevelocitytestview class hierarchy apache velocity 161 test api'

distance = 371
spam score = 61
title = 'uses of class orgapachevelocitytestissuesvelocity625testcase apache velocity 17dev test api'

distance = 371
spam score = 61
title = 'uses of class orgapachevelocitytestissuesvelocity355and552testcase apache velocity 17dev test api'

distance = 373
spam score = 56
title = 'uses of class orgapachevelocityruntimeparsernodesetpropertyexecutor apache velocity 161 api'

distance = 446
spam score = 53
title = 'velocity 14 api uses of package orgapachevelocityconvert'

distance = 452
spam score = 52
title = 'velocity 14 api uses of package orgapachevelocityruntimeexception'

distance = 454
spam score = 55
title = 'velocity 14 api uses of package orgapachevelocityio'

distance = 457
spam score = 55
title = 'orgapachevelocitytexenutil apache velocity 16 api'

distance = 459
spam score = 62
title = 'uses of interface orgapachevelocityruntimeparserparsertreeconstants apache velocity 16 api'

distance = 463
spam score = 62
title = 'orgapachevelocitytesteventhandler apache velocity 161 test api'

distance = 465
spam score = 61
title = 'uses of class orgapachevelocitytestutilintrospectionclassmaptestcasetestclassmap apache velocity 16 test api'

distance = 465
spam score = 60
title = 'uses of package orgapachevelocity apache velocity 161 api'

distance = 466
spam score = 69
title = 'orgapachevelocityapptools apache velocity 161 api'

distance = 466
spam score = 57
title = 'velocity 14 api uses of package orgapachevelocitytexen'

distance = 515
spam score = 54
title = 'uses of class orgapachevelocityappvelocityengine apache velocity 161 api'

distance = 515
spam score = 58
title = 'orgapachevelocityutil class hierarchy apache velocity 16 test api'

distance = 517
spam score = 65
title = 'orgapachevelocitytexenutil apache velocity 17dev api'

distance = 517
spam score = 60
title = 'orgapachevelocityruntimevisitor class hierarchy apache velocity 17dev api'

distance = 518
spam score = 61
title = 'velocity 14 api package orgapachevelocityservlet'

distance = 518
spam score = 58
title = 'uses of package orgapachevelocitytestprovider apache velocity 17dev test api'

distance = 518
spam score = 50
title = 'velocity 14 api uses of class orgapachevelocityruntimeexceptionnodeexception'

distance = 518
spam score = 62
title = 'orgapachevelocityapp apache velocity 161 api'

distance = 519
spam score = 49
title = 'velocity 14 api uses of class orgapachevelocityanakiatreewalker'

distance = 519
spam score = 49
title = 'velocity 14 api uses of class orgapachevelocityanakiaoutputwrapper'

distance = 594
spam score = 58
title = 'orgapachevelocitytestprovider class hierarchy apache velocity 16 test api'

distance = 595
spam score = 52
title = 'orgapachevelocityapp apache velocity 15 api'

distance = 595
spam score = 55
title = 'overview velocity site doxia renderer 120snapshot api'

distance = 596
spam score = 50
title = 'velocity 14 api uses of class orgapachevelocityruntimeloglogmanager'

distance = 601
spam score = 49
title = 'velocity 14 api uses of class orgapachevelocitytestproviderchild'

distance = 604
spam score = 70
title = 'deprecated list jbalboa api'

distance = 604
spam score = 65
title = 'uses of class orgjopendocumentutilexceptionutils jopendocument api'

distance = 605
spam score = 50
title = 'orgapachevelocitysitedoxiarunner velocity site doxia renderer 120snapshot api'

distance = 606
spam score = 53
title = 'velocity 14 api uses of class orgapachevelocitytestprovidertestprovider'

distance = 606
spam score = 55
title = 'uses of interface orgapachevelocityruntimerenderable apache velocity 17dev api'

distance = 664
spam score = 53
title = 'velocity 14 api uses of class orgapachevelocityvelocitycontext'

distance = 668
spam score = 57
title = 'velocity 14 api uses of package orgapachevelocityutil'

distance = 668
spam score = 58
title = 'orgapachevelocityservlet class hierarchy apache velocity 17dev api'

distance = 669
spam score = 57
title = 'orgapachevelocityruntimeresourceutil apache velocity 16 api'

distance = 672
spam score = 53
title = 'velocity 14 api orgapachevelocityruntimevisitor class hierarchy'

distance = 676
spam score = 55
title = 'orgapachevelocitysitenews velocity site news plugin 120snapshot api'

distance = 678
spam score = 48
title = 'uses of class orgapachevelocityruntimeresourceutilstringresource apache velocity 17dev api'

distance = 679
spam score = 48
title = 'velocity 14 api uses of class orgapachevelocityruntimeparserparserjjcalls'

distance = 681
spam score = 55
title = 'orgapachevelocitysitenewsmodelioxpp3 velocity site news plugin 120snapshot api'

distance = 682
spam score = 50
title = 'orgapachevelocityruntimeresourceloader class hierarchy apache velocity 17dev api'

distance = 775
spam score = 66
title = 'orgapachevelocitycontext apache velocity 15 api'

distance = 775
spam score = 48
title = 'velocity 14 api orgapachevelocityruntimeresourceloader class hierarchy'

distance = 777
spam score = 58
title = 'uses of class orgapachevelocityruntimeparsernodeastprocess apache velocity 16 api'

distance = 777
spam score = 58
title = 'velocity 14 api uses of class orgapachevelocityruntimevisitornodeviewmode'

distance = 778
spam score = 55
title = 'uses of package orgapachevelocityruntimeresourceutil apache velocity 161 api'

distance = 778
spam score = 58
title = 'velocity 14 api uses of package orgapachevelocityruntimelog'

distance = 778
spam score = 59
title = 'uses of class orgapachevelocityruntimeparsernodeastfalse apache velocity 16 api'

distance = 778
spam score = 59
title = 'uses of package orgapachevelocityruntimeresourceutil apache velocity 16 api'

distance = 779
spam score = 68
title = 'overview apache velocity 15 api'

distance = 780
spam score = 63
title = 'velocity 14 api uses of class orgapachevelocityutilintrospectionintrospectorbase'

distance = 895
spam score = 55
title = 'velocity 14 api uses of interface orgapachevelocityutilintrospectionuberspect'

distance = 897
spam score = 63
title = 'uses of class orgjopendocumentiostyletableproperties jopendocument api'

distance = 898
spam score = 66
title = 'velocity 14 api overview'

distance = 902
spam score = 72
title = 'orgapachevelocitytoolsviewservlet velocitytools 20snapshot documentation'

distance = 903
spam score = 70
title = 'orgapachevelocityruntimeresource apache velocity 161 api'

distance = 905
spam score = 66
title = 'orgapachevelocitytestutilintrospection class hierarchy apache velocity 16 test api'

distance = 906
spam score = 59
title = 'orgapachevelocitytestissues class hierarchy apache velocity 16 test api'

distance = 909
spam score = 87
title = 'overview velocitytools 20snapshot documentation'

distance = 912
spam score = 65
title = 'orgapachevelocityruntimeresource apache velocity 17dev api'

distance = 916
spam score = 60
title = 'orgapachevelocitytestutilintrospection class hierarchy apache velocity 17dev test api'

distance = 1033
spam score = 56
title = 'velocity 14 api uses of class orgapachevelocityruntimeparsernodeastexpression'

distance = 1033
spam score = 50
title = 'uses of package orgapachevelocityruntimelog apache velocity 17dev api'

distance = 1036
spam score = 57
title = 'velocity 14 api uses of class orgapachevelocityruntimeparsernodeastidentifier'

distance = 1038
spam score = 55
title = 'velocity 14 api uses of class orgapachevelocityruntimeparsernodeastgtnode'

distance = 1038
spam score = 54
title = 'velocity 14 api uses of class orgapachevelocityruntimeparsernodeaststringliteral'

distance = 1039
spam score = 58
title = 'velocity 14 api uses of class orgapachevelocityruntimeparsernodeastprocess'

distance = 1040
spam score = 59
title = 'velocity 14 api package orgapachevelocityruntime'

distance = 1041
spam score = 56
title = 'velocity 14 api package orgapachevelocityruntimeresourceloader'

distance = 1041
spam score = 57
title = 'velocity 14 api uses of class orgapachevelocityruntimeparsernodeastblock'

distance = 1043
spam score = 56
title = 'deprecated list'

distance = 1397
spam score = 88
title = 'orgapachevelocitytoolsview velocitytools 20snapshot documentation'

distance = 1437
spam score = 71
title = 'velocity 14 api deprecated list'

distance = 1441
spam score = 72
title = 'orgobjectstylecayenneaccessjdbc cayenne api documentation v12'

distance = 1473
spam score = 67
title = 'orgapachevelocitytest class hierarchy apache velocity 16 test api'

distance = 1474
spam score = 62
title = 'orgapachevelocitytest class hierarchy apache velocity 161 test api'

distance = 1534
spam score = 50
title = 'uses of package orgapachevelocityexception apache velocity 16 api'

distance = 262
spam score = 52
title = 'uses of class jatdemotwobodyexampletwobodyexample'

distance = 298
spam score = 49
title = 'uses of class jatinssimuaccelfiltermodel'

distance = 314
spam score = 56
title = 'uses of class jatdemorendezvouscwrendezvous'

distance = 317
spam score = 50
title = 'uses of class jatdemoplotexampleplotexample'

distance = 322
spam score = 55
title = 'uses of package jatdemointegratorexample'

distance = 331
spam score = 52
title = 'uses of class jattestpathtestpathtest'

distance = 333
spam score = 58
title = 'uses of package jattestinterpolatortest'

distance = 334
spam score = 53
title = 'uses of class jatforcesharrispriesterold'

distance = 340
spam score = 54
title = 'uses of class jattestpropagatorsimulationxml'

distance = 340
spam score = 57
title = 'uses of class jattestscalingsimpleintegrator'

distance = 342
spam score = 53
title = 'uses of class jatmatlabinterfacematlabfunc'

distance = 356
spam score = 50
title = 'uses of class jatdemozerovelcurvezerovelcurve'

distance = 358
spam score = 54
title = 'uses of class jatdemozerovelcurvethreebodyapp'

distance = 359
spam score = 54
title = 'uses of class jatdemovrplanetgridplanetgrid'

distance = 359
spam score = 54
title = 'uses of class jattestinterpolatortestinterpolatortest'

distance = 361
spam score = 57
title = 'uses of package jatmatvecdataarraytools'

distance = 364
spam score = 47
title = 'uses of class jatattitudefourrwmaneuveroutput'

distance = 368
spam score = 50
title = 'uses of class jatalgestimatorsextendedkalmanfilter'

distance = 374
spam score = 56
title = 'uses of class jatmatvecfunctiondoublefunctionexpression'

distance = 375
spam score = 55
title = 'uses of class jatdemovrthreebodythreebodyvr'

distance = 476
spam score = 54
title = 'uses of class jatdemolambertlamberttest'

distance = 476
spam score = 52
title = 'uses of class jatattitudethesisattitudesimulatora'

distance = 476
spam score = 60
title = 'uses of class jatattitudeutilanimationwindow2'

distance = 477
spam score = 47
title = 'uses of class jattestpathtestpathtest'

distance = 477
spam score = 61
title = 'uses of class jatdemoattitudeexamplerigidggcircularorbit'

distance = 477
spam score = 52
title = 'uses of class jatdemovrmoviemakerjpegimagestomovie'

distance = 477
spam score = 56
title = 'uses of package jatmatvecdataarraytools'

distance = 477
spam score = 56
title = 'uses of class jatgpselevationmask'

distance = 479
spam score = 43
title = 'uses of class jatdemovrmoviemakerjpegimagestomovie'

distance = 479
spam score = 52
title = 'uses of class jatgpsinsrelativergpsinsmeasurementmodel'

distance = 505
spam score = 48
title = 'uses of class jatalgopttestfunctionsfunction2'

distance = 506
spam score = 60
title = 'jattestpathtest class hierarchy'

distance = 506
spam score = 59
title = 'uses of package jatcmbodies'

distance = 506
spam score = 47
title = 'uses of class jatmatvecdatarandomvariable'

distance = 506
spam score = 65
title = 'uses of class jatcmeomde405body'

distance = 507
spam score = 63
title = 'jatxmlinputparse'

distance = 507
spam score = 69
title = 'uses of class jatdemovrthreebodythreebodyworks'

distance = 507
spam score = 53
title = 'uses of class jatgpsfiltersrelativergpsthruster'

distance = 509
spam score = 53
title = 'uses of class jatxmlinputimplinputtypeimplunmarshaller'

distance = 509
spam score = 71
title = 'uses of class jatdemoattitudeexamplerigidggeccentricorbit'

distance = 536
spam score = 57
title = 'uses of class jatalgzerofinder'

distance = 537
spam score = 52
title = 'uses of class jatdemovrthreebodythreebodynoplot'

distance = 538
spam score = 60
title = 'jatsim'

distance = 538
spam score = 51
title = 'uses of package jatdemovrattitude'

distance = 538
spam score = 55
title = 'uses of class jatxmlinputimplruntimecontenthandleradaptor'

distance = 539
spam score = 57
title = 'uses of class jatmatvecioguiplottoolsdataplot3d'

distance = 540
spam score = 50
title = 'uses of class jatdemovrthreebodythreebodyexample'

distance = 540
spam score = 53
title = 'uses of class jatspacetimeuniversemodel'

distance = 540
spam score = 71
title = 'uses of class jatdemointegratorexamplerkf78integrator'

distance = 542
spam score = 52
title = 'uses of class jatmatvecioguiplottoolsnotedpoint2d'

distance = 587
spam score = 75
title = 'jatdemofreeins class hierarchy'

distance = 588
spam score = 49
title = 'jatmatlabinterface'

distance = 590
spam score = 45
title = 'uses of class jatdemovrcopernicus1marsorbit'

distance = 590
spam score = 54
title = 'uses of class jatgpsearthblockage'

distance = 591
spam score = 46
title = 'uses of class jatalgopttestfunctionsrosenbrock'

distance = 591
spam score = 49
title = 'uses of class jatmatvecdatamatrixdecompositionshouseholder'

distance = 591
spam score = 47
title = 'uses of class jatgpsfiltersabsolutegpsmeasurementmodel'

distance = 592
spam score = 45
title = 'uses of class jatmatvecioguipanelparameters'

distance = 593
spam score = 69
title = 'jatsim class hierarchy'

distance = 593
spam score = 55
title = 'uses of class jatvrcopernicustrajectory'

distance = 651
spam score = 46
title = 'uses of class jatmatveciodatafiletoolstextstring'

distance = 652
spam score = 45
title = 'uses of class jatgpsgeneratorsrgpsmpmeasurementgenerator'

distance = 652
spam score = 54
title = 'uses of class jatmatvecdatavectorlist'

distance = 653
spam score = 52
title = 'uses of class jatmatvecioguiplottoolsdataplot3d'

distance = 654
spam score = 51
title = 'uses of class jatdemoostthrustdirection'

distance = 654
spam score = 58
title = 'uses of class jatcmcmdate'

distance = 657
spam score = 52
title = 'uses of class jattestrcpagestatedoublestar'

distance = 659
spam score = 57
title = 'uses of class jatcmbodiescentralbody'

distance = 662
spam score = 55
title = 'uses of package jatalgopt'

distance = 663
spam score = 66
title = 'jatattitude'

distance = 742
spam score = 60
title = 'jatutil'

distance = 743
spam score = 58
title = 'uses of package jatgpsfilters'

distance = 744
spam score = 55
title = 'uses of class jatgpsrgpsmeasurement'

distance = 745
spam score = 60
title = 'uses of class jatdemovrattitudeattitudesimclock'

distance = 746
spam score = 51
title = 'uses of class jatvrthreedstudioobject'

distance = 747
spam score = 68
title = 'jattestpropagator class hierarchy'

distance = 747
spam score = 55
title = 'uses of package jatdemovrsolarsystem'

distance = 748
spam score = 62
title = 'uses of class jatspacetimecaldate'

distance = 748
spam score = 50
title = 'uses of class jatmatvecdatamatrixdecompositionsqrdecomposition'

distance = 749
spam score = 56
title = 'uses of class jatinsrk4ins'

distance = 833
spam score = 52
title = 'uses of class jatgpsgpssv'

distance = 833
spam score = 71
title = 'jatcmeom class hierarchy'

distance = 833
spam score = 58
title = 'jatdemointegratorexample'

distance = 836
spam score = 56
title = 'uses of package jatmatveciogui'

distance = 839
spam score = 65
title = 'uses of class jatcmeomtwobodycsi'

distance = 839
spam score = 61
title = 'jatmatveciogui'

distance = 840
spam score = 57
title = 'uses of class jatalgintegratorsrungekuttafehlberg78'

distance = 840
spam score = 54
title = 'uses of class jatcmrendezvouscwtarget'

distance = 841
spam score = 52
title = 'uses of package jatmatvecdatamatrixdecompositions'

distance = 844
spam score = 73
title = 'jatdemoattitudeexample class hierarchy'

distance = 1011
spam score = 73
title = 'uses of class jattimerefcaldate'

distance = 1014
spam score = 70
title = 'uses of class jatforcesforcemodellistold'

distance = 1021
spam score = 71
title = 'jatdemovrmoviemaker class hierarchy'

distance = 1022
spam score = 53
title = 'uses of interface jatalgvectorfunction'

distance = 1025
spam score = 53
title = 'uses of class jatmatvecioguimatrixplot2d'

distance = 1029
spam score = 54
title = 'uses of class jatmatvecioguimatrixhist3d'

distance = 1035
spam score = 61
title = 'uses of class jatvraxis'

distance = 1039
spam score = 63
title = 'uses of class jattrajjgm3drageom'

distance = 1043
spam score = 72
title = 'jatdemovrsolarsystem'

distance = 1044
spam score = 59
title = 'uses of class jattimerefcaldate'

distance = 1402
spam score = 72
title = 'uses of interface jatspacecraftprimaryspacecraft'

distance = 1441
spam score = 58
title = 'uses of package jatvr'

distance = 1462
spam score = 62
title = 'uses of class jatvrcapturingcanvas3d'

distance = 341
spam score = 71
title = ''

distance = 343
spam score = 71
title = ''

distance = 350
spam score = 64
title = ''

distance = 350
spam score = 66
title = ''

distance = 351
spam score = 67
title = ''

distance = 363
spam score = 63
title = ''

distance = 365
spam score = 67
title = ''

distance = 370
spam score = 62
title = ''

distance = 372
spam score = 68
title = ''

distance = 373
spam score = 69
title = ''

distance = 375
spam score = 73
title = ''

distance = 376
spam score = 60
title = ''

distance = 377
spam score = 77
title = ''

distance = 377
spam score = 65
title = ''

distance = 378
spam score = 81
title = ''

distance = 380
spam score = 63
title = ''

distance = 380
spam score = 68
title = ''

distance = 383
spam score = 78
title = ''

distance = 388
spam score = 68
title = ''

distance = 389
spam score = 69
title = ''

distance = 408
spam score = 78
title = ''

distance = 408
spam score = 87
title = ''

distance = 413
spam score = 61
title = ''

distance = 419
spam score = 78
title = ''

distance = 422
spam score = 67
title = ''

distance = 427
spam score = 83
title = ''

distance = 428
spam score = 73
title = ''

distance = 441
spam score = 76
title = ''

distance = 451
spam score = 81
title = ''

distance = 463
spam score = 76
title = ''

distance = 465
spam score = 63
title = ''

distance = 465
spam score = 75
title = ''

distance = 469
spam score = 65
title = ''

distance = 474
spam score = 77
title = ''

distance = 478
spam score = 64
title = ''

distance = 603
spam score = 84
title = ''

distance = 609
spam score = 77
title = ''

distance = 740
spam score = 81
title = ''

distance = 747
spam score = 67
title = ''

distance = 751
spam score = 67
title = ''

distance = 854
spam score = 78
title = ''

distance = 860
spam score = 68
title = ''

distance = 873
spam score = 71
title = ''

distance = 876
spam score = 70
title = ''

distance = 892
spam score = 85
title = ''

distance = 895
spam score = 82
title = ''

distance = 969
spam score = 60
title = ''

distance = 970
spam score = 61
title = ''

distance = 977
spam score = 69
title = ''

distance = 981
spam score = 59
title = ''

distance = 982
spam score = 59
title = ''

distance = 984
spam score = 77
title = ''

distance = 1084
spam score = 60
title = ''

distance = 1084
spam score = 68
title = ''

distance = 1085
spam score = 61
title = ''

distance = 1088
spam score = 63
title = ''

distance = 1088
spam score = 57
title = ''

distance = 1088
spam score = 56
title = ''

distance = 1091
spam score = 62
title = ''

distance = 1093
spam score = 66
title = ''

distance = 1109
spam score = 75
title = ''

distance = 1110
spam score = 71
title = ''

distance = 226
spam score = 90
title = 'metnetaboutframe'

distance = 229
spam score = 90
title = 'guitest'

distance = 233
spam score = 90
title = 'errorconsole clack v16 api specification'

distance = 235
spam score = 88
title = 'errorconsole clack v16 api specification'

distance = 237
spam score = 91
title = 'errorconsole clack v16 api specification'

distance = 240
spam score = 91
title = 'registrationlabsgui'

distance = 240
spam score = 92
title = 'registrationlabsgui'

distance = 246
spam score = 92
title = 'main treeviz 016 20081216'

distance = 248
spam score = 94
title = 'tinyhtmlviewer'

distance = 257
spam score = 91
title = 'minorthird'

distance = 260
spam score = 89
title = 'pathbinderupdater'

distance = 263
spam score = 91
title = 'gui file2xliff4j'

distance = 265
spam score = 91
title = 'tableframe'

distance = 273
spam score = 91
title = 'spcelementinfoframe'

distance = 276
spam score = 86
title = 'aboutdialog'

distance = 283
spam score = 90
title = 'main'

distance = 294
spam score = 94
title = 'singleplot'

distance = 294
spam score = 88
title = 'imageframe'

distance = 294
spam score = 90
title = 'plotexample'

distance = 296
spam score = 87
title = 'dynzonecagui'

distance = 444
spam score = 66
title = 'unsharingform'

distance = 445
spam score = 91
title = 'wordclassview'

distance = 445
spam score = 94
title = 'singularsocketserviceappl singular service api'

distance = 451
spam score = 86
title = 'fileeventloader'

distance = 451
spam score = 89
title = 'configurationwizard scheduler api'

distance = 452
spam score = 89
title = 'piechartdemo1 jfreechart class library version 1012'

distance = 452
spam score = 94
title = 'poibrowser poi api documentation'

distance = 452
spam score = 67
title = 'information naradabrokering documentation release332'

distance = 452
spam score = 90
title = 'idtablejframe jemboss api'

distance = 453
spam score = 94
title = 'threeplots'

distance = 514
spam score = 88
title = 'errordialog formproc api version 13'

distance = 515
spam score = 59
title = 'nbgridftp naradabrokering documentation release332'

distance = 515
spam score = 59
title = 'exportgui'

distance = 515
spam score = 62
title = 'settingsframe jomic'

distance = 515
spam score = 64
title = 'mainscreen'

distance = 518
spam score = 61
title = 'lexerframe groovy 16rc3'

distance = 518
spam score = 76
title = 'rtreeenvironment'

distance = 518
spam score = 90
title = 'application javaunidu'

distance = 518
spam score = 88
title = 'tracksframe'

distance = 519
spam score = 88
title = 'resultsviewer foaftown jqbus api'

distance = 571
spam score = 88
title = 'pluginmanager jedit api'

distance = 572
spam score = 89
title = 'mainframe mapperxml presentation framework 198ga'

distance = 572
spam score = 61
title = 'parserpane hilbert ii'

distance = 574
spam score = 93
title = 'riataviewerframe'

distance = 574
spam score = 74
title = 'pfviewframe'

distance = 575
spam score = 63
title = 'pdfreader apachepdfbox080incubatordev api'

distance = 575
spam score = 66
title = 'querydialog'

distance = 575
spam score = 92
title = 'broadcastmessage webnms5 api docs'

distance = 576
spam score = 84
title = 'okframe cebit'

distance = 576
spam score = 92
title = 'reporthandlerlistenergui fc 040 api'

distance = 624
spam score = 59
title = 'topoframe oracle spatial java api reference'

distance = 624
spam score = 85
title = 'oaahelpdialog oaa 23 javadocs'

distance = 625
spam score = 83
title = 'oaahelpdialog oaa 23 javadocs'

distance = 627
spam score = 65
title = 'cansendframe jmri api'

distance = 627
spam score = 64
title = 'symbolicprogframe jmri api'

distance = 628
spam score = 87
title = 'roiclassifierview'

distance = 628
spam score = 89
title = 'agentframe mesh middleware api'

distance = 629
spam score = 81
title = 'mainframepic'

distance = 629
spam score = 89
title = 'exampleapp formproc api version 13'

distance = 630
spam score = 91
title = 'diagnosisframe'

distance = 703
spam score = 87
title = 'viewplotframe'

distance = 703
spam score = 60
title = 'outputframe parallel fftj 10 api specification'

distance = 704
spam score = 68
title = 'monframe jmri api'

distance = 704
spam score = 70
title = 'serialmonframe jmri api'

distance = 704
spam score = 68
title = 'pfviewframeinteractive'

distance = 707
spam score = 69
title = 'mrcmonframe jmri api'

distance = 708
spam score = 87
title = 'fonts imagej api'

distance = 709
spam score = 69
title = 'serialmonframe jmri api'

distance = 709
spam score = 87
title = 'fonts imagej api'

distance = 709
spam score = 89
title = 'synonymeditform'

distance = 783
spam score = 89
title = 'demowindow'

distance = 783
spam score = 92
title = 'cooccurrencesclientgui webservice api'

distance = 783
spam score = 90
title = 'wirestableframe jhdl api'

distance = 784
spam score = 92
title = 'serviceoverviewclientgui webservice api'

distance = 784
spam score = 93
title = 'synonymsclientgui webservice api'

distance = 785
spam score = 88
title = 'callbackdemo mig layout api'

distance = 785
spam score = 94
title = 'sentencesclientgui webservice api'

distance = 785
spam score = 77
title = 'abceditor'

distance = 787
spam score = 95
title = 'mysqlclientgui webservice api'

distance = 788
spam score = 95
title = 'leftneighboursclientgui webservice api'

distance = 859
spam score = 77
title = 'spliteditor'

distance = 860
spam score = 57
title = 'applicationframe'

distance = 861
spam score = 87
title = 'popupfiledialog o2plib docs'

distance = 864
spam score = 55
title = 'jxframe swinglabs javadoc'

distance = 865
spam score = 90
title = 'scrolltext'

distance = 865
spam score = 71
title = 'xsbsubprocessenginewindow'

distance = 869
spam score = 79
title = 'jpopupcalendar'

distance = 872
spam score = 58
title = 'viewerframe joelib2alpha api documentation'

distance = 877
spam score = 92
title = 'hateditableattributesframe'

distance = 877
spam score = 93
title = 'helpwindow'

distance = 980
spam score = 74
title = 'clockmonframe jmri api'

distance = 980
spam score = 85
title = 'browserlaunchertestapp'

distance = 981
spam score = 91
title = 'controlframe'

distance = 983
spam score = 33
title = 'verifierappframe'

distance = 990
spam score = 94
title = 'xdesktopapp'

distance = 990
spam score = 90
title = 'sbmlsqueezerui'

distance = 991
spam score = 92
title = 'plotframe'

distance = 993
spam score = 88
title = 'showresultset jemboss api'

distance = 997
spam score = 85
title = 'bsxdisplay module for jta 10 10snapshot api'

distance = 997
spam score = 93
title = 'mainframe'

distance = 1183
spam score = 83
title = 'appletframe'

distance = 1194
spam score = 87
title = 'fft2dframe'

distance = 1211
spam score = 73
title = 'formdesign czt gaffe 10 api'

distance = 1247
spam score = 54
title = 'dicomcleaner'

distance = 1411
spam score = 61
title = 'edborganizationbrowser edbjava api specification'

distance = 1422
spam score = 86
title = 'objectbrowsergui geoxygene 13 api documentation'

distance = 1480
spam score = 45
title = 'java swing'

distance = 1512
spam score = 50
title = 'martin stepp'

distance = 1566
spam score = 73
title = 'public object december 2005'

distance = 175
spam score = 53
title = 'uses of class orgapachecayennepersistentobject cayenne documentation 30snapshot api'

distance = 175
spam score = 53
title = 'uses of class orgapachecayenneobjectcontextutils cayenne documentation 30snapshot api'

distance = 183
spam score = 54
title = 'uses of class orgapachecayennedataobjectutils cayenne documentation 30snapshot api'

distance = 188
spam score = 55
title = 'uses of class orgapachecayenneplaceholder16 cayenne documentation 30snapshot api'

distance = 192
spam score = 59
title = 'uses of class orgapachecayenneenhancerenhancer cayenne documentation 30snapshot api'

distance = 194
spam score = 55
title = 'uses of class orgapachecayennepersistencestate cayenne documentation 30snapshot api'

distance = 202
spam score = 51
title = 'uses of class orgapachecayenneconfigurationexception cayenne documentation 30snapshot api'

distance = 208
spam score = 58
title = 'uses of class orgapachecayennecayennedataobject cayenne documentation 30snapshot api'

distance = 217
spam score = 60
title = 'uses of class orgapachecayennequeryrefreshquery cayenne documentation 30snapshot api'

distance = 222
spam score = 60
title = 'uses of class orgapachecayenneutilidutil cayenne documentation 30snapshot api'

distance = 225
spam score = 55
title = 'uses of class orgapachecayennemergedroprelationshiptomodel cayenne documentation 30snapshot api'

distance = 226
spam score = 49
title = 'uses of class orgapachecayenneaccessclientserverchannel cayenne documentation 30snapshot api'

distance = 228
spam score = 52
title = 'uses of class orgapachecayennequerynamedquery cayenne documentation 30snapshot api'

distance = 231
spam score = 50
title = 'uses of class orgapachecayennereflectidmapkeyaccessor cayenne documentation 30snapshot api'

distance = 233
spam score = 56
title = 'uses of class orgapachecayenneutildeleteruleupdater cayenne documentation 30snapshot api'

distance = 234
spam score = 56
title = 'uses of class orgapachecayennetoolsnamepatternmatcher cayenne documentation 30snapshot api'

distance = 234
spam score = 52
title = 'uses of class orgapachecayennequeryinsertbatchquery cayenne documentation 30snapshot api'

distance = 236
spam score = 56
title = 'uses of class orgapachecayennedataviewfieldcomponentfactory cayenne documentation 30snapshot api'

distance = 236
spam score = 60
title = 'uses of class orgapachecayennemapderiveddbentity cayenne documentation 30snapshot api'

distance = 237
spam score = 52
title = 'uses of class orgapachecayennequerydeletebatchquery cayenne documentation 30snapshot api'

distance = 327
spam score = 51
title = 'uses of class orgapachecayenneejbqlparserejbqlmax cayenne documentation 30snapshot api'

distance = 327
spam score = 55
title = 'uses of class orgapachecayenneaccessjdbcbindequaldirective cayenne documentation 30snapshot api'

distance = 328
spam score = 58
title = 'uses of class orgapachecayenneexpparserastnotequal cayenne documentation 30snapshot api'

distance = 328
spam score = 55
title = 'uses of class orgapachecayennedbadb2db2sniffer cayenne documentation 30snapshot api'

distance = 328
spam score = 65
title = 'uses of package orgapachecayennereflectgeneric cayenne documentation 30snapshot api'

distance = 328
spam score = 54
title = 'uses of class orgapachecayenneejbqlparserejbqlfrom cayenne documentation 30snapshot api'

distance = 328
spam score = 55
title = 'uses of class orgapachecayenneexpparserastobjpath cayenne documentation 30snapshot api'

distance = 328
spam score = 48
title = 'uses of class orgapachecayenneaccessutildistinctresultiterator cayenne documentation 30snapshot api'

distance = 328
spam score = 56
title = 'uses of class orgapachecayennedbaingresingressniffer cayenne documentation 30snapshot api'

distance = 329
spam score = 55
title = 'uses of class orgapachecayenneaccessrevengbasicnamingstrategy cayenne documentation 30snapshot api'

distance = 355
spam score = 49
title = 'uses of class orgapachecayenneaccesstransdeletetranslator cayenne documentation 30snapshot api'

distance = 355
spam score = 59
title = 'uses of class orgapachecayenneexpparserastlessorequal cayenne documentation 30snapshot api'

distance = 356
spam score = 57
title = 'uses of class orgapachecayenneexpparserastequal cayenne documentation 30snapshot api'

distance = 356
spam score = 50
title = 'uses of class orgapachecayennedbaopenbaseopenbasequalifiertranslator cayenne documentation 30snapshot api'

distance = 356
spam score = 57
title = 'uses of class orgapachecayennewocompatparsertokenmgrerror cayenne documentation 30snapshot api'

distance = 356
spam score = 57
title = 'uses of class orgapachecayennedbaopenbaseopenbasejoinstack cayenne documentation 30snapshot api'

distance = 357
spam score = 56
title = 'uses of class orgapachecayenneaccesstransinsertbatchquerybuilder cayenne documentation 30snapshot api'

distance = 357
spam score = 56
title = 'uses of class orgapachecayenneaccessjdbcejbqlfromtranslator cayenne documentation 30snapshot api'

distance = 358
spam score = 57
title = 'uses of class orgapachecayennedbasqlserversqlserverprocedureaction cayenne documentation 30snapshot api'

distance = 359
spam score = 52
title = 'uses of class orgapachecayenneejbqlparserejbqlabs cayenne documentation 30snapshot api'

distance = 471
spam score = 55
title = 'uses of class orgapachecayennejpamapjparelationship cayenne documentation 30snapshot api'

distance = 475
spam score = 63
title = 'uses of class orgapachecayenneinterceptobjectcontextdecorator cayenne documentation 30snapshot api'

distance = 479
spam score = 53
title = 'uses of class orgapachecayennemapentityresult cayenne documentation 30snapshot api'

distance = 480
spam score = 52
title = 'uses of class orgapachecayenneaccesstransdataobjectmatchtranslator cayenne documentation 30snapshot api'

distance = 481
spam score = 63
title = 'uses of class orgapachecayenneprojectvalidatordbrelationshipvalidator cayenne documentation 30snapshot api'

distance = 482
spam score = 56
title = 'uses of interface orgapachecayenneinstrumentinstrumentationfactory cayenne documentation 30snapshot api'

distance = 482
spam score = 59
title = 'uses of package orgapachehttputil httpcore 40beta4snapshot test api'

distance = 486
spam score = 62
title = 'uses of class orgapachecayenneinterceptdatachanneldecorator cayenne documentation 30snapshot api'

distance = 486
spam score = 58
title = 'uses of class orgapachecayenneprojectvalidatordatanodevalidator cayenne documentation 30snapshot api'

distance = 487
spam score = 56
title = 'uses of class orgapachehttpmalformedchunkcodingexception httpcore 40beta4snapshot api'

distance = 582
spam score = 51
title = 'uses of class orgapacheplutotestsuitetestsecuritymappingtest pluto testsuite portlet 200snapshot api'

distance = 582
spam score = 61
title = 'uses of class orgapachehttpmockuptesthttpserver httpcore 40beta4snapshot test api'

distance = 582
spam score = 53
title = 'uses of class orgapacheplutotestsuitetestactionparametertest pluto testsuite portlet 200snapshot api'

distance = 583
spam score = 58
title = 'uses of class orgapachecayennemergemergedirection cayenne documentation 30snapshot api'

distance = 583
spam score = 63
title = 'uses of class orgapachehttpprotocoltesthttprequesthandlerregistry httpcore 40beta4snapshot test api'

distance = 583
spam score = 49
title = 'uses of class orgapachecayennequeryentityresult cayenne documentation 30snapshot api'

distance = 584
spam score = 64
title = 'uses of class orgapachehttpentitytestbasichttpentity httpcore 40beta4snapshot test api'

distance = 584
spam score = 62
title = 'uses of class orgapachehttputiltestlangutils httpcore 40beta4snapshot test api'

distance = 584
spam score = 51
title = 'uses of class orgapacheplutotestsuitetestrenderresponsenocontenttypetest pluto testsuite portlet 200snapshot api'

distance = 585
spam score = 63
title = 'uses of class orgapachehttpprotocoltesthttpexecutioncontext httpcore 40beta4snapshot test api'

distance = 646
spam score = 52
title = 'uses of class orgapacheplutodriverservicescontainerfilterchainimpl pluto portal driver implementation classes 200snapshot api'

distance = 647
spam score = 65
title = 'orgapachecayenneaccessselect class hierarchy cayenne documentation 30snapshot api'

distance = 647
spam score = 52
title = 'uses of class orgapachehttpimplentitylaxcontentlengthstrategy httpcore 40beta4snapshot api'

distance = 648
spam score = 52
title = 'uses of class orgapacheplutotestsuitetestdispatcherrenderparametertestcompanionservlet pluto testsuite portlet 200snapshot api'

distance = 649
spam score = 61
title = 'uses of class orgapachehttpimpltestenglishreasonphrasecatalog httpcore 40beta4snapshot test api'

distance = 651
spam score = 69
title = 'orgapachecayennedbaingres class hierarchy cayenne documentation 30snapshot api'

distance = 651
spam score = 52
title = 'uses of class orgapachejamespostagejmxjvmresourcesampler apache james postage 01snapshot api'

distance = 652
spam score = 50
title = 'uses of class orgapachecayennejpamapjpasecondarytable cayenne documentation 30snapshot api'

distance = 652
spam score = 62
title = 'uses of class orgapachecayennexmlxmldecoder cayenne documentation 30snapshot api'

distance = 656
spam score = 55
title = 'orgapachecayennedbafrontbase apache cayenne api documentation v20incubatingsnapshot'

distance = 727
spam score = 47
title = 'uses of class orgapachecayennejpamapjpabasic cayenne documentation 30snapshot api'

distance = 729
spam score = 53
title = 'uses of class orgapacheplutotestsuitetestjsr286filterwildcardmappedfilter pluto testsuite portlet 200snapshot api'

distance = 731
spam score = 58
title = 'uses of class orgapachecayenneaccesstransjoinstack cayenne documentation 30snapshot api'

distance = 733
spam score = 61
title = 'uses of interface orgapachecayennecachequerycachefactory cayenne documentation 30snapshot api'

distance = 734
spam score = 69
title = 'orgapachecayenneremoteservice apache cayenne api documentation v20incubatingsnapshot'

distance = 734
spam score = 66
title = 'orgapachecayennedbahsqldb class hierarchy apache cayenne api documentation v20incubatingsnapshot'

distance = 734
spam score = 56
title = 'uses of interface orgapachehttpprotocolhttpresponseinterceptorlist httpcore 40beta4snapshot api'

distance = 734
spam score = 62
title = 'uses of interface orgapachecayennemapeventdbrelationshiplistener cayenne documentation 30snapshot api'

distance = 734
spam score = 66
title = 'orgapachecayenneprojectvalidator class hierarchy apache cayenne api documentation v20incubatingsnapshot'

distance = 735
spam score = 69
title = 'uses of class orgapachecayennegenartifactsgenerationmode cayenne documentation 30snapshot api'

distance = 892
spam score = 52
title = 'index pluto portal driver 200snapshot test api'

distance = 893
spam score = 66
title = 'uses of class orgapachecayenneaccessjdbcbasesqlaction cayenne documentation 30snapshot api'

distance = 896
spam score = 69
title = 'orgobjectstylecayennedbahsqldb cayenne api documentation v12'

distance = 901
spam score = 53
title = 'uses of class orgapachecayennequeryindirectquery cayenne documentation 30snapshot api'

distance = 901
spam score = 57
title = 'uses of interface orgapachecayenneconfpasswordencoding cayenne documentation 30snapshot api'

distance = 904
spam score = 58
title = 'uses of interface orgapachehttptokeniterator httpcore 40beta4snapshot api'

distance = 905
spam score = 60
title = 'uses of package orgapachecayenneejbqlparser cayenne documentation 30snapshot api'

distance = 906
spam score = 50
title = 'uses of interface orgapachecayennecachequerycacheentryfactory cayenne documentation 30snapshot api'

distance = 911
spam score = 68
title = 'orgapachecayenneexp cayenne documentation 30snapshot api'

distance = 912
spam score = 54
title = 'uses of interface orgapachehttpniofilecontentdecoder httpcore nio 40beta4snapshot api'

distance = 1127
spam score = 75
title = 'orgapachecayenneremote cayenne documentation 30snapshot api'

distance = 1128
spam score = 55
title = 'uses of class orgapachecayennereflectclassdescriptormap cayenne documentation 30snapshot api'

distance = 1134
spam score = 78
title = 'orgapachecayenneenhancer cayenne documentation 30snapshot api'

distance = 1135
spam score = 64
title = 'uses of class orgapachecayenneremoteremotesession cayenne documentation 30snapshot api'

distance = 1135
spam score = 76
title = 'uses of package orgapachecayenneremote cayenne documentation 30snapshot api'

distance = 1141
spam score = 54
title = 'uses of class orgapachecayennequeryquerycachestrategy cayenne documentation 30snapshot api'

distance = 1142
spam score = 74
title = 'orgapachecayennedba cayenne documentation 30snapshot api'

distance = 1146
spam score = 78
title = 'orgapachecayenneconn cayenne documentation 30snapshot api'

distance = 1146
spam score = 77
title = 'orgapachecayenneconn apache cayenne api documentation v20incubatingsnapshot'

distance = 1147
spam score = 50
title = 'uses of class orgapachecayennejpamapjpapropertydescriptor cayenne documentation 30snapshot api'

distance = 207
spam score = 59
title = ''

distance = 226
spam score = 56
title = ''

distance = 229
spam score = 58
title = ''

distance = 230
spam score = 55
title = ''

distance = 231
spam score = 61
title = ''

distance = 234
spam score = 58
title = ''

distance = 236
spam score = 56
title = ''

distance = 236
spam score = 59
title = ''

distance = 238
spam score = 57
title = ''

distance = 240
spam score = 57
title = ''

distance = 241
spam score = 58
title = ''

distance = 246
spam score = 61
title = ''

distance = 250
spam score = 55
title = ''

distance = 251
spam score = 58
title = ''

distance = 252
spam score = 57
title = ''

distance = 268
spam score = 56
title = ''

distance = 275
spam score = 59
title = ''

distance = 281
spam score = 54
title = ''

distance = 284
spam score = 56
title = ''

distance = 288
spam score = 59
title = ''

distance = 288
spam score = 55
title = ''

distance = 303
spam score = 59
title = ''

distance = 314
spam score = 53
title = ''

distance = 319
spam score = 63
title = ''

distance = 320
spam score = 57
title = ''

distance = 321
spam score = 56
title = ''

distance = 322
spam score = 55
title = ''

distance = 324
spam score = 56
title = ''

distance = 327
spam score = 53
title = ''

distance = 336
spam score = 61
title = ''

distance = 342
spam score = 58
title = ''

distance = 352
spam score = 58
title = ''

distance = 359
spam score = 56
title = ''

distance = 369
spam score = 52
title = ''

distance = 372
spam score = 56
title = ''

distance = 374
spam score = 55
title = ''

distance = 376
spam score = 55
title = ''

distance = 465
spam score = 59
title = ''

distance = 510
spam score = 56
title = ''

distance = 523
spam score = 61
title = ''

distance = 524
spam score = 60
title = ''

distance = 564
spam score = 59
title = ''

distance = 591
spam score = 59
title = ''

distance = 619
spam score = 61
title = ''

distance = 638
spam score = 76
title = ''

distance = 640
spam score = 54
title = ''

distance = 642
spam score = 53
title = ''

distance = 667
spam score = 55
title = ''

distance = 671
spam score = 66
title = ''

distance = 673
spam score = 62
title = ''

distance = 676
spam score = 58
title = ''

distance = 688
spam score = 64
title = ''

distance = 699
spam score = 80
title = ''

distance = 699
spam score = 72
title = ''

distance = 708
spam score = 58
title = ''

distance = 711
spam score = 61
title = ''

distance = 716
spam score = 57
title = ''

distance = 720
spam score = 50
title = ''

distance = 742
spam score = 62
title = ''

distance = 742
spam score = 57
title = ''

distance = 746
spam score = 54
title = ''

distance = 758
spam score = 65
title = ''

distance = 773
spam score = 54
title = ''

distance = 796
spam score = 67
title = ''

distance = 799
spam score = 59
title = ''

distance = 811
spam score = 64
title = ''

distance = 823
spam score = 58
title = ''

distance = 839
spam score = 59
title = ''

distance = 845
spam score = 67
title = ''

distance = 862
spam score = 66
title = ''

distance = 886
spam score = 58
title = ''

distance = 890
spam score = 55
title = ''

distance = 891
spam score = 55
title = ''

distance = 894
spam score = 52
title = ''

distance = 902
spam score = 65
title = ''

distance = 903
spam score = 62
title = ''

distance = 906
spam score = 63
title = ''

distance = 906
spam score = 62
title = ''

distance = 906
spam score = 65
title = ''

distance = 911
spam score = 61
title = ''

distance = 916
spam score = 64
title = ''

distance = 937
spam score = 62
title = ''

distance = 984
spam score = 61
title = ''

distance = 1004
spam score = 61
title = ''

distance = 1059
spam score = 67
title = ''

distance = 1089
spam score = 53
title = ''

distance = 1104
spam score = 68
title = ''

distance = 1116
spam score = 70
title = ''

distance = 1134
spam score = 69
title = ''

distance = 1157
spam score = 63
title = ''

distance = 1251
spam score = 62
title = ''

distance = 1273
spam score = 71
title = ''

distance = 1347
spam score = 64
title = ''

distance = 1347
spam score = 80
title = ''

distance = 1423
spam score = 70
title = ''

distance = 321
spam score = 46
title = 'viewerswitchingcancelled'

distance = 337
spam score = 66
title = 'mpjruntimeexception'

distance = 357
spam score = 62
title = 's3exception hadoop 0132dev api'

distance = 365
spam score = 70
title = 'epsexception'

distance = 378
spam score = 61
title = 'httpinvalidvalueexception'

distance = 383
spam score = 66
title = 'invalidparentexception'

distance = 387
spam score = 62
title = 'j2flexcoreexception'

distance = 387
spam score = 57
title = 'epsexception'

distance = 388
spam score = 52
title = 'authorizationexception jboss seam api documentation'

distance = 392
spam score = 49
title = 'requiredexception jboss seam api documentation'

distance = 393
spam score = 54
title = 'shouldnotimplement'

distance = 394
spam score = 50
title = 'requiredexception jboss seam api documentation'

distance = 396
spam score = 55
title = 'badparameterexception origin 102'

distance = 398
spam score = 78
title = 'joieexception'

distance = 399
spam score = 47
title = 'authorizationexception jboss seam api documentation'

distance = 401
spam score = 63
title = 'nullboxidexception jaudiotagger user api v109'

distance = 402
spam score = 70
title = 'unavailableexception'

distance = 402
spam score = 67
title = 'holderinitexception'

distance = 404
spam score = 75
title = 'componentexception cuba api documentation'

distance = 405
spam score = 46
title = 'requiredexception jboss seam api documentation'

distance = 546
spam score = 70
title = 'codeattributeruntimecopyexception javassist api'

distance = 547
spam score = 62
title = 'invalidschemaexception dom4j 161 api'

distance = 547
spam score = 58
title = 'leftrecursiveexception abstract simple parser api'

distance = 547
spam score = 51
title = 'symbolresolverexception'

distance = 547
spam score = 62
title = 'operationcanceledexception eclipse platform api specification'

distance = 547
spam score = 58
title = 'ilrundefinedmaintaskexception ilog jrules java api'

distance = 550
spam score = 61
title = 'cannotmockinneroranonymousclassexception himock 10beta1 api'

distance = 550
spam score = 51
title = 'exception lejos nxt api documentation'

distance = 551
spam score = 52
title = 'cycleinrolehierarchyexception spring security 204 api'

distance = 551
spam score = 56
title = 'rollbackexception rife api 161'

distance = 592
spam score = 51
title = 'calculatingzeroratesjdbcexception webcab bonds v201 j2se edition'

distance = 592
spam score = 67
title = 'omegahat api documentation class notimplementedexception'

distance = 592
spam score = 66
title = 'invalidfilenameexception refsend api'

distance = 592
spam score = 59
title = 'applicationinitializationexception freehep api specification version current'

distance = 593
spam score = 55
title = 'forwardratesjdbcexception webcab bonds v201 j2se edition'

distance = 593
spam score = 51
title = 'alreadydefinedexception elib api'

distance = 593
spam score = 73
title = 'abstractrestartresponseexception wicket 12snapshot api'

distance = 593
spam score = 61
title = 'addressexception robe 01snapshot api'

distance = 593
spam score = 49
title = 'lispundefinedfunctionexception jatha api documentation'

distance = 593
spam score = 60
title = 'ilvnotinjsflifecycleexception ilog jviews maps 81 api'

distance = 625
spam score = 58
title = 'europeandeltajdbcexception webcab options and futures v31 j2se edition'

distance = 625
spam score = 71
title = 'eventexception lcd api documentation'

distance = 625
spam score = 62
title = 'generallinearfactormodeljdbcexception webcab probability and statistics v35 j2se edition'

distance = 625
spam score = 73
title = 'negativearraysizeexception robojde api documentation v15'

distance = 625
spam score = 60
title = 'performanceevaluationjdbcexception webcab portfolio v50 j2se edition'

distance = 625
spam score = 51
title = 'durationconvexityjdbcexception webcab bonds j2ee edition'

distance = 625
spam score = 60
title = 'runtimeexception robojde api documentation v15'

distance = 626
spam score = 59
title = 'finderexception genjavacore 30 api'

distance = 626
spam score = 53
title = 'calculatingzeroratesjdbcexception webcab bonds j2ee edition'

distance = 626
spam score = 63
title = 'deprecationexception groovy 16rc3'

distance = 650
spam score = 63
title = 'discreteprobabilitydistributionapproximationjdbcexception webcab probability and statistics v35 j2se edition'

distance = 650
spam score = 59
title = 'contextexception'

distance = 650
spam score = 55
title = 'boletoexception stella boleto 12 api'

distance = 651
spam score = 63
title = 'operationcanceledexception eclipse platform api specification'

distance = 651
spam score = 58
title = 'interpolationjdbcexception webcab functions v20 j2se edition'

distance = 651
spam score = 65
title = 'exception robojde api documentation v15'

distance = 651
spam score = 60
title = 'unsupportedoperationexception robojde api documentation v15'

distance = 652
spam score = 65
title = 'smyle 081 api java class smyleexception'

distance = 652
spam score = 59
title = 'lookaheadconflictexception abstract simple parser api'

distance = 652
spam score = 64
title = 'docs for cs252 spring 2002 class connectivityviolationexception'

distance = 686
spam score = 51
title = 'tokenstreamretryexception elib api'

distance = 686
spam score = 12
title = 'aopoperationnotsupportedexception jbosscache api jboss 401 sp1 cache api documentation java c'

distance = 686
spam score = 49
title = 'bondsruntimeexception webcab options and futures v31 j2se edition'

distance = 687
spam score = 57
title = 'finitedifferencejdbcexception webcab options and futures v31 j2se edition'

distance = 687
spam score = 47
title = 'supplierscyclicdependencyexception google collections library snapshot20080818 alpha'

distance = 687
spam score = 61
title = 'unknownparticleidexception freehep physics 21 api'

distance = 687
spam score = 61
title = 'readonlyexception freehep api specification version current'

distance = 688
spam score = 52
title = 'generallinearjdbcexception webcab probability and statistics v35 j2ee edition'

distance = 688
spam score = 49
title = 'uploadsizelimitexceededexception echopoint api specification'

distance = 688
spam score = 57
title = 'blackscholesjdbcexception webcab options and futures v31 j2se edition'

distance = 737
spam score = 67
title = 'assertionfailedexception eclipse platform api specification'

distance = 739
spam score = 61
title = 'protegeexception protege 331'

distance = 739
spam score = 67
title = 'class restrictedaccessexception'

distance = 740
spam score = 49
title = 'emptystackexception sun spot api green'

distance = 740
spam score = 54
title = 'unsupportedphysicalmemoryexception sunspot api v40'

distance = 740
spam score = 61
title = 'ipexception'

distance = 740
spam score = 76
title = 'docs for cs252 spring 2002 class invalidvertexexception'

distance = 741
spam score = 82
title = 'classredefinitionexception jrockit management api jmapi'

distance = 742
spam score = 54
title = 'compilerexception objectweb common architecture for rmi objectweb layer api'

distance = 743
spam score = 64
title = 'antsecurityexception eclipse platform api specification'

distance = 806
spam score = 49
title = 'nomatchingactionmethodexception waffle core 13 api'

distance = 806
spam score = 41
title = 'higherorderdeclexception kodkod api'

distance = 807
spam score = 69
title = 'xerces 120 api class eventexception'

distance = 808
spam score = 57
title = 'variablehandlerexception cookxml java api'

distance = 809
spam score = 54
title = 'integrityconstraintexception sleepycat software inc berkeley db java api'

distance = 809
spam score = 62
title = 'functionhandlerexception cookxml java api'

distance = 810
spam score = 61
title = 'class runtimeoperationsexception'

distance = 810
spam score = 66
title = 'httptimeoutexception oakland software http client api'

distance = 812
spam score = 36
title = 'exceptionval oraclereg database xml java api reference'

distance = 814
spam score = 45
title = 'xqueryexception nux 16 api specification'

distance = 922
spam score = 72
title = 'waxexception'

distance = 923
spam score = 52
title = 'formulaexception'

distance = 923
spam score = 15
title = 'invalidparentexception jbossmanagement api jboss 401 sp1 management api documentation java c'

distance = 924
spam score = 46
title = 'unidimensionalexception webcab optimization v26 j2ee edition'

distance = 925
spam score = 72
title = 'invocationexception'

distance = 925
spam score = 62
title = 'class illegalsharingexception'

distance = 926
spam score = 62
title = 'notfound novell extend messaging platform api 51'

distance = 928
spam score = 41
title = 'unidimensionalexception webcab optimization v26 j2ee edition'

distance = 947
spam score = 54
title = 'xmlanalysisexception dkbricsxact'

distance = 950
spam score = 73
title = 'incrementalcommandcanceledexception google web toolkit javadoc'

distance = 1185
spam score = 59
title = 'chapter 17 emptystackexception'

distance = 1189
spam score = 58
title = 'bufferoverflowexception gnu classpath 095 documentation'

distance = 1196
spam score = 71
title = 'soapfaultexception axis api'

distance = 1199
spam score = 53
title = 'needmoreexception elib api'

distance = 1240
spam score = 53
title = 'ambiguousmatchexception starteam sdk documentation'

distance = 1244
spam score = 77
title = 'jsiminvalidprocessstateexception jsim simulation library v 060 api documentation'

distance = 1326
spam score = 56
title = 'nosuchentryexception isode java dsapi classes'

distance = 1412
spam score = 69
title = 'tm hapi 06snapshot api'

distance = 120
spam score = 62
title = 'uses of class orgapachebatikdomsvgsvgomfeoffsetelement apache batik javadoc'

distance = 129
spam score = 60
title = 'uses of class orgapachebatikdomsvgsvgomfontfacenameelement apache batik javadoc'

distance = 136
spam score = 61
title = 'uses of class orgapachebatikdomsvgsvgomfemorphologyelement apache batik javadoc'

distance = 138
spam score = 60
title = 'uses of class orgapachebatikdomsvgsvgomgelement apache batik javadoc'

distance = 143
spam score = 64
title = 'uses of class orgapachebatikdomsvgsvgomforeignobjectelement apache batik javadoc'

distance = 145
spam score = 62
title = 'uses of class orgapachebatikdomsvgsvgomfontfacesrcelement apache batik javadoc'

distance = 147
spam score = 63
title = 'uses of class orgapachebatikdomsvgsvgomfeblendelement apache batik javadoc'

distance = 149
spam score = 61
title = 'uses of class orgapachebatikdomsvgsvgstylesheetprocessinginstruction apache batik javadoc'

distance = 153
spam score = 64
title = 'uses of class orgapachebatikdomsvgsvgomcursorelement apache batik javadoc'

distance = 161
spam score = 62
title = 'uses of class orgapachebatikdomsvgsvgomglyphelement apache batik javadoc'

distance = 163
spam score = 62
title = 'uses of class orgapachebatikdomsvgsvgomfedisplacementmapelement apache batik javadoc'

distance = 164
spam score = 61
title = 'uses of class orgapachebatikdomsvgsvgomcolorprofileelement apache batik javadoc'

distance = 164
spam score = 65
title = 'uses of class orgapachebatikdomsvgsvgomaltglyphelement apache batik javadoc'

distance = 166
spam score = 64
title = 'uses of class orgapachebatikdomsvgsvgomanimatecolorelement apache batik javadoc'

distance = 167
spam score = 65
title = 'uses of class orgapachebatikdomsvgsvgomaltglyphitemelement apache batik javadoc'

distance = 168
spam score = 64
title = 'uses of class orgapachebatikdomsvgsvgomaltglyphdefelement apache batik javadoc'

distance = 169
spam score = 64
title = 'uses of class orgapachebatikdomsvgsvgomanimatemotionelement apache batik javadoc'

distance = 169
spam score = 61
title = 'uses of class orgapachebatikdomsvgsvgomfefuncrelement apache batik javadoc'

distance = 169
spam score = 64
title = 'uses of class orgapachebatikdomsvgsvgomanimatetransformelement apache batik javadoc'

distance = 170
spam score = 65
title = 'uses of class orgapachebatikdomsvgsvgomdefselement apache batik javadoc'

distance = 218
spam score = 59
title = 'uses of class orgapachebatikdomsvgabstractsvgpointlistpointslistbuilder apache batik javadoc'

distance = 218
spam score = 62
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationaltglyphelementfactory apache batik javadoc'

distance = 219
spam score = 58
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationellipseelementfactory apache batik javadoc'

distance = 219
spam score = 62
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationsetelementfactory apache batik javadoc'

distance = 219
spam score = 60
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationfemergeelementfactory apache batik javadoc'

distance = 219
spam score = 63
title = 'uses of class orgapachebatikdomsvg12svg12domimplementation apache batik javadoc'

distance = 219
spam score = 61
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationmissingglyphelementfactory apache batik javadoc'

distance = 220
spam score = 65
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationforeignobjectelementfactory apache batik javadoc'

distance = 220
spam score = 58
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationglyphelementfactory apache batik javadoc'

distance = 222
spam score = 59
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationfontfaceelementfactory apache batik javadoc'

distance = 232
spam score = 60
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationlineelementfactory apache batik javadoc'

distance = 232
spam score = 59
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationglyphrefelementfactory apache batik javadoc'

distance = 232
spam score = 60
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationfemergenodeelementfactory apache batik javadoc'

distance = 232
spam score = 59
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationfefuncrelementfactory apache batik javadoc'

distance = 232
spam score = 60
title = 'uses of class orgapachebatikdomsvg12svg12omdocument apache batik javadoc'

distance = 234
spam score = 59
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationfeoffsetelementfactory apache batik javadoc'

distance = 234
spam score = 59
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationscriptelementfactory apache batik javadoc'

distance = 234
spam score = 64
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationfepointlightelementfactory apache batik javadoc'

distance = 237
spam score = 58
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationfetileelementfactory apache batik javadoc'

distance = 238
spam score = 58
title = 'uses of class orgapachebatikdomsvgsvgdomimplementationfespotlightelementfactory apache batik javadoc'

distance = 295
spam score = 57
title = 'uses of class orgapachebatikdomsvg12svg12domimplementationxblcontentelementfactory apache batik javadoc'

distance = 306
spam score = 66
title = 'uses of class orgapachebatikdomsvgabstractsvgnumber apache batik javadoc'

distance = 310
spam score = 66
title = 'uses of class orgapachebatikdomsvgsvgdomimplementation apache batik javadoc'

distance = 321
spam score = 61
title = 'uses of class orgapachebatikdomsvgsvgdescriptiveelement apache batik javadoc'

distance = 339
spam score = 63
title = 'uses of class orgapachebatikdomsvgsvgstylableelementstyledeclaration apache batik javadoc'

distance = 341
spam score = 60
title = 'uses of class orgapachebatikdomsvgsvgstylableelementoverridestyledeclaration apache batik javadoc'

distance = 344
spam score = 61
title = 'uses of class orgapachebatikdomsvgabstractsvgnormpathseglistsvgpathseggenericitem apache batik javadoc'

distance = 347
spam score = 56
title = 'uses of class orgapachebatikdomsvg12svg12domimplementationflowrootelementfactory apache batik javadoc'

distance = 354
spam score = 66
title = 'uses of package orgw3cdom apache batik javadoc'

distance = 361
spam score = 60
title = 'uses of interface orgapachebatikdomsvg12svgglobal apache batik javadoc'

distance = 495
spam score = 64
title = 'uses of class orgapachebatikdomutiltriplyindexedtable apache batik javadoc'

distance = 496
spam score = 61
title = 'uses of class orgapachebatikdomsvgabstractsvglengthlist apache batik javadoc'

distance = 505
spam score = 65
title = 'uses of class orgapachebatikbridgesvg12contentmanagerdomattrmodifiedeventlistener apache batik javadoc'

distance = 506
spam score = 77
title = 'uses of class orgapachebatikdomabstractdocumentfragment apache batik javadoc'

distance = 509
spam score = 67
title = 'uses of class orgapachebatikdomutilhashtablestack apache batik javadoc'

distance = 511
spam score = 69
title = 'uses of class orgapachebatikdomabstractdocumentdocumentconfiguration apache batik javadoc'

distance = 515
spam score = 66
title = 'uses of class orgapachebatikbridgebridgecontexteventlistenermememto apache batik javadoc'

distance = 518
spam score = 68
title = 'orgapachebatikgvtsvg12 class hierarchy apache batik javadoc'

distance = 518
spam score = 59
title = 'uses of interface orgapachebatikcssenginecssnavigabledocument apache batik javadoc'

distance = 526
spam score = 62
title = 'uses of class orgapachebatikextensionsvgglyphiterator apache batik javadoc'

distance = 646
spam score = 71
title = 'uses of interface orgw3cdomeventsdocumentevent apache batik javadoc'

distance = 662
spam score = 73
title = 'uses of class orgapachebatikutilcleanerthreadsoftreferencecleared apache batik javadoc'

distance = 668
spam score = 72
title = 'uses of class orgapachebatikdomsvgabstractsvgtransform apache batik javadoc'

distance = 671
spam score = 66
title = 'uses of class orgapachebatikswingsvgabstractjsvgcomponent apache batik javadoc'

distance = 674
spam score = 68
title = 'uses of class orgapachebatikdomeventsdomuievent apache batik javadoc'

distance = 677
spam score = 68
title = 'uses of class orgapachebatikparserdefaultpreserveaspectratiohandler apache batik javadoc'

distance = 680
spam score = 73
title = 'uses of class orgapachebatikdomutilinttable apache batik javadoc'

distance = 681
spam score = 68
title = 'orgapachebatikdomtraversal apache batik javadoc'

distance = 686
spam score = 63
title = 'uses of interface orgapachebatikbridgesvg12abstractcontentselectorcontentselectorfactory apache batik javadoc'

distance = 689
spam score = 66
title = 'uses of class orgapachebatikdomeventseventlistenerlist apache batik javadoc'

distance = 827
spam score = 65
title = 'uses of class orgapachebatikdomsvgsvggraphicselement apache batik javadoc'

distance = 832
spam score = 73
title = 'uses of class orgapachebatikdomabstractchildnode apache batik javadoc'

distance = 838
spam score = 76
title = 'uses of interface orgapachebatikdomstylesheetfactory apache batik javadoc'

distance = 842
spam score = 62
title = 'uses of interface orgapachebatikcssdomcssomstyledeclarationmodificationhandler apache batik javadoc'

distance = 854
spam score = 59
title = 'uses of class orgapachebatikgvtrendererbasictextpainter apache batik javadoc'

distance = 856
spam score = 58
title = 'uses of class orgapachebatikdomsvg12bindableelement apache batik javadoc'

distance = 860
spam score = 71
title = 'uses of class orgapachebatikbridgegvtbuilder apache batik javadoc'

distance = 871
spam score = 69
title = 'uses of class orgapachebatikswinggvtjgvtcomponent apache batik javadoc'

distance = 874
spam score = 70
title = 'uses of class orgapachebatikextensionextensionelement apache batik javadoc'

distance = 875
spam score = 70
title = 'uses of class orgapachebatiksvggenabstractsvgfilterconverter apache batik javadoc'

distance = 1013
spam score = 59
title = 'uses of class orgapachebatikcssenginevaluelengthmanager apache batik javadoc'

distance = 1015
spam score = 75
title = 'uses of class orgapachebatikscriptinterpreterpool apache batik javadoc'

distance = 1023
spam score = 80
title = 'uses of class orgapachebatikdomeventseventsupport apache batik javadoc'

distance = 1033
spam score = 71
title = 'uses of class orgw3cdomeventseventexception apache batik javadoc'

distance = 1049
spam score = 78
title = 'uses of class orgapachebatikdomeventseventlistenerlistentry apache batik javadoc'

distance = 1052
spam score = 61
title = 'uses of package orgapachebatikcssparser apache batik javadoc'

distance = 1057
spam score = 69
title = 'uses of class orgapachebatikswinggvtabstractjgvtcomponentlistener apache batik javadoc'

distance = 1061
spam score = 67
title = 'uses of interface orgapachebatikparserpathhandler apache batik javadoc'

distance = 1061
spam score = 73
title = 'uses of class orgapachebatiktranscoderabstracttranscoder apache batik javadoc'

distance = 1066
spam score = 71
title = 'uses of class orgapachebatikbridgesvg12abstractcontentselector apache batik javadoc'

distance = 1164
spam score = 75
title = 'uses of package orgapachebatikdomevents apache batik javadoc'

distance = 1178
spam score = 68
title = 'uses of interface orgapachebatikscriptwindow apache batik javadoc'

distance = 1183
spam score = 76
title = 'orgapachebatikdomevents apache batik javadoc'

distance = 1187
spam score = 68
title = 'uses of interface orgapachebatikswinggvtgvttreerendererlistener apache batik javadoc'

distance = 1188
spam score = 78
title = 'uses of interface orgapachebatikgvteventeventdispatcher apache batik javadoc'

distance = 1196
spam score = 67
title = 'uses of interface orgapachebatikcssenginecssnavigabledocumentlistener apache batik javadoc'

distance = 1198
spam score = 67
title = 'uses of package orgapachebatikgvtrenderer apache batik javadoc'

distance = 1201
spam score = 57