tree path: root node -> a79a10460
clusters in node: 960
spam scores: The spammiest documents have a score of 0, and the least spammy have a score of 99. The spam score is the percentage of documents in the collection more spammy than this document. Cluster spam scores are averaged across all documents in a cluster.

clusterid = a79c729d0
RMSE = 0
spam score = 32
documents = 1
clusterid = a79d00970
RMSE = 0
spam score = 64
documents = 1
clusterid = a79dee9c0
RMSE = 0
spam score = 62
documents = 1
clusterid = a79e42a40
RMSE = 0
spam score = 46
documents = 1
clusterid = a7a59abb0
RMSE = 0
spam score = 78
documents = 1
clusterid = a79c167f0
RMSE = 0
spam score = 19
documents = 1
clusterid = a79acc7c0
RMSE = 2.70801
spam score = 98.6667
documents = 3
clusterid = a7a761e40
RMSE = 10.198
spam score = 40.5
documents = 2
clusterid = a79ebbb90
RMSE = 32.5112
spam score = 96.213
documents = 216
clusterid = a7a440240
RMSE = 45.4606
spam score = 55.3333
documents = 3
clusterid = a7a794000
RMSE = 90.2102
spam score = 46.875
documents = 32
clusterid = a79a7d150
RMSE = 139.535
spam score = 38.25
documents = 4
clusterid = a7a519480
RMSE = 154.084
spam score = 36.9304
documents = 345
clusterid = a7a680660
RMSE = 181.791
spam score = 55.6358
documents = 475
clusterid = a7a0a8770
RMSE = 190.054
spam score = 90.6758
documents = 256
clusterid = a7a9e9230
RMSE = 190.95
spam score = 40.2776
documents = 688
clusterid = a7a05d4d0
RMSE = 218.014
spam score = 59.5
documents = 24
clusterid = a7a1c8980
RMSE = 223.884
spam score = 28.7396
documents = 1183
clusterid = a79f94dd0
RMSE = 240.444
spam score = 41.2105
documents = 19
clusterid = a7a3f0cd0
RMSE = 257.04
spam score = 60.9365
documents = 63
clusterid = a7a5d5310
RMSE = 272.962
spam score = 72.725
documents = 40
clusterid = a79e42fc0
RMSE = 278.766
spam score = 49.0306
documents = 98
clusterid = a7a7b5680
RMSE = 287.614
spam score = 48.525
documents = 40
clusterid = a7a91c860
RMSE = 290.646
spam score = 25.8545
documents = 110
clusterid = a7a836db0
RMSE = 337.715
spam score = 96.4524
documents = 42
clusterid = a7a57d800
RMSE = 358.035
spam score = 89.9468
documents = 94
clusterid = a7a2c4250
RMSE = 370.605
spam score = 60.9247
documents = 239
clusterid = a7a7fc650
RMSE = 381.832
spam score = 50.7255
documents = 204
clusterid = a79cb99a0
RMSE = 388.904
spam score = 46.661
documents = 59
clusterid = a7a142f80
RMSE = 396.829
spam score = 47.6623
documents = 77
clusterid = a7a345980
RMSE = 397.303
spam score = 27.48
documents = 25
clusterid = a7a656a40
RMSE = 421.474
spam score = 60.435
documents = 177
clusterid = a7a7a4b40
RMSE = 438.688
spam score = 54.5517
documents = 348
clusterid = a79b13790
RMSE = 444.218
spam score = 54.8333
documents = 18
clusterid = a79d4fee0
RMSE = 449.695
spam score = 64.1875
documents = 160
clusterid = a7a858430
RMSE = 486.873
spam score = 29.0543
documents = 350
clusterid = a7a4ce1e0
RMSE = 495.087
spam score = 45.699
documents = 309
clusterid = a79b2ca70
RMSE = 504.747
spam score = 42.9062
documents = 768
clusterid = a79bfd710
RMSE = 512.147
spam score = 44.1807
documents = 808
clusterid = a7a510ee0
RMSE = 521.941
spam score = 30.0571
documents = 70
clusterid = a7a02b310
RMSE = 535.403
spam score = 33.2683
documents = 328
clusterid = a7a022d70
RMSE = 582.888
spam score = 88.6007
documents = 909
clusterid = a7a978640
RMSE = 591.79
spam score = 95.0909
documents = 11
clusterid = a7a72b9b0
RMSE = 602.24
spam score = 78.0535
documents = 935
clusterid = a7a618010
RMSE = 604.291
spam score = 25.1905
documents = 21
clusterid = a79e0bd70
RMSE = 605.869
spam score = 55
documents = 4
clusterid = a7a0059c0
RMSE = 611.578
spam score = 36.4398
documents = 191
clusterid = a7a1f25a0
RMSE = 613.475
spam score = 79.0269
documents = 521
clusterid = a7a5fac60
RMSE = 620.885
spam score = 70
documents = 2
clusterid = a79d58480
RMSE = 632.968
spam score = 83.233
documents = 781
clusterid = a79fe8610
RMSE = 637.429
spam score = 89.7
documents = 20
clusterid = a7a8f6f10
RMSE = 654.358
spam score = 43.1467
documents = 75
clusterid = a7a2030e0
RMSE = 656.76
spam score = 32.0035
documents = 1733
clusterid = a7a75db70
RMSE = 676.832
spam score = 81.4746
documents = 59
clusterid = a7a6780c0
RMSE = 677.758
spam score = 66.9271
documents = 576
clusterid = a79ec4130
RMSE = 678.767
spam score = 82.5775
documents = 71
clusterid = a7a59ee80
RMSE = 687.533
spam score = 35.9195
documents = 807
clusterid = a7a628b50
RMSE = 693.351
spam score = 70.5135
documents = 333
clusterid = a7a7d6d00
RMSE = 698.481
spam score = 41.0881
documents = 261
clusterid = a7a19ed60
RMSE = 713.299
spam score = 78.9256
documents = 309
clusterid = a7a94a750
RMSE = 714.304
spam score = 82.174
documents = 385
clusterid = a79d75830
RMSE = 740.788
spam score = 64
documents = 22
clusterid = a7aa02310
RMSE = 745.754
spam score = 22.4474
documents = 38
clusterid = a7a1fab40
RMSE = 746.272
spam score = 40.6525
documents = 259
clusterid = a7a217ef0
RMSE = 749.501
spam score = 73.6923
documents = 39
clusterid = a7a76e6b0
RMSE = 751.552
spam score = 49.69
documents = 2145
clusterid = a7a86d240
RMSE = 751.827
spam score = 34.8056
documents = 36
clusterid = a7a3521f0
RMSE = 780.886
spam score = 59.5124
documents = 121
clusterid = a7a76a3e0
RMSE = 794.452
spam score = 75.6667
documents = 3
clusterid = a7a508940
RMSE = 795.024
spam score = 72.7982
documents = 223
clusterid = a79d96eb0
RMSE = 808.085
spam score = 78.3333
documents = 72
clusterid = a79c12520
RMSE = 810.494
spam score = 65.992
documents = 251
clusterid = a7a8a36d0
RMSE = 817.871
spam score = 62.8511
documents = 47
clusterid = a79d71560
RMSE = 825.52
spam score = 18.3488
documents = 129
clusterid = a7a459320
RMSE = 832.317
spam score = 81.2
documents = 5
clusterid = a7a41a8f0
RMSE = 834.597
spam score = 58.2353
documents = 85
clusterid = a7a26b730
RMSE = 843.093
spam score = 92.1905
documents = 63
clusterid = a79a81420
RMSE = 843.387
spam score = 73.4312
documents = 109
clusterid = a7a7d2a30
RMSE = 872.611
spam score = 60.4457
documents = 92
clusterid = a79dbc800
RMSE = 878.697
spam score = 48.5
documents = 8
clusterid = a7a320030
RMSE = 881.593
spam score = 78.6875
documents = 16
clusterid = a7aa1b3f0
RMSE = 888.188
spam score = 84.7259
documents = 270
clusterid = a7a7a8e10
RMSE = 888.733
spam score = 63.6667
documents = 3
clusterid = a7a39d490
RMSE = 890.136
spam score = 85.2696
documents = 831
clusterid = a7a6badc0
RMSE = 890.368
spam score = 83.375
documents = 56
clusterid = a79aede40
RMSE = 891.893
spam score = 43.4613
documents = 297
clusterid = a79a31de0
RMSE = 892
spam score = 72
documents = 1
clusterid = a7a20b680
RMSE = 904.744
spam score = 37.538
documents = 342
clusterid = a7a7598a0
RMSE = 905.389
spam score = 23
documents = 1246
clusterid = a7a9e0c90
RMSE = 906.256
spam score = 82.6316
documents = 19
clusterid = a79a5bad0
RMSE = 909.913
spam score = 85.075
documents = 40
clusterid = a7a88a5f0
RMSE = 917.775
spam score = 43.0567
documents = 247
clusterid = a7a16cba0
RMSE = 927.684
spam score = 34.3733
documents = 75
clusterid = a7a00df60
RMSE = 929
spam score = 31.3846
documents = 65
clusterid = a7a2352a0
RMSE = 930.403
spam score = 71.5
documents = 4
clusterid = a7a179410
RMSE = 932.959
spam score = 31
documents = 11
clusterid = a7a3a5a30
RMSE = 934.421
spam score = 64.4327
documents = 104
clusterid = a7a07a880
RMSE = 936.366
spam score = 75.2143
documents = 42
clusterid = a7a324300
RMSE = 936.404
spam score = 50.9795
documents = 438
clusterid = a79fd3800
RMSE = 938.077
spam score = 59.4894
documents = 188
clusterid = a79a57820
RMSE = 940.538
spam score = 59
documents = 2
clusterid = a79c6a430
RMSE = 941.256
spam score = 48.2864
documents = 419
clusterid = a7a0722e0
RMSE = 944.659
spam score = 52.6452
documents = 31
clusterid = a7a5d1040
RMSE = 946.883
spam score = 54.5
documents = 8
clusterid = a7a224760
RMSE = 947.055
spam score = 44.0875
documents = 834
clusterid = a79cc1f40
RMSE = 950.006
spam score = 65.8935
documents = 413
clusterid = a7a6cfbd0
RMSE = 952.377
spam score = 46.019
documents = 158
clusterid = a7a1dd790
RMSE = 953.095
spam score = 41.1732
documents = 179
clusterid = a7a98d450
RMSE = 954.021
spam score = 71.68
documents = 150
clusterid = a79bbaa10
RMSE = 955.817
spam score = 56
documents = 12
clusterid = a7a4a8890
RMSE = 960.395
spam score = 39.2703
documents = 74
clusterid = a7a667580
RMSE = 961.421
spam score = 91.9444
documents = 18
clusterid = a79d5c750
RMSE = 962.833
spam score = 72.7209
documents = 455
clusterid = a79b20000
RMSE = 968.503
spam score = 88.4118
documents = 17
clusterid = a79e39c60
RMSE = 974.945
spam score = 42.6667
documents = 3
clusterid = a7a054f30
RMSE = 975.54
spam score = 54.5094
documents = 106
clusterid = a79a9a500
RMSE = 986.391
spam score = 44.2877
documents = 146
clusterid = a7a037b80
RMSE = 990.296
spam score = 81.6923
documents = 286
clusterid = a79aa6e70
RMSE = 994.397
spam score = 88.8462
documents = 13
clusterid = a79dc9070
RMSE = 998.324
spam score = 47.0818
documents = 1259
clusterid = a7a213c20
RMSE = 1003.11
spam score = 92.5857
documents = 449
clusterid = a79dc0ad0
RMSE = 1003.71
spam score = 49.657
documents = 242
clusterid = a7a956fc0
RMSE = 1004.1
spam score = 78.2541
documents = 728
clusterid = a79e53540
RMSE = 1005.31
spam score = 41.5
documents = 2
clusterid = a79c48db0
RMSE = 1005.92
spam score = 94.7917
documents = 48
clusterid = a7a24e380
RMSE = 1008.15
spam score = 62
documents = 7
clusterid = a7a08b3c0
RMSE = 1008.98
spam score = 78.7066
documents = 542
clusterid = a79da79f0
RMSE = 1011.73
spam score = 50.3929
documents = 28
clusterid = a7a879ab0
RMSE = 1015.11
spam score = 64.1765
documents = 68
clusterid = a79ec8400
RMSE = 1016.58
spam score = 91.1667
documents = 120
clusterid = a79c598f0
RMSE = 1018
spam score = 7
documents = 1
clusterid = a7a94ea20
RMSE = 1021.06
spam score = 48.6471
documents = 17
clusterid = a7a4a45c0
RMSE = 1021.94
spam score = 54.7385
documents = 65
clusterid = a7a157d90
RMSE = 1024.22
spam score = 90.9924
documents = 132
clusterid = a7a2d0ac0
RMSE = 1030.47
spam score = 46.25
documents = 4
clusterid = a7a553be0
RMSE = 1048.24
spam score = 50.8
documents = 15
clusterid = a7a2bff80
RMSE = 1049.72
spam score = 73.68
documents = 25
clusterid = a7a88e8c0
RMSE = 1053.59
spam score = 7.5
documents = 2
clusterid = a7a811460
RMSE = 1055.74
spam score = 49.432
documents = 1176
clusterid = a7a6fdac0
RMSE = 1065.18
spam score = 17.1774
documents = 761
clusterid = a79e78e90
RMSE = 1066.19
spam score = 64.865
documents = 1133
clusterid = a7a0aca40
RMSE = 1067.05
spam score = 55.9107
documents = 112
clusterid = a7a8c9020
RMSE = 1071.77
spam score = 72.937
documents = 556
clusterid = a7a8609d0
RMSE = 1081.07
spam score = 63.3913
documents = 23
clusterid = a7a230fd0
RMSE = 1084.16
spam score = 83.5997
documents = 587
clusterid = a7a48b4e0
RMSE = 1084.41
spam score = 11.5769
documents = 26
clusterid = a79f66ee0
RMSE = 1087.04
spam score = 79.75
documents = 24
clusterid = a7aa3ca70
RMSE = 1088
spam score = 72.1026
documents = 156
clusterid = a79d6d290
RMSE = 1094.87
spam score = 84.5556
documents = 18
clusterid = a7a252650
RMSE = 1098.56
spam score = 83.2709
documents = 849
clusterid = a79fbe9f0
RMSE = 1102.4
spam score = 53.8195
documents = 277
clusterid = a79bf5170
RMSE = 1102.47
spam score = 51.25
documents = 8
clusterid = a7a5c47d0
RMSE = 1102.86
spam score = 63.6892
documents = 4151
clusterid = a7a54f910
RMSE = 1104.58
spam score = 35.4
documents = 5
clusterid = a7a9421b0
RMSE = 1117.64
spam score = 48.4189
documents = 74
clusterid = a7a104550
RMSE = 1118.19
spam score = 25.1499
documents = 407
clusterid = a79a3a3e0
RMSE = 1120.7
spam score = 57.0424
documents = 118
clusterid = a7a504670
RMSE = 1123.81
spam score = 56.6
documents = 20
clusterid = a7a8dde30
RMSE = 1125.09
spam score = 90.9416
documents = 770
clusterid = a7a688c00
RMSE = 1127.34
spam score = 44.6748
documents = 246
clusterid = a79e9a510
RMSE = 1129.04
spam score = 60.3989
documents = 361
clusterid = a79aab140
RMSE = 1140.78
spam score = 38.5556
documents = 27
clusterid = a79b45b50
RMSE = 1140.9
spam score = 63.3465
documents = 482
clusterid = a7a6aa280
RMSE = 1142.74
spam score = 63.5822
documents = 213
clusterid = a7a8aff40
RMSE = 1148.63
spam score = 56.5467
documents = 514
clusterid = a79c27330
RMSE = 1150.58
spam score = 36.4203
documents = 69
clusterid = a7a108820
RMSE = 1153.03
spam score = 57.8276
documents = 116
clusterid = a7a25abf0
RMSE = 1153.5
spam score = 54.2182
documents = 362
clusterid = a79aa2ba0
RMSE = 1153.91
spam score = 63
documents = 6
clusterid = a7a65ad10
RMSE = 1161.92
spam score = 36.6177
documents = 395
clusterid = a7a050c60
RMSE = 1164.44
spam score = 48.2879
documents = 778
clusterid = a79eb35f0
RMSE = 1167.68
spam score = 42.8504
documents = 127
clusterid = a7a9700a0
RMSE = 1167.73
spam score = 82.6818
documents = 22
clusterid = a79c7f240
RMSE = 1168.63
spam score = 34.875
documents = 8
clusterid = a7a92d3a0
RMSE = 1168.76
spam score = 67.0588
documents = 34
clusterid = a7a931670
RMSE = 1175.72
spam score = 57.1905
documents = 21
clusterid = a7a7bdc20
RMSE = 1176.53
spam score = 84.8095
documents = 105
clusterid = a7a0c1850
RMSE = 1178.85
spam score = 33.4
documents = 5
clusterid = a7a71ae70
RMSE = 1180.59
spam score = 88.5182
documents = 137
clusterid = a7a4acb60
RMSE = 1181.28
spam score = 52.1029
documents = 204
clusterid = a79e24e50
RMSE = 1184.25
spam score = 41.9706
documents = 102
clusterid = a79a360b0
RMSE = 1186.69
spam score = 74.4014
documents = 147
clusterid = a79f7ffc0
RMSE = 1189.97
spam score = 85.4706
documents = 221
clusterid = a7a903780
RMSE = 1193.24
spam score = 87.2866
documents = 328
clusterid = a79f4de00
RMSE = 1193.84
spam score = 21.6129
documents = 31
clusterid = a79c66160
RMSE = 1194.52
spam score = 71.763
documents = 633
clusterid = a7a63d960
RMSE = 1196.38
spam score = 72.9355
documents = 124
clusterid = a7a9aead0
RMSE = 1202.15
spam score = 73.8
documents = 5
clusterid = a7a8478f0
RMSE = 1202.49
spam score = 74.9051
documents = 158
clusterid = a7a4f7e00
RMSE = 1203.95
spam score = 69.7431
documents = 759
clusterid = a79c877e0
RMSE = 1204.61
spam score = 56.6667
documents = 18
clusterid = a79afa6b0
RMSE = 1208.3
spam score = 8.27957
documents = 93
clusterid = a7a4daa50
RMSE = 1215.68
spam score = 76.6364
documents = 55
clusterid = a7a5003a0
RMSE = 1218.1
spam score = 52.4898
documents = 294
clusterid = a7a1967c0
RMSE = 1218.41
spam score = 63.6378
documents = 127
clusterid = a7a751300
RMSE = 1223.43
spam score = 91.5766
documents = 222
clusterid = a79f1ff10
RMSE = 1225.4
spam score = 67.4444
documents = 9
clusterid = a79cbdc70
RMSE = 1225.69
spam score = 58.2353
documents = 17
clusterid = a79b77d10
RMSE = 1227.84
spam score = 64.7174
documents = 46
clusterid = a79c8bab0
RMSE = 1229.18
spam score = 75.8372
documents = 43
clusterid = a7a5430a0
RMSE = 1230.15
spam score = 60.2052
documents = 916
clusterid = a79f49b30
RMSE = 1231.26
spam score = 74.8
documents = 5
clusterid = a79ba9ed0
RMSE = 1232.6
spam score = 52.9524
documents = 21
clusterid = a79ddde80
RMSE = 1232.91
spam score = 86.2682
documents = 302
clusterid = a79e68350
RMSE = 1233.33
spam score = 47.8846
documents = 26
clusterid = a79eb78c0
RMSE = 1234.83
spam score = 68.4555
documents = 382
clusterid = a79a2db10
RMSE = 1238.06
spam score = 75.2
documents = 30
clusterid = a79ad4d60
RMSE = 1238.74
spam score = 82.5524
documents = 210
clusterid = a7a62ce20
RMSE = 1240.41
spam score = 83.5705
documents = 149
clusterid = a7a0617a0
RMSE = 1241.7
spam score = 89.4571
documents = 35
clusterid = a7a7ebb10
RMSE = 1247
spam score = 56
documents = 1
clusterid = a7aa17120
RMSE = 1247.83
spam score = 91.2906
documents = 203
clusterid = a79c0e250
RMSE = 1249.63
spam score = 60.0561
documents = 196
clusterid = a7aa55b50
RMSE = 1250.25
spam score = 31.05
documents = 20
clusterid = a79d92be0
RMSE = 1251.03
spam score = 52.6923
documents = 13
clusterid = a7a24a0b0
RMSE = 1251.59
spam score = 45.7727
documents = 44
clusterid = a7a7f40b0
RMSE = 1253.28
spam score = 65.8875
documents = 80
clusterid = a7a980be0
RMSE = 1257.55
spam score = 62.0319
documents = 251
clusterid = a79c8fd80
RMSE = 1258.6
spam score = 56.0936
documents = 171
clusterid = a7a027040
RMSE = 1259.65
spam score = 67.8536
documents = 642
clusterid = a7aa4d5b0
RMSE = 1261.65
spam score = 88.6504
documents = 226
clusterid = a79d2a590
RMSE = 1261.98
spam score = 58
documents = 6
clusterid = a7a2cc7f0
RMSE = 1263.27
spam score = 34.3824
documents = 1161
clusterid = a79d3b0d0
RMSE = 1263.81
spam score = 64.2847
documents = 295
clusterid = a79ad0a90
RMSE = 1264.05
spam score = 63.1721
documents = 122
clusterid = a7a147250
RMSE = 1266.88
spam score = 25.4323
documents = 155
clusterid = a7a5ee3f0
RMSE = 1268.42
spam score = 90.1266
documents = 632
clusterid = a79aaf410
RMSE = 1269.55
spam score = 81.9024
documents = 635
clusterid = a79a68340
RMSE = 1270.68
spam score = 47.9091
documents = 11
clusterid = a7a13a9e0
RMSE = 1272.66
spam score = 38.097
documents = 134
clusterid = a79c55620
RMSE = 1275.05
spam score = 12.4839
documents = 310
clusterid = a79fd7ad0
RMSE = 1275.61
spam score = 12.3247
documents = 348
clusterid = a7a2f2140
RMSE = 1278.87
spam score = 86.2152
documents = 395
clusterid = a7aa492e0
RMSE = 1278.92
spam score = 66.1515
documents = 33
clusterid = a79c6e700
RMSE = 1279.04
spam score = 7.75806
documents = 62
clusterid = a7a90fff0
RMSE = 1280.43
spam score = 77.1101
documents = 1008
clusterid = a79ab36e0
RMSE = 1283.32
spam score = 43.4
documents = 5
clusterid = a79dff500
RMSE = 1285.37
spam score = 70.5
documents = 2
clusterid = a79c44ae0
RMSE = 1286.49
spam score = 63.5
documents = 12
clusterid = a7a4b0e30
RMSE = 1290.65
spam score = 61.4091
documents = 22
clusterid = a7a0c9df0
RMSE = 1297.98
spam score = 41.75
documents = 4
clusterid = a79dd1610
RMSE = 1302.07
spam score = 82.0405
documents = 74
clusterid = a79f136a0
RMSE = 1302.17
spam score = 75.1818
documents = 22
clusterid = a7a390c20
RMSE = 1303.08
spam score = 50.8109
documents = 682
clusterid = a7a575260
RMSE = 1304.17
spam score = 62.9749
documents = 239
clusterid = a7a1688d0
RMSE = 1305.14
spam score = 47
documents = 4
clusterid = a79f6f480
RMSE = 1306.88
spam score = 64.1244
documents = 225
clusterid = a79c3c540
RMSE = 1309.24
spam score = 69.4231
documents = 78
clusterid = a7aa065e0
RMSE = 1309.29
spam score = 34.3701
documents = 1051
clusterid = a79b30d40
RMSE = 1310.29
spam score = 64.5
documents = 12
clusterid = a79ba1930
RMSE = 1311.38
spam score = 58.0171
documents = 234
clusterid = a7a35a790
RMSE = 1313.91
spam score = 79.4504
documents = 111
clusterid = a79e424c0
RMSE = 1316.45
spam score = 58.5217
documents = 23
clusterid = a79a42960
RMSE = 1316.8
spam score = 38.9299
documents = 157
clusterid = a79d541b0
RMSE = 1318.8
spam score = 71.6203
documents = 482
clusterid = a79c2b600
RMSE = 1318.89
spam score = 54.7843
documents = 932
clusterid = a7a7276e0
RMSE = 1319.93
spam score = 65.4731
documents = 93
clusterid = a7a1e5d30
RMSE = 1321.63
spam score = 69.4632
documents = 557
clusterid = a7a50cc10
RMSE = 1322.8
spam score = 43.8743
documents = 676
clusterid = a79c2bb80
RMSE = 1323.18
spam score = 39.6303
documents = 119
clusterid = a7a5151b0
RMSE = 1323.3
spam score = 86.7448
documents = 239
clusterid = a79c40810
RMSE = 1324.88
spam score = 70.5629
documents = 421
clusterid = a7a1ccc50
RMSE = 1325.95
spam score = 68.4783
documents = 69
clusterid = a7a097c30
RMSE = 1326.1
spam score = 55.2778
documents = 18
clusterid = a79a78e80
RMSE = 1326.15
spam score = 51
documents = 20
clusterid = a7a1d0f20
RMSE = 1326.76
spam score = 35.2749
documents = 171
clusterid = a7aa51880
RMSE = 1327.46
spam score = 72.7188
documents = 128
clusterid = a7a136710
RMSE = 1328.02
spam score = 93.1946
documents = 853
clusterid = a7a3a1760
RMSE = 1329.18
spam score = 72.3163
documents = 196
clusterid = a7a49c020
RMSE = 1329.57
spam score = 52.5169
documents = 385
clusterid = a79ff0bb0
RMSE = 1332.8
spam score = 44.0667
documents = 90
clusterid = a7a38c950
RMSE = 1334.73
spam score = 54.775
documents = 400
clusterid = a79f41590
RMSE = 1337.42
spam score = 51.4407
documents = 59
clusterid = a7a592610
RMSE = 1338.17
spam score = 82.3
documents = 20
clusterid = a7a2073b0
RMSE = 1340.05
spam score = 63.1667
documents = 24
clusterid = a79e43070
RMSE = 1342.04
spam score = 63
documents = 80
clusterid = a7a4b93d0
RMSE = 1342.94
spam score = 40.7143
documents = 189
clusterid = a79a534a0
RMSE = 1343.08
spam score = 37.7771
documents = 157
clusterid = a7a47a9a0
RMSE = 1346.56
spam score = 76.6
documents = 215
clusterid = a7a97c910
RMSE = 1346.6
spam score = 78.7704
documents = 379
clusterid = a79be4630
RMSE = 1347.06
spam score = 64.2135
documents = 698
clusterid = a7a9d0150
RMSE = 1347.07
spam score = 59.4315
documents = 584
clusterid = a79b0b1f0
RMSE = 1348.88
spam score = 51.3684
documents = 19
clusterid = a7a9c38e0
RMSE = 1349.68
spam score = 73.7774
documents = 1388
clusterid = a7a3a9d00
RMSE = 1351.31
spam score = 60.1173
documents = 162
clusterid = a79f1bc40
RMSE = 1352.84
spam score = 73.3125
documents = 16
clusterid = a7a64e4a0
RMSE = 1357.09
spam score = 63.75
documents = 8
clusterid = a7a1ab5d0
RMSE = 1359.86
spam score = 71.7987
documents = 154
clusterid = a7a6ecf80
RMSE = 1361.3
spam score = 75
documents = 48
clusterid = a7a4c5c40
RMSE = 1362.49
spam score = 72.1414
documents = 481
clusterid = a7a153ac0
RMSE = 1362.82
spam score = 75.9737
documents = 38
clusterid = a7a74d030
RMSE = 1364.34
spam score = 78.0952
documents = 21
clusterid = a7a3416b0
RMSE = 1364.82
spam score = 37.6378
documents = 439
clusterid = a79b5a960
RMSE = 1366.21
spam score = 86.5549
documents = 647
clusterid = a7a920b30
RMSE = 1373.51
spam score = 59.1845
documents = 168
clusterid = a79c2b8c0
RMSE = 1373.57
spam score = 45.75
documents = 84
clusterid = a79abff50
RMSE = 1376.56
spam score = 50.6734
documents = 2137
clusterid = a79e29120
RMSE = 1377.39
spam score = 59.0729
documents = 96
clusterid = a7a639690
RMSE = 1380.2
spam score = 72.877
documents = 1057
clusterid = a79df6f60
RMSE = 1380.86
spam score = 63.3448
documents = 261
clusterid = a7a241b10
RMSE = 1382.05
spam score = 62.8169
documents = 355
clusterid = a79e316c0
RMSE = 1382.9
spam score = 62.4351
documents = 239
clusterid = a7a35ea60
RMSE = 1385.03
spam score = 70.7697
documents = 152
clusterid = a7a3c70b0
RMSE = 1385.58
spam score = 69.0868
documents = 2695
clusterid = a79a3e690
RMSE = 1386.79
spam score = 55.9032
documents = 31
clusterid = a79b6b4a0
RMSE = 1387.03
spam score = 66.027
documents = 444
clusterid = a7a67c390
RMSE = 1387.13
spam score = 58.8539
documents = 89
clusterid = a7a482f40
RMSE = 1387.57
spam score = 62.7143
documents = 7
clusterid = a7aa23990
RMSE = 1388.54
spam score = 58.4029
documents = 1030
clusterid = a79b06f20
RMSE = 1392.75
spam score = 74.6267
documents = 75
clusterid = a7a6f97f0
RMSE = 1394.85
spam score = 31.0397
documents = 151
clusterid = a79ce7890
RMSE = 1396.94
spam score = 75.5467
documents = 439
clusterid = a7a53ab00
RMSE = 1397.08
spam score = 61.1833
documents = 251
clusterid = a79b0f4c0
RMSE = 1397.1
spam score = 53
documents = 12
clusterid = a79a6c610
RMSE = 1397.95
spam score = 62.5833
documents = 12
clusterid = a79a14a00
RMSE = 1398.03
spam score = 73.8786
documents = 140
clusterid = a7a886320
RMSE = 1400.01
spam score = 78.5357
documents = 56
clusterid = a7a557eb0
RMSE = 1400.34
spam score = 66.25
documents = 148
clusterid = a79b02c50
RMSE = 1402.61
spam score = 88.4444
documents = 9
clusterid = a7a9f17d0
RMSE = 1402.87
spam score = 58.0227
documents = 968
clusterid = a79d79b00
RMSE = 1403.62
spam score = 66.0362
documents = 802
clusterid = a7a465b90
RMSE = 1403.92
spam score = 74.7917
documents = 168
clusterid = a7a5f26c0
RMSE = 1404.19
spam score = 76.918
documents = 756
clusterid = a7a40e080
RMSE = 1404.31
spam score = 68.6722
documents = 848
clusterid = a7a23d840
RMSE = 1404.48
spam score = 48.5586
documents = 111
clusterid = a79e20b80
RMSE = 1405.56
spam score = 63.3789
documents = 285
clusterid = a79b6f770
RMSE = 1407.03
spam score = 54.2183
documents = 252
clusterid = a7a72fc80
RMSE = 1407.27
spam score = 78.6923
documents = 143
clusterid = a7a9c7bb0
RMSE = 1408.28
spam score = 90.6503
documents = 163
clusterid = a7a9f5aa0
RMSE = 1409.36
spam score = 79.6038
documents = 843
clusterid = a79a10710
RMSE = 1410.21
spam score = 25.0062
documents = 645
clusterid = a79daff90
RMSE = 1410.39
spam score = 66.9313
documents = 131
clusterid = a79ac84f0
RMSE = 1410.74
spam score = 77.6744
documents = 43
clusterid = a79c4d080
RMSE = 1411.05
spam score = 65.6482
documents = 975
clusterid = a7a5af9c0
RMSE = 1411.85
spam score = 71.2275
documents = 189
clusterid = a79a4f1d0
RMSE = 1411.89
spam score = 50.3401
documents = 1473
clusterid = a79f990a0
RMSE = 1412.79
spam score = 66.2724
documents = 602
clusterid = a79c51350
RMSE = 1414.28
spam score = 66.7917
documents = 216
clusterid = a7a189f50
RMSE = 1414.86
spam score = 54.6017
documents = 231
clusterid = a79b88850
RMSE = 1415.05
spam score = 63.7252
documents = 2777
clusterid = a79d43670
RMSE = 1415.95
spam score = 63.8617
documents = 282
clusterid = a7a716ba0
RMSE = 1418.14
spam score = 75.4692
documents = 1315
clusterid = a79c9c5f0
RMSE = 1420.16
spam score = 59.9153
documents = 1818
clusterid = a7a175140
RMSE = 1420.85
spam score = 62.7305
documents = 141
clusterid = a7a8cd2f0
RMSE = 1421.11
spam score = 53.7564
documents = 468
clusterid = a7a44cab0
RMSE = 1421.52
spam score = 76.0078
documents = 383
clusterid = a79d68fc0
RMSE = 1421.74
spam score = 69.11
documents = 100
clusterid = a7a3c2de0
RMSE = 1422.27
spam score = 64.4401
documents = 1327
clusterid = a79e42200
RMSE = 1422.98
spam score = 45.6547
documents = 139
clusterid = a79ea6d80
RMSE = 1423.33
spam score = 77.401
documents = 202
clusterid = a7a95f560
RMSE = 1424.05
spam score = 75.735
documents = 4203
clusterid = a7a6b6af0
RMSE = 1424.5
spam score = 65.25
documents = 4
clusterid = a7a160330
RMSE = 1426.35
spam score = 60.4039
documents = 3221
clusterid = a7a51d750
RMSE = 1426.69
spam score = 72.795
documents = 2088
clusterid = a7a81dcd0
RMSE = 1427.31
spam score = 80.3143
documents = 140
clusterid = a79becbd0
RMSE = 1427.52
spam score = 85.3857
documents = 140
clusterid = a7a2d4d90
RMSE = 1429.08
spam score = 52.6089
documents = 1120
clusterid = a7a256920
RMSE = 1429.09
spam score = 69.0899
documents = 2246
clusterid = a7a0e2ed0
RMSE = 1429.7
spam score = 66.2091
documents = 1119
clusterid = a79b671d0
RMSE = 1429.9
spam score = 62.6095
documents = 1265
clusterid = a79ca08c0
RMSE = 1430.21
spam score = 76.5381
documents = 210
clusterid = a79e6c620
RMSE = 1430.33
spam score = 71.0667
documents = 1110
clusterid = a7a60b7a0
RMSE = 1431.26
spam score = 80.3253
documents = 415
clusterid = a79f88560
RMSE = 1432.53
spam score = 74.1855
documents = 593
clusterid = a7a4ded20
RMSE = 1433.99
spam score = 83.1701
documents = 194
clusterid = a7a21c1c0
RMSE = 1434.1
spam score = 63.5031
documents = 479
clusterid = a79bcf820
RMSE = 1434.33
spam score = 61.6727
documents = 55
clusterid = a7a3dbec0
RMSE = 1434.59
spam score = 79.5031
documents = 1598
clusterid = a7a267460
RMSE = 1434.87
spam score = 71.9013
documents = 466
clusterid = a7a603200
RMSE = 1435.81
spam score = 66.5318
documents = 598
clusterid = a7a185c80
RMSE = 1435.86
spam score = 64.513
documents = 386
clusterid = a7a93dee0
RMSE = 1436.6
spam score = 73.2584
documents = 89
clusterid = a7a772980
RMSE = 1437.63
spam score = 67.1242
documents = 1312
clusterid = a7a9b2da0
RMSE = 1439.28
spam score = 60.633
documents = 1703
clusterid = a7a579530
RMSE = 1439.82
spam score = 63.7128
documents = 2152
clusterid = a7a093960
RMSE = 1440.05
spam score = 70.9245
documents = 106
clusterid = a7a8ea6a0
RMSE = 1440.32
spam score = 65.2797
documents = 118
clusterid = a79cc6210
RMSE = 1441.21
spam score = 59.0712
documents = 2246
clusterid = a7a5968e0
RMSE = 1441.83
spam score = 65.6156
documents = 718
clusterid = a7a7b9950
RMSE = 1441.92
spam score = 58.4927
documents = 205
clusterid = a7a110dc0
RMSE = 1442.41
spam score = 56.6575
documents = 438
clusterid = a79d820a0
RMSE = 1444.83
spam score = 66.1801
documents = 1621
clusterid = a79a4af00
RMSE = 1445.15
spam score = 78.2663
documents = 1363
clusterid = a79a36140
RMSE = 1445.74
spam score = 73.2679
documents = 56
clusterid = a7a437ca0
RMSE = 1445.78
spam score = 47.3137
documents = 204
clusterid = a79fec8e0
RMSE = 1446.09
spam score = 66.5267
documents = 1798
clusterid = a79ca8e60
RMSE = 1448.12
spam score = 67.4505
documents = 384
clusterid = a7a1ea000
RMSE = 1448.24
spam score = 55.9
documents = 10
clusterid = a79af63e0
RMSE = 1451
spam score = 61.8333
documents = 372
clusterid = a79fa1640
RMSE = 1451.57
spam score = 65.0754
documents = 703
clusterid = a7a804bf0
RMSE = 1451.65
spam score = 69.3121
documents = 439
clusterid = a79e96240
RMSE = 1451.88
spam score = 62.5622
documents = 1085
clusterid = a7a54b640
RMSE = 1451.95
spam score = 63.6577
documents = 558
clusterid = a79cebb60
RMSE = 1452.42
spam score = 65.9511
documents = 1329
clusterid = a79f77a20
RMSE = 1452.7
spam score = 65.4623
documents = 954
clusterid = a79afe980
RMSE = 1452.77
spam score = 68.1339
documents = 844
clusterid = a79b523c0
RMSE = 1452.8
spam score = 62.0671
documents = 164
clusterid = a7a8fb1e0
RMSE = 1454.59
spam score = 58.3345
documents = 281
clusterid = a79cb1400
RMSE = 1454.74
spam score = 60.8992
documents = 2074
clusterid = a7a3f9270
RMSE = 1454.79
spam score = 63.6667
documents = 6
clusterid = a7a317a90
RMSE = 1455.28
spam score = 58.2095
documents = 931
clusterid = a7a6b2820
RMSE = 1455.54
spam score = 70.0681
documents = 191
clusterid = a7a61c2e0
RMSE = 1455.85
spam score = 61.8107
documents = 993
clusterid = a79c1aac0
RMSE = 1456.19
spam score = 70.2839
documents = 155
clusterid = a7aa12e50
RMSE = 1456.6
spam score = 59.9514
documents = 555
clusterid = a7a9d4420
RMSE = 1456.93
spam score = 56.9414
documents = 1588
clusterid = a7a37be10
RMSE = 1457.18
spam score = 59.8456
documents = 136
clusterid = a7a7df2a0
RMSE = 1457.61
spam score = 66.1258
documents = 159
clusterid = a7a1d51f0
RMSE = 1458.05
spam score = 62.6738
documents = 1122
clusterid = a7a5b3c90
RMSE = 1458.32
spam score = 39.961
documents = 308
clusterid = a79e899d0
RMSE = 1458.39
spam score = 69.935
documents = 1324
clusterid = a7a016500
RMSE = 1459.33
spam score = 68.7248
documents = 585
clusterid = a7a8b84e0
RMSE = 1460.31
spam score = 72.0331
documents = 725
clusterid = a7a059200
RMSE = 1461.02
spam score = 65.6344
documents = 993
clusterid = a7a0b4fe0
RMSE = 1461.07
spam score = 59.1136
documents = 819
clusterid = a7a9aa800
RMSE = 1461.13
spam score = 63.2893
documents = 1929
clusterid = a7a58a070
RMSE = 1461.15
spam score = 58.7869
documents = 305
clusterid = a7a8d9b60
RMSE = 1461.53
spam score = 60.1411
documents = 1304
clusterid = a79fba720
RMSE = 1462.17
spam score = 74.601
documents = 203
clusterid = a79dabcc0
RMSE = 1462.32
spam score = 61.7172
documents = 297
clusterid = a79c5dbc0
RMSE = 1462.83
spam score = 67.7444
documents = 446
clusterid = a7a125bd0
RMSE = 1463.02
spam score = 67.2302
documents = 252
clusterid = a79c05cb0
RMSE = 1463.23
spam score = 60.1231
documents = 1275
clusterid = a79e8dca0
RMSE = 1463.36
spam score = 72.4988
documents = 1241
clusterid = a7a040120
RMSE = 1463.41
spam score = 77.4583
documents = 288
clusterid = a79e9e7e0
RMSE = 1464.07
spam score = 73.9571
documents = 396
clusterid = a79d47940
RMSE = 1465.05
spam score = 64.5759
documents = 929
clusterid = a79d4bc10
RMSE = 1465.15
spam score = 73.1828
documents = 1718
clusterid = a7a1a7300
RMSE = 1466.27
spam score = 59.4903
documents = 1136
clusterid = a79ebfe60
RMSE = 1466.48
spam score = 73.087
documents = 230
clusterid = a79a64070
RMSE = 1466.48
spam score = 64.3036
documents = 112
clusterid = a79d8a640
RMSE = 1466.56
spam score = 67.2526
documents = 582
clusterid = a79fb6450
RMSE = 1466.6
spam score = 53.1718
documents = 553
clusterid = a7a6074d0
RMSE = 1466.63
spam score = 78.6577
documents = 1259
clusterid = a79ecc6d0
RMSE = 1466.82
spam score = 63.0262
documents = 1487
clusterid = a7a4fc0d0
RMSE = 1466.83
spam score = 69.5087
documents = 861
clusterid = a7a6e8cb0
RMSE = 1467.02
spam score = 62.8093
documents = 776
clusterid = a7a14b520
RMSE = 1467.25
spam score = 64.4661
documents = 502
clusterid = a7a645f00
RMSE = 1467.85
spam score = 61.7003
documents = 1852
clusterid = a7a7982d0
RMSE = 1467.96
spam score = 63.2105
documents = 19
clusterid = a7a5ea120
RMSE = 1468.02
spam score = 61.9293
documents = 283
clusterid = a7a95b290
RMSE = 1468.64
spam score = 55.3315
documents = 1240
clusterid = a79bbece0
RMSE = 1468.86
spam score = 64.9222
documents = 1736
clusterid = a7a3564c0
RMSE = 1469.01
spam score = 61.0818
documents = 2029
clusterid = a7a1fee10
RMSE = 1469.14
spam score = 58.802
documents = 495
clusterid = a7a7c1ef0
RMSE = 1469.2
spam score = 67.144
documents = 653
clusterid = a7a455050
RMSE = 1469.45
spam score = 63.9124
documents = 651
clusterid = a7a1af8a0
RMSE = 1469.49
spam score = 57.6242
documents = 306
clusterid = a7a6cb900
RMSE = 1469.57
spam score = 68.1553
documents = 2337
clusterid = a7a896e60
RMSE = 1469.78
spam score = 64.1111
documents = 9
clusterid = a7a7834c0
RMSE = 1470.06
spam score = 63.0136
documents = 1104
clusterid = a79d19a50
RMSE = 1470.38
spam score = 58.6537
documents = 205
clusterid = a7aa30200
RMSE = 1470.51
spam score = 62.8147
documents = 556
clusterid = a7a493a80
RMSE = 1471.18
spam score = 61.5242
documents = 1614
clusterid = a79a29840
RMSE = 1471.19
spam score = 64.5556
documents = 9
clusterid = a7a1819b0
RMSE = 1471.29
spam score = 57.7985
documents = 1236
clusterid = a7a699740
RMSE = 1471.35
spam score = 67.1938
documents = 356
clusterid = a7a082e20
RMSE = 1471.46
spam score = 64.9255
documents = 1449
clusterid = a7a31bd60
RMSE = 1471.46
spam score = 76.3601
documents = 1247
clusterid = a79d08f10
RMSE = 1471.71
spam score = 74.4762
documents = 842
clusterid = a79a5fda0
RMSE = 1471.75
spam score = 68.5482
documents = 197
clusterid = a7a9959f0
RMSE = 1471.87
spam score = 75.7066
documents = 794
clusterid = a79bc7280
RMSE = 1472.03
spam score = 63.0349
documents = 430
clusterid = a79c94050
RMSE = 1472.23
spam score = 74.4568
documents = 440
clusterid = a79a21280
RMSE = 1472.79
spam score = 54.2626
documents = 1245
clusterid = a7a5e5e50
RMSE = 1473.16
spam score = 63.8466
documents = 1069
clusterid = a7a1d94c0
RMSE = 1473.4
spam score = 72.8028
documents = 1450
clusterid = a79e42780
RMSE = 1473.41
spam score = 76.4545
documents = 110
clusterid = a7a8d15c0
RMSE = 1473.44
spam score = 71.825
documents = 2194
clusterid = a79a57770
RMSE = 1473.83
spam score = 62.6154
documents = 65
clusterid = a7a4ef860
RMSE = 1473.84
spam score = 61.5888
documents = 698
clusterid = a79cdf2f0
RMSE = 1473.96
spam score = 63.9091
documents = 319
clusterid = a79e85700
RMSE = 1474.06
spam score = 65.7295
documents = 244
clusterid = a79b7bfe0
RMSE = 1474.16
spam score = 66.0775
documents = 1574
clusterid = a7a7555d0
RMSE = 1474.22
spam score = 58.8663
documents = 2192
clusterid = a79b20370
RMSE = 1474.31
spam score = 69.0615
documents = 130
clusterid = a7a624880
RMSE = 1474.35
spam score = 68.2255
documents = 1135
clusterid = a79d32b30
RMSE = 1474.88
spam score = 59.4799
documents = 573
clusterid = a7a9f9d70
RMSE = 1474.99
spam score = 73.0122
documents = 1960
clusterid = a7a5c8aa0
RMSE = 1474.99
spam score = 69.8844
documents = 761
clusterid = a7a695470
RMSE = 1475.29
spam score = 71.6319
documents = 1695
clusterid = a79c1ed90
RMSE = 1475.29
spam score = 80.25
documents = 12
clusterid = a7a36f5a0
RMSE = 1475.81
spam score = 72.4565
documents = 1253
clusterid = a7a6310f0
RMSE = 1475.86
spam score = 64.1144
documents = 822
clusterid = a7a450d80
RMSE = 1475.9
spam score = 73.0625
documents = 1008
clusterid = a7a984eb0
RMSE = 1476.38
spam score = 56.6648
documents = 701
clusterid = a7a065a70
RMSE = 1477.05
spam score = 42.9652
documents = 316
clusterid = a79edd210
RMSE = 1477.07
spam score = 64.2521
documents = 242
clusterid = a79fa9be0
RMSE = 1477.17
spam score = 63.2277
documents = 224
clusterid = a7a83f350
RMSE = 1477.29
spam score = 66.103
documents = 728
clusterid = a79e3df30
RMSE = 1477.4
spam score = 74.0763
documents = 118
clusterid = a7a427160
RMSE = 1477.98
spam score = 75.484
documents = 2064
clusterid = a7a815730
RMSE = 1478.6
spam score = 76.1562
documents = 1082
clusterid = a7a4b5100
RMSE = 1478.77
spam score = 63.568
documents = 1000
clusterid = a7a29a630
RMSE = 1478.99
spam score = 64.2698
documents = 1286
clusterid = a7a292090
RMSE = 1479.03
spam score = 69.4906
documents = 426
clusterid = a7a245de0
RMSE = 1479.04
spam score = 77.5756
documents = 1322
clusterid = a79ea2ab0
RMSE = 1479.26
spam score = 73.7172
documents = 1492
clusterid = a7a5ab6f0
RMSE = 1479.48
spam score = 71.18
documents = 1467
clusterid = a79d15780
RMSE = 1480.06
spam score = 75.9928
documents = 278
clusterid = a79bcb550
RMSE = 1480.21
spam score = 55.8467
documents = 261
clusterid = a7a3b6570
RMSE = 1480.33
spam score = 66.1837
documents = 1399
clusterid = a79d60a20
RMSE = 1480.48
spam score = 71.7458
documents = 1318
clusterid = a79b392e0
RMSE = 1480.5
spam score = 63.2935
documents = 1247
clusterid = a7a306f50
RMSE = 1480.77
spam score = 73.5855
documents = 2222
clusterid = a79add300
RMSE = 1482.23
spam score = 63.9868
documents = 304
clusterid = a7a5c0500
RMSE = 1482.35
spam score = 66.0086
documents = 116
clusterid = a79ed8f40
RMSE = 1482.61
spam score = 62.4886
documents = 700
clusterid = a7a0b0d10
RMSE = 1482.82
spam score = 60.3043
documents = 46
clusterid = a7a7a0870
RMSE = 1483.15
spam score = 72.601
documents = 203
clusterid = a7a2e58d0
RMSE = 1483.56
spam score = 66.2178
documents = 886
clusterid = a7a2fa6e0
RMSE = 1483.73
spam score = 58.1778
documents = 1232
clusterid = a7a85c700
RMSE = 1484.21
spam score = 63.4066
documents = 455
clusterid = a7a946480
RMSE = 1484.83
spam score = 55.5
documents = 30
clusterid = a7a78ba60
RMSE = 1485
spam score = 90
documents = 1
clusterid = a7a8e63d0
RMSE = 1485.06
spam score = 61.9249
documents = 546
clusterid = a79e07aa0
RMSE = 1485.49
spam score = 64.7062
documents = 1096
clusterid = a7a3e8730
RMSE = 1485.65
spam score = 69.25
documents = 1492
clusterid = a7a641c30
RMSE = 1485.69
spam score = 69.4833
documents = 689
clusterid = a79e2d3f0
RMSE = 1485.78
spam score = 62.1985
documents = 1043
clusterid = a7a1e1a60
RMSE = 1486.18
spam score = 59.2727
documents = 110
clusterid = a7a5689f0
RMSE = 1486.25
spam score = 46.9722
documents = 575
clusterid = a79fe4340
RMSE = 1486.35
spam score = 51.2448
documents = 478
clusterid = a7a1ee2d0
RMSE = 1486.74
spam score = 73.0082
documents = 973
clusterid = a7a826270
RMSE = 1486.76
spam score = 62.0466
documents = 1115
clusterid = a7a7ce760
RMSE = 1487.14
spam score = 66.6564
documents = 1586
clusterid = a7a547370
RMSE = 1487.41
spam score = 76.8425
documents = 254
clusterid = a79dcd340
RMSE = 1487.74
spam score = 54.4239
documents = 1163
clusterid = a7a01eaa0
RMSE = 1487.76
spam score = 67.4013
documents = 598
clusterid = a7a367000
RMSE = 1488.61
spam score = 62.399
documents = 767
clusterid = a7a9a6530
RMSE = 1488.69
spam score = 66.1621
documents = 253
clusterid = a7a444510
RMSE = 1489.06
spam score = 69.7292
documents = 1152
clusterid = a7aa344d0
RMSE = 1489.47
spam score = 64.0378
documents = 794
clusterid = a7a4c9f10
RMSE = 1489.63
spam score = 71.4339
documents = 2770
clusterid = a7a9b7070
RMSE = 1490.05
spam score = 56.3764
documents = 781
clusterid = a79cd2a80
RMSE = 1490.29
spam score = 66.5688
documents = 443
clusterid = a79b99390
RMSE = 1490.42
spam score = 63.1494
documents = 1011
clusterid = a7a302c80
RMSE = 1490.7
spam score = 75.6197
documents = 1178
clusterid = a7a5e1b80
RMSE = 1490.79
spam score = 80.3219
documents = 407
clusterid = a7a7e3570
RMSE = 1490.95
spam score = 73.3207
documents = 820
clusterid = a79a708e0
RMSE = 1491.28
spam score = 61.3581
documents = 645
clusterid = a7a90bd20
RMSE = 1491.38
spam score = 61.3738
documents = 305
clusterid = a7a564720
RMSE = 1492.06
spam score = 70.7794
documents = 1528
clusterid = a7a7128d0
RMSE = 1492.1
spam score = 63.0669
documents = 508
clusterid = a79d3f3a0
RMSE = 1492.29
spam score = 65.5036
documents = 842
clusterid = a79db8530
RMSE = 1492.38
spam score = 71.2602
documents = 196
clusterid = a7a6632b0
RMSE = 1492.51
spam score = 61.2966
documents = 1045
clusterid = a79c38290
RMSE = 1492.8
spam score = 68.7715
documents = 954
clusterid = a7a766110
RMSE = 1493.09
spam score = 53.7063
documents = 1774
clusterid = a7a99df90
RMSE = 1493.11
spam score = 72.2903
documents = 1323
clusterid = a7a2fe9b0
RMSE = 1493.23
spam score = 60.6115
documents = 780
clusterid = a79eaf320
RMSE = 1493.35
spam score = 70.3429
documents = 1082
clusterid = a7a79c5a0
RMSE = 1493.5
spam score = 68.191
documents = 199
clusterid = a7a2f6410
RMSE = 1493.57
spam score = 56.8654
documents = 52
clusterid = a7a6205b0
RMSE = 1493.58
spam score = 67.0047
documents = 1064
clusterid = a7a2ede70
RMSE = 1493.85
spam score = 71.6075
documents = 749
clusterid = a79cd6d50
RMSE = 1494.17
spam score = 72.0316
documents = 1204
clusterid = a79c019e0
RMSE = 1494.47
spam score = 66.1875
documents = 48
clusterid = a7a748d60
RMSE = 1494.49
spam score = 71.4596
documents = 1053
clusterid = a79ef2020
RMSE = 1494.99
spam score = 64.2479
documents = 1061
clusterid = a7a43bf70
RMSE = 1495.05
spam score = 63.9177
documents = 2006
clusterid = a7a3cf650
RMSE = 1495.14
spam score = 63.1252
documents = 615
clusterid = a7a82a540
RMSE = 1495.24
spam score = 65.6201
documents = 1732
clusterid = a79db4260
RMSE = 1495.7
spam score = 55.8068
documents = 1289
clusterid = a79a46c30
RMSE = 1495.88
spam score = 64.913
documents = 1264
clusterid = a79ee57b0
RMSE = 1495.95
spam score = 68.4155
documents = 2289
clusterid = a7a974370
RMSE = 1496.23
spam score = 67.3467
documents = 1151
clusterid = a7a7ca490
RMSE = 1496.65
spam score = 59.284
documents = 933
clusterid = a7aa1f6c0
RMSE = 1497.45
spam score = 64.6774
documents = 468
clusterid = a79b802b0
RMSE = 1497.46
spam score = 62.0394
documents = 1320
clusterid = a79a8dc90
RMSE = 1497.47
spam score = 61.4386
documents = 2241
clusterid = a79ed4c70
RMSE = 1497.57
spam score = 52.6971
documents = 855
clusterid = a79dfb230
RMSE = 1497.68
spam score = 63.2028
documents = 1282
clusterid = a7a939c10
RMSE = 1497.74
spam score = 61.0859
documents = 873
clusterid = a7a87dd80
RMSE = 1498.08
spam score = 65.446
documents = 1316
clusterid = a7a6a5fb0
RMSE = 1498.75
spam score = 69.6607
documents = 890
clusterid = a7a3eca00
RMSE = 1498.75
spam score = 65.1818
documents = 880
clusterid = a79fadeb0
RMSE = 1498.84
spam score = 79.116
documents = 1284
clusterid = a7aa59e20
RMSE = 1499.6
spam score = 72.3645
documents = 1177
clusterid = a79d262c0
RMSE = 1499.95
spam score = 60.6146
documents = 288
clusterid = a7a0a44a0
RMSE = 1500.12
spam score = 69.2218
documents = 1366
clusterid = a7a65efe0
RMSE = 1500.28
spam score = 75.7263
documents = 464
clusterid = a7a0d6660
RMSE = 1500.33
spam score = 75.3153
documents = 463
clusterid = a7a412350
RMSE = 1500.37
spam score = 60.7519
documents = 2052
clusterid = a79bd3af0
RMSE = 1500.62
spam score = 59.5671
documents = 261
clusterid = a7a8c4d50
RMSE = 1500.76
spam score = 62.4454
documents = 797
clusterid = a7a871510
RMSE = 1501.13
spam score = 56.1667
documents = 18
clusterid = a7a119360
RMSE = 1501.14
spam score = 70.7101
documents = 1242
clusterid = a7a6e49e0
RMSE = 1501.18
spam score = 67.8286
documents = 1056
clusterid = a7a952cf0
RMSE = 1501.3
spam score = 60.8145
documents = 1008
clusterid = a7a5f6990
RMSE = 1501.43
spam score = 78.8759
documents = 1603
clusterid = a7a405ae0
RMSE = 1501.55
spam score = 59.7177
documents = 503
clusterid = a7a29e900
RMSE = 1502.17
spam score = 44.0417
documents = 144
clusterid = a7a68ced0
RMSE = 1502.32
spam score = 69.0638
documents = 188
clusterid = a7a362d30
RMSE = 1502.38
spam score = 73.3565
documents = 805
clusterid = a7a2a2bd0
RMSE = 1502.58
spam score = 70.4305
documents = 604
clusterid = a79cdb020
RMSE = 1502.69
spam score = 66.8183
documents = 1139
clusterid = a7a09bf00
RMSE = 1502.88
spam score = 50.9712
documents = 208
clusterid = a79c7af70
RMSE = 1503.19
spam score = 70.2953
documents = 193
clusterid = a7a9dc9c0
RMSE = 1503.33
spam score = 65.2959
documents = 1325
clusterid = a7a07eb50
RMSE = 1503.34
spam score = 64.723
documents = 1372
clusterid = a79f0f3d0
RMSE = 1503.38
spam score = 60.8691
documents = 1413
clusterid = a7a0b92b0
RMSE = 1503.57
spam score = 60.3846
documents = 1334
clusterid = a7a349c50
RMSE = 1503.86
spam score = 66.9286
documents = 700
clusterid = a7a20f950
RMSE = 1504.39
spam score = 51.8614
documents = 2056
clusterid = a7a30f4f0
RMSE = 1504.4
spam score = 80.5694
documents = 1117
clusterid = a7a5ccd70
RMSE = 1504.78
spam score = 69.2616
documents = 1556
clusterid = a7a2dd330
RMSE = 1505.18
spam score = 62.7843
documents = 343
clusterid = a79e91f70
RMSE = 1505.31
spam score = 64.5315
documents = 1351
clusterid = a7a0443f0
RMSE = 1505.35
spam score = 79.2669
documents = 487
clusterid = a7a388680
RMSE = 1505.75
spam score = 70.6938
documents = 307
clusterid = a79ac4220
RMSE = 1505.97
spam score = 63.9152
documents = 672
clusterid = a79f90b00
RMSE = 1506.17
spam score = 68.5993
documents = 1193
clusterid = a79bf9440
RMSE = 1506.68
spam score = 56
documents = 20
clusterid = a7a42f700
RMSE = 1506.9
spam score = 63.8105
documents = 1409
clusterid = a7a800920
RMSE = 1506.94
spam score = 65.3077
documents = 1261
clusterid = a7a0dec00
RMSE = 1507.03
spam score = 63.1778
documents = 360
clusterid = a7a80d190
RMSE = 1507.11
spam score = 72.7911
documents = 761
clusterid = a79f7bcf0
RMSE = 1507.27
spam score = 71.4026
documents = 760
clusterid = a7a228a30
RMSE = 1507.3
spam score = 59.9914
documents = 584
clusterid = a7a6bf090
RMSE = 1507.5
spam score = 54.7896
documents = 1359
clusterid = a79f520d0
RMSE = 1507.59
spam score = 57.0911
documents = 1790
clusterid = a79f9d370
RMSE = 1507.62
spam score = 62.1962
documents = 1259
clusterid = a7a8a79a0
RMSE = 1507.64
spam score = 76.0958
documents = 1252
clusterid = a79abbc80
RMSE = 1508.74
spam score = 57.2263
documents = 137
clusterid = a7a48f7b0
RMSE = 1509.07
spam score = 61.9412
documents = 17
clusterid = a7a84fe90
RMSE = 1509.47
spam score = 72.8263
documents = 944
clusterid = a7a1b3b70
RMSE = 1509.51
spam score = 71.8143
documents = 237
clusterid = a79f84290
RMSE = 1509.57
spam score = 73.4859
documents = 992
clusterid = a79d1dd20
RMSE = 1509.7
spam score = 63.0407
documents = 1303
clusterid = a7aa27c60
RMSE = 1509.8
spam score = 68.6005
documents = 378
clusterid = a7a1924f0
RMSE = 1509.93
spam score = 62.7608
documents = 1476
clusterid = a7a999cc0
RMSE = 1509.98
spam score = 70.6835
documents = 556
clusterid = a79bc2fb0
RMSE = 1510.66
spam score = 62.6671
documents = 1490
clusterid = a7a673df0
RMSE = 1510.76
spam score = 74.0947
documents = 961
clusterid = a7a808ec0
RMSE = 1511.01
spam score = 63.6775
documents = 862
clusterid = a7a8abc70
RMSE = 1511.16
spam score = 72.3533
documents = 852
clusterid = a7a8ee970
RMSE = 1511.21
spam score = 67.1481
documents = 621
clusterid = a7a487210
RMSE = 1511.41
spam score = 66.121
documents = 1364
clusterid = a79ef62f0
RMSE = 1511.6
spam score = 53.835
documents = 406
clusterid = a7a6c3360
RMSE = 1511.66
spam score = 70.8786
documents = 1359
clusterid = a7a3f4fa0
RMSE = 1511.73
spam score = 73.2972
documents = 461
clusterid = a79f73750
RMSE = 1511.95
spam score = 81.6577
documents = 111
clusterid = a79fc6f90
RMSE = 1512.45
spam score = 62.8805
documents = 1230
clusterid = a7a9142c0
RMSE = 1512.87
spam score = 75.2266
documents = 993
clusterid = a7a6c7630
RMSE = 1513.01
spam score = 55.5338
documents = 1139
clusterid = a79ce35c0
RMSE = 1513.04
spam score = 56.8095
documents = 950
clusterid = a7a02f5e0
RMSE = 1513.37
spam score = 63.4356
documents = 101
clusterid = a7a73c4f0
RMSE = 1514.01
spam score = 66.6726
documents = 1845
clusterid = a7a132440
RMSE = 1514.14
spam score = 70.4346
documents = 405
clusterid = a7a9e4f60
RMSE = 1514.34
spam score = 71.2744
documents = 164
clusterid = a7a3fd540
RMSE = 1514.68
spam score = 59.6625
documents = 809
clusterid = a7aa45010
RMSE = 1514.8
spam score = 68.6333
documents = 60
clusterid = a7a82e810
RMSE = 1514.89
spam score = 53.2419
documents = 62
clusterid = a79f5e940
RMSE = 1514.99
spam score = 57.9876
documents = 482
clusterid = a79b90df0
RMSE = 1515.11
spam score = 64.6956
documents = 1153
clusterid = a7aa0a8b0
RMSE = 1515.12
spam score = 63.1024
documents = 713
clusterid = a7a3adfd0
RMSE = 1515.16
spam score = 70.1866
documents = 595
clusterid = a7a78fd30
RMSE = 1515.18
spam score = 68.431
documents = 1849
clusterid = a7a17d6e0
RMSE = 1515.19
spam score = 56.5123
documents = 1136
clusterid = a79e185e0
RMSE = 1515.35
spam score = 65.5063
documents = 316
clusterid = a79f284b0
RMSE = 1515.39
spam score = 60.9122
documents = 1389
clusterid = a79ca4b90
RMSE = 1515.62
spam score = 77.2507
documents = 1488
clusterid = a7a55c180
RMSE = 1515.78
spam score = 63.9514
documents = 1480
clusterid = a7a0da930
RMSE = 1515.81
spam score = 62.6989
documents = 1561
clusterid = a7a22cd00
RMSE = 1516.09
spam score = 61.4382
documents = 1465
clusterid = a7a36b2d0
RMSE = 1516.59
spam score = 68.0558
documents = 1182
clusterid = a7a9bb340
RMSE = 1516.69
spam score = 67.6362
documents = 1553
clusterid = a7a422e90
RMSE = 1516.9
spam score = 56.6833
documents = 1301
clusterid = a7a263190
RMSE = 1517.08
spam score = 63.4793
documents = 603
clusterid = a7a2af440
RMSE = 1517.16
spam score = 75.1784
documents = 482
clusterid = a7a8f2c40
RMSE = 1517.19
spam score = 8.17822
documents = 202
clusterid = a79e4f270
RMSE = 1517.47
spam score = 74.6294
documents = 1233
clusterid = a79ba5c00
RMSE = 1517.65
spam score = 60.0289
documents = 1003
clusterid = a7a0bd580
RMSE = 1517.91
spam score = 56.8564
documents = 390
clusterid = a79d0d1e0
RMSE = 1518.27
spam score = 71.2278
documents = 1567
clusterid = a79f45860
RMSE = 1518.58
spam score = 75.6004
documents = 1086
clusterid = a7a3b22a0
RMSE = 1518.66
spam score = 63.0116
documents = 1721
clusterid = a79d04c40
RMSE = 1519.03
spam score = 58.8742
documents = 493
clusterid = a79f17970
RMSE = 1519.25
spam score = 57.5636
documents = 660
clusterid = a79b84580
RMSE = 1519.49
spam score = 67.631
documents = 84
clusterid = a79e1c8b0
RMSE = 1519.51
spam score = 65.8799
documents = 1199
clusterid = a79fb2180
RMSE = 1519.55
spam score = 73.4656
documents = 960
clusterid = a79f02b60
RMSE = 1519.64
spam score = 69.7657
documents = 367
clusterid = a7a3137c0
RMSE = 1519.74
spam score = 65.5164
documents = 428
clusterid = a7a18e220
RMSE = 1519.83
spam score = 56.3544
documents = 79
clusterid = a7a989180
RMSE = 1520.13
spam score = 54.4778
documents = 496
clusterid = a7a843620
RMSE = 1520.41
spam score = 69.2338
documents = 1112
clusterid = a7a6f1250
RMSE = 1520.57
spam score = 62.2889
documents = 405
clusterid = a79eab050
RMSE = 1520.57
spam score = 62.4217
documents = 1596
clusterid = a79ee14e0
RMSE = 1520.67
spam score = 64.3742
documents = 302
clusterid = a7a532560
RMSE = 1521.03
spam score = 66.6637
documents = 797
clusterid = a7a868f70
RMSE = 1521.38
spam score = 67.9474
documents = 1464
clusterid = a79ad9030
RMSE = 1521.49
spam score = 60.0311
documents = 161
clusterid = a79b202c0
RMSE = 1521.54
spam score = 51.2521
documents = 1067
clusterid = a7a882050
RMSE = 1521.55
spam score = 57.3321
documents = 545
clusterid = a79d9b180
RMSE = 1521.81
spam score = 73.1597
documents = 238
clusterid = a7a06e010
RMSE = 1522.31
spam score = 63.9284
documents = 1481
clusterid = a7a9d86f0
RMSE = 1522.31
spam score = 50.9005
documents = 834
clusterid = a79e7d160
RMSE = 1522.75
spam score = 63.4819
documents = 996
clusterid = a7a963830
RMSE = 1522.77
spam score = 57.6606
documents = 277
clusterid = a79de2150
RMSE = 1522.77
spam score = 62.5092
documents = 491
clusterid = a79f6b1b0
RMSE = 1523.21
spam score = 56.6205
documents = 1191
clusterid = a7a525cf0
RMSE = 1523.24
spam score = 71.5417
documents = 192
clusterid = a7a2c8520
RMSE = 1523.48
spam score = 65.887
documents = 1540
clusterid = a7a115090
RMSE = 1523.67
spam score = 61.261
documents = 387
clusterid = a79a1cfd0
RMSE = 1523.82
spam score = 70.0981
documents = 540
clusterid = a7a330b70
RMSE = 1524.18
spam score = 63.947
documents = 812
clusterid = a79f5a670
RMSE = 1524.33
spam score = 71.2351
documents = 336
clusterid = a7a334e40
RMSE = 1524.64
spam score = 68.0603
documents = 531
clusterid = a7a373870
RMSE = 1525.28
spam score = 68.8755
documents = 1943
clusterid = a7a83b080
RMSE = 1525.46
spam score = 59.7989
documents = 557
clusterid = a7a924e00
RMSE = 1525.52
spam score = 45.1852
documents = 27
clusterid = a7a5a7420
RMSE = 1525.97
spam score = 62.9362
documents = 1160
clusterid = a79a18cf0
RMSE = 1526.22
spam score = 69.4466
documents = 468
clusterid = a79cb56d0
RMSE = 1526.23
spam score = 63.4138
documents = 58
clusterid = a79dd58e0
RMSE = 1526.23
spam score = 58.9812
documents = 959
clusterid = a7a10caf0
RMSE = 1526.72
spam score = 64.0474
documents = 633
clusterid = a7a744a90
RMSE = 1527.57
spam score = 66.0337
documents = 1099
clusterid = a7a497d50
RMSE = 1527.58
spam score = 61.8195
documents = 554
clusterid = a79b41880
RMSE = 1527.84
spam score = 59.1734
documents = 467
clusterid = a7a4e2ff0
RMSE = 1528.12
spam score = 66.8979
documents = 1175
clusterid = a7a04c990
RMSE = 1528.14
spam score = 63.53
documents = 832
clusterid = a7a6dc440
RMSE = 1528.38
spam score = 63.2635
documents = 1226
clusterid = a7a77f1f0
RMSE = 1528.98
spam score = 75.248
documents = 1770
clusterid = a79f62c10
RMSE = 1529.67
spam score = 64.7692
documents = 117
clusterid = a79f3d2c0
RMSE = 1529.73
spam score = 58.0745
documents = 510
clusterid = a7a652770
RMSE = 1530.17
spam score = 55.1075
documents = 828
clusterid = a7a394ef0
RMSE = 1530.45
spam score = 68.378
documents = 537
clusterid = a7a832ae0
RMSE = 1530.75
spam score = 57.2025
documents = 869
clusterid = a79d86370
RMSE = 1531.06
spam score = 53.6818
documents = 22
clusterid = a7a19aa90
RMSE = 1531.16
spam score = 66.5606
documents = 701
clusterid = a7a5a3150
RMSE = 1531.23
spam score = 67.1524
documents = 1234
clusterid = a79f38ff0
RMSE = 1531.29
spam score = 55.7857
documents = 56
clusterid = a7a3843b0
RMSE = 1531.3
spam score = 66.0229
documents = 787
clusterid = a7a03be50
RMSE = 1531.55
spam score = 71.0373
documents = 1206
clusterid = a79d7ddd0
RMSE = 1531.68
spam score = 63.0442
documents = 633
clusterid = a7a585da0
RMSE = 1531.76
spam score = 68.6456
documents = 79
clusterid = a79fcf530
RMSE = 1531.88
spam score = 73.9353
documents = 479
clusterid = a79d36e00
RMSE = 1531.9
spam score = 69.9206
documents = 126
clusterid = a7a560450
RMSE = 1532.06
spam score = 61.1656
documents = 761
clusterid = a7a1a3030
RMSE = 1532.16
spam score = 59.0602
documents = 615
clusterid = a79a25570
RMSE = 1532.21
spam score = 60.6351
documents = 296
clusterid = a7a15c060
RMSE = 1532.22
spam score = 57.2137
documents = 524
clusterid = a7a84bbc0
RMSE = 1532.38
spam score = 62.4601
documents = 363
clusterid = a7aa5e0f0
RMSE = 1532.48
spam score = 69.9007
documents = 302
clusterid = a7a776c50
RMSE = 1533.02
spam score = 67.8176
documents = 466
clusterid = a79e57810
RMSE = 1533.14
spam score = 65.9679
documents = 187
clusterid = a7a1f6870
RMSE = 1533.17
spam score = 56.4201
documents = 845
clusterid = a7a4e72c0
RMSE = 1533.35
spam score = 62.6741
documents = 1163
clusterid = a7a0fbfb0
RMSE = 1533.38
spam score = 60.0321
documents = 811
clusterid = a79e81430
RMSE = 1533.99
spam score = 74.0876
documents = 1643
clusterid = a7a3d7bf0
RMSE = 1534.45
spam score = 70.4851
documents = 1515
clusterid = a79b56690
RMSE = 1534.5
spam score = 54.4708
documents = 1729
clusterid = a7a2b3710
RMSE = 1534.66
spam score = 70.8734
documents = 616
clusterid = a79f241e0
RMSE = 1534.94
spam score = 59.6552
documents = 290
clusterid = a7a2e9ba0
RMSE = 1535.03
spam score = 62.2471
documents = 437
clusterid = a7a521a20
RMSE = 1535.07
spam score = 61.5428
documents = 1214
clusterid = a7a53edd0
RMSE = 1535.5
spam score = 62.6294
documents = 618
clusterid = a7a7e7840
RMSE = 1535.51
spam score = 66.5913
documents = 1287
clusterid = a7a069d40
RMSE = 1535.58
spam score = 69.619
documents = 84
clusterid = a79bb2470
RMSE = 1536.75
spam score = 62.5796
documents = 735
clusterid = a7a66b850
RMSE = 1536.77
spam score = 63.5707
documents = 615
clusterid = a79f06e30
RMSE = 1536.97
spam score = 64.6149
documents = 470
clusterid = a7a723410
RMSE = 1537.09
spam score = 69.153
documents = 1536
clusterid = a7a012230
RMSE = 1537.12
spam score = 57.2643
documents = 473
clusterid = a7a701d90
RMSE = 1537.52
spam score = 53.047
documents = 808
clusterid = a79e037d0
RMSE = 1537.9
spam score = 68.7859
documents = 299
clusterid = a79f30a50
RMSE = 1537.97
spam score = 68.8779
documents = 1621
clusterid = a79fa5910
RMSE = 1538.19
spam score = 69.9245
documents = 106
clusterid = a7aa387a0
RMSE = 1538.52
spam score = 68.1456
documents = 879
clusterid = a79e5fdb0
RMSE = 1538.55
spam score = 60.9844
documents = 771
clusterid = a79d2e860
RMSE = 1538.83
spam score = 65.6429
documents = 770
clusterid = a79cf83d0
RMSE = 1539.23
spam score = 69.1145
documents = 1336
clusterid = a7a5fef30
RMSE = 1539.23
spam score = 65.2464
documents = 617
clusterid = a7a4bd6a0
RMSE = 1539.26
spam score = 53.2446
documents = 826
clusterid = a7a0a01d0
RMSE = 1539.37
spam score = 56.6926
documents = 989
clusterid = a79bae1a0
RMSE = 1539.8
spam score = 74.475
documents = 1659
clusterid = a7a70a330
RMSE = 1539.93
spam score = 66.5921
documents = 939
clusterid = a7a8e2100
RMSE = 1540.12
spam score = 66.8862
documents = 1107
clusterid = a7a377b40
RMSE = 1540.14
spam score = 70.6543
documents = 243
clusterid = a7a4a02f0
RMSE = 1540.29
spam score = 55.0419
documents = 978
clusterid = a7a42b430
RMSE = 1540.49
spam score = 70.2278
documents = 641
clusterid = a7a4d24b0
RMSE = 1540.73
spam score = 67.176
documents = 500
clusterid = a7a2e1600
RMSE = 1540.85
spam score = 64.3499
documents = 623
clusterid = a79be0360
RMSE = 1541.54
spam score = 60.569
documents = 58
clusterid = a7a71f140
RMSE = 1541.54
spam score = 52.7787
documents = 863
clusterid = a7a7ad0e0
RMSE = 1541.62
spam score = 66.3141
documents = 191
clusterid = a7a66fb20
RMSE = 1541.82
spam score = 63.3405
documents = 561
clusterid = a79b73a40
RMSE = 1542.05
spam score = 62.0985
documents = 1310
clusterid = a7a3ba840
RMSE = 1542.46
spam score = 68.534
documents = 970
clusterid = a7a1c46b0
RMSE = 1542.8
spam score = 60.8408
documents = 986
clusterid = a7a89b130
RMSE = 1542.92
spam score = 57.4463
documents = 782
clusterid = a7a9ed500
RMSE = 1542.94
spam score = 63.4554
documents = 819
clusterid = a7a8d5890
RMSE = 1543.39
spam score = 67.4192
documents = 334
clusterid = a7a239570
RMSE = 1543.9
spam score = 75.3182
documents = 132
clusterid = a79f2c780
RMSE = 1544.18
spam score = 69.2507
documents = 363
clusterid = a7a64a1d0
RMSE = 1544.55
spam score = 65.1484
documents = 1651
clusterid = a7a581ad0
RMSE = 1544.98
spam score = 58.6908
documents = 705
clusterid = a79be8900
RMSE = 1545.14
spam score = 64.2903
documents = 713
clusterid = a79af2110
RMSE = 1545.16
spam score = 69.5917
documents = 120
clusterid = a79b49e20
RMSE = 1545.3
spam score = 59.3649
documents = 1299
clusterid = a7a9fe040
RMSE = 1545.93
spam score = 59.7743
documents = 319
clusterid = a7a34df20
RMSE = 1546.04
spam score = 82.1406
documents = 128
clusterid = a7a5d95e0
RMSE = 1546.24
spam score = 65.9711
documents = 761
clusterid = a7a0ef740
RMSE = 1546.3
spam score = 67.2045
documents = 753
clusterid = a79e64080
RMSE = 1546.3
spam score = 67.8295
documents = 2545
clusterid = a7a170e70
RMSE = 1546.36
spam score = 54.9946
documents = 554
clusterid = a79f34d20
RMSE = 1546.61
spam score = 64.4617
documents = 600
clusterid = a7a60fa70
RMSE = 1547.05
spam score = 57.2653
documents = 1598
clusterid = a7a1c03e0
RMSE = 1547.13
spam score = 64.9623
documents = 106
clusterid = a79dc4da0
RMSE = 1547.43
spam score = 66.5735
documents = 272
clusterid = a7a4487e0
RMSE = 1547.65
spam score = 60.0152
documents = 924
clusterid = a79f8c830
RMSE = 1547.7
spam score = 62.0324
documents = 802
clusterid = a79bdc090
RMSE = 1547.84
spam score = 63.8164
documents = 256
clusterid = a79b950c0
RMSE = 1547.88
spam score = 61.6588
documents = 1058
clusterid = a7a3beb10
RMSE = 1547.9
spam score = 66.3094
documents = 934
clusterid = a79e10040
RMSE = 1547.92
spam score = 59.9309
documents = 564
clusterid = a7a69da10
RMSE = 1548.34
spam score = 67.1042
documents = 595
clusterid = a7a3e4460
RMSE = 1548.36
spam score = 64.9929
documents = 422
clusterid = a7a854160
RMSE = 1548.47
spam score = 65.1722
documents = 273
clusterid = a7a32c8a0
RMSE = 1548.54
spam score = 60.311
documents = 553
clusterid = a7a6ae550
RMSE = 1548.76
spam score = 57.8037
documents = 820
clusterid = a7a416620
RMSE = 1549.2
spam score = 63.7596
documents = 183
clusterid = a79bb6740
RMSE = 1549.34
spam score = 70.2491
documents = 1128
clusterid = a7a70e600
RMSE = 1549.44
spam score = 58.7579
documents = 566
clusterid = a7a100280
RMSE = 1550.02
spam score = 76.0173
documents = 404
clusterid = a79dea6f0
RMSE = 1550.53
spam score = 69.1102
documents = 127
clusterid = a7a819a00
RMSE = 1550.59
spam score = 61.9883
documents = 256
clusterid = a7a892b90
RMSE = 1550.77
spam score = 68.5778
documents = 514
clusterid = a7a58e340
RMSE = 1551.02
spam score = 64.2854
documents = 452
clusterid = a7a14f7f0
RMSE = 1551.25
spam score = 65.1117
documents = 555
clusterid = a7a33d3e0
RMSE = 1551.47
spam score = 62.0157
documents = 127
clusterid = a79cca4e0
RMSE = 1551.85
spam score = 67.8775
documents = 147
clusterid = a79eedd50
RMSE = 1552.05
spam score = 62.25
documents = 384
clusterid = a79fc2cc0
RMSE = 1552.15
spam score = 52.0966
documents = 176
clusterid = a7a3800e0
RMSE = 1552.34
spam score = 54.1987
documents = 448
clusterid = a7a6a1ce0
RMSE = 1552.36
spam score = 71.285
documents = 407
clusterid = a7a6911a0
RMSE = 1553.45
spam score = 67.6805
documents = 457
clusterid = a79e43120
RMSE = 1553.75
spam score = 58.7619
documents = 147
clusterid = a79e5bae0
RMSE = 1554.07
spam score = 65.2488
documents = 868
clusterid = a7a733f50
RMSE = 1554.59
spam score = 67.7985
documents = 273
clusterid = a7a5b7f60
RMSE = 1555.09
spam score = 50.2036
documents = 830
clusterid = a7a7dafd0
RMSE = 1555.1
spam score = 69.9363
documents = 251
clusterid = a7a907a50
RMSE = 1555.47
spam score = 59.898
documents = 304
clusterid = a7a7efde0
RMSE = 1555.59
spam score = 56.8174
documents = 241
clusterid = a7a472400
RMSE = 1555.63
spam score = 62.6788
documents = 1158
clusterid = a7a529fc0
RMSE = 1555.73
spam score = 66.1974
documents = 1459
clusterid = a79d21ff0
RMSE = 1556.09
spam score = 63.3014
documents = 637
clusterid = a79b35010
RMSE = 1556.26
spam score = 72.7206
documents = 68
clusterid = a79fe0070
RMSE = 1556.35
spam score = 56.3895
documents = 190
clusterid = a7a0f7ce0
RMSE = 1556.51
spam score = 62.5782
documents = 403
clusterid = a7a6f5520
RMSE = 1556.62
spam score = 73.9355
documents = 620
clusterid = a7a339110
RMSE = 1556.67
spam score = 64.2293
documents = 628
clusterid = a7a4c1970
RMSE = 1556.77
spam score = 67.7853
documents = 163
clusterid = a7a3285d0
RMSE = 1556.85
spam score = 59.8964
documents = 869
clusterid = a7a45d5f0
RMSE = 1557.14
spam score = 52.2333
documents = 90
clusterid = a79b8cb20
RMSE = 1557.32
spam score = 70.5858
documents = 507
clusterid = a79c09f80
RMSE = 1557.48
spam score = 59.4333
documents = 1281
clusterid = a79fcb260
RMSE = 1557.49
spam score = 67.384
documents = 664
clusterid = a7a8c0a80
RMSE = 1557.74
spam score = 71.5881
documents = 318
clusterid = a7a2a6ea0
RMSE = 1557.9
spam score = 59.6278
documents = 1311
clusterid = a7a401810
RMSE = 1558.05
spam score = 55.6009
documents = 1075
clusterid = a79e35990
RMSE = 1558.17
spam score = 67.3827
documents = 776
clusterid = a79c83510
RMSE = 1558.21
spam score = 70.3722
documents = 360
clusterid = a79a96230
RMSE = 1558.21
spam score = 66.5638
documents = 94
clusterid = a79cefe30
RMSE = 1558.38
spam score = 66.8783
documents = 846
clusterid = a7a7c61c0
RMSE = 1558.56
spam score = 58.2939
documents = 1099
clusterid = a7a5dd8b0
RMSE = 1558.86
spam score = 66.8801
documents = 342
clusterid = a79a9a5b0
RMSE = 1559.12
spam score = 73.0161
documents = 310
clusterid = a79ffd420
RMSE = 1559.34
spam score = 71.9551
documents = 1025
clusterid = a7a3e0190
RMSE = 1560.29
spam score = 62.2398
documents = 1472
clusterid = a79ff4e80
RMSE = 1560.38
spam score = 60.7112
documents = 1212
clusterid = a7a1b7e40
RMSE = 1560.61
spam score = 62.4526
documents = 411
clusterid = a7a13ecb0
RMSE = 1560.64
spam score = 36.9167
documents = 36
clusterid = a7a0765b0
RMSE = 1560.93
spam score = 62.1836
documents = 501
clusterid = a7a8757e0
RMSE = 1561.53
spam score = 68.1594
documents = 1104
clusterid = a7a9cbe80
RMSE = 1561.65
spam score = 63.0239
documents = 543
clusterid = a7a706060
RMSE = 1561.9
spam score = 65.1454
documents = 784
clusterid = a7a0e71a0
RMSE = 1562.22
spam score = 62.9558
documents = 679
clusterid = a7a220490
RMSE = 1562.81
spam score = 46.9615
documents = 78
clusterid = a7a46e130
RMSE = 1563.75
spam score = 63.2865
documents = 960
clusterid = a79fdbda0
RMSE = 1565.27
spam score = 56.5689
documents = 515
clusterid = a7a41ebc0
RMSE = 1565.32
spam score = 69.8
documents = 215
clusterid = a79f563a0
RMSE = 1565.35
spam score = 63.4609
documents = 909
clusterid = a79d9f450
RMSE = 1565.77
spam score = 65.8753
documents = 722
clusterid = a7a0486c0
RMSE = 1566.16
spam score = 68.5097
documents = 257
clusterid = a7a8bc7b0
RMSE = 1566.25
spam score = 67.5251
documents = 956
clusterid = a7a296360
RMSE = 1566.47
spam score = 65.0392
documents = 204
clusterid = a79b9d660
RMSE = 1566.87
spam score = 61.1911
documents = 403
clusterid = a7a991720
RMSE = 1566.97
spam score = 73.4426
documents = 1333
clusterid = a7a89f400
RMSE = 1568.11
spam score = 62.8366
documents = 1022
clusterid = a79ed09a0
RMSE = 1569.08
spam score = 60.9368
documents = 427
clusterid = a7aa2bf30
RMSE = 1569.26
spam score = 62.2695
documents = 512
clusterid = a7a2bbcb0
RMSE = 1569.35
spam score = 60.9872
documents = 156
clusterid = a79cce7b0
RMSE = 1569.48
spam score = 72.6979
documents = 384
clusterid = a7a11d630
RMSE = 1569.83
spam score = 71.5422
documents = 1020
clusterid = a79df2c90
RMSE = 1570.02
spam score = 58.7407
documents = 563
clusterid = a7a864ca0
RMSE = 1570.17
spam score = 60.8444
documents = 450
clusterid = a79efa5c0
RMSE = 1570.27
spam score = 58.7652
documents = 132
clusterid = a7a52e290
RMSE = 1570.49
spam score = 64.3333
documents = 42
clusterid = a7a8ff4b0
RMSE = 1570.63
spam score = 70.1047
documents = 430
clusterid = a79f0b100
RMSE = 1571.07
spam score = 51.5745
documents = 879
clusterid = a7a0338b0
RMSE = 1572.03
spam score = 55.4634
documents = 902
clusterid = a7a01a7d0
RMSE = 1572.1
spam score = 72.7606
documents = 71
clusterid = a7a4d6780
RMSE = 1572.62
spam score = 63.1011
documents = 989
clusterid = a7a0c5b20
RMSE = 1573.27
spam score = 65.9766
documents = 598
clusterid = a7a0eb470
RMSE = 1574.78
spam score = 68.8385
documents = 322
clusterid = a79de6420
RMSE = 1575.33
spam score = 65.9792
documents = 144
clusterid = a7a4339d0
RMSE = 1575.38
spam score = 58.0157
documents = 447
clusterid = a7a8b4210
RMSE = 1575.96
spam score = 48.397
documents = 199
clusterid = a7a30b220
RMSE = 1576.21
spam score = 66.4295
documents = 461
clusterid = a79bd7dc0
RMSE = 1576.25
spam score = 54.5259
documents = 116
clusterid = a7a12e170
RMSE = 1577.22
spam score = 59.9714
documents = 420
clusterid = a7a4618c0
RMSE = 1577.45
spam score = 59.1389
documents = 1051
clusterid = a7a613d40
RMSE = 1577.49
spam score = 57.9119
documents = 579
clusterid = a7a47ec70
RMSE = 1577.57
spam score = 59.9458
documents = 203
clusterid = a79a856f0
RMSE = 1578.38
spam score = 68.675
documents = 677
clusterid = a79dd9bb0
RMSE = 1578.48
spam score = 57.5431
documents = 591
clusterid = a7a2d9060
RMSE = 1578.73
spam score = 65.2165
documents = 231
clusterid = a7a3cb380
RMSE = 1579.11
spam score = 55.3126
documents = 419
clusterid = a79e74bc0
RMSE = 1580.31
spam score = 70.139
documents = 259
clusterid = a79cfc6a0
RMSE = 1580.37
spam score = 57.4215
documents = 325
clusterid = a7a129ea0
RMSE = 1581.82
spam score = 63.1795
documents = 117
clusterid = a7a469e60
RMSE = 1581.97
spam score = 64.8833
documents = 557
clusterid = a7a6e0710
RMSE = 1583.28
spam score = 65.1704
documents = 223
clusterid = a79ff9150
RMSE = 1583.43
spam score = 57.1442
documents = 721
clusterid = a7a0d2390
RMSE = 1584.03
spam score = 65.597
documents = 531
clusterid = a7a9bf610
RMSE = 1584.35
spam score = 53.8994
documents = 328
clusterid = a7a935940
RMSE = 1584.39
spam score = 62.3852
documents = 392
clusterid = a7a164600
RMSE = 1584.74
spam score = 63.0801
documents = 437
clusterid = a79b4e0f0
RMSE = 1588.62
spam score = 59.1309
documents = 894
clusterid = a7a009c90
RMSE = 1589.28
spam score = 62.5486
documents = 370
clusterid = a79cf4100
RMSE = 1590.12
spam score = 63.3837
documents = 245
clusterid = a7a56ccc0
RMSE = 1591.29
spam score = 57.8973
documents = 1003
clusterid = a79a74bb0
RMSE = 1591.54
spam score = 58.8642
documents = 302
clusterid = a7a96bdd0
RMSE = 1592.11
spam score = 64.096
documents = 552
clusterid = a7a2ab170
RMSE = 1592.27
spam score = 62.6993
documents = 296
clusterid = a7a6d3ea0
RMSE = 1592.95
spam score = 58.3026
documents = 152
clusterid = a7a9290d0
RMSE = 1593.17
spam score = 63.1703
documents = 323
clusterid = a7a121900
RMSE = 1593.84
spam score = 63.6648
documents = 916
clusterid = a7a6d8170
RMSE = 1595.43
spam score = 62.7962
documents = 211
clusterid = a7a0f3a10
RMSE = 1600.78
spam score = 67.787
documents = 108
clusterid = a7a25eec0
RMSE = 1601.56
spam score = 50.605
documents = 443
clusterid = a79d114b0
RMSE = 1601.92
spam score = 58.7372
documents = 506
clusterid = a7a9a2260
RMSE = 1602.68
spam score = 60.18
documents = 50
clusterid = a7a570f90
RMSE = 1603.04
spam score = 60.6055
documents = 398
clusterid = a7aa0eb80
RMSE = 1605.39
spam score = 34.2812
documents = 256
clusterid = a7a4f3b30
RMSE = 1606.68
spam score = 62.6346
documents = 52
clusterid = a7a967b00
RMSE = 1607.06
spam score = 55.3538
documents = 130
clusterid = a7a821fa0
RMSE = 1608.12
spam score = 52.3396
documents = 53
clusterid = a7a536830
RMSE = 1611.42
spam score = 54.205
documents = 278
clusterid = a7aa40d40
RMSE = 1613.15
spam score = 57.0898
documents = 167
clusterid = a79b5ec30
RMSE = 1613.75
spam score = 61.466
documents = 427
clusterid = a79da3720
RMSE = 1614.04
spam score = 65.0193
documents = 415
clusterid = a79efe890
RMSE = 1619.75
spam score = 58.027
documents = 741
clusterid = a7a0ce0c0
RMSE = 1640.1
spam score = 56.8333
documents = 6
clusterid = a7a5bc230
RMSE = 1645.97
spam score = 79.7
documents = 10
clusterid = a7a6353c0
RMSE = 1688
spam score = 66
documents = 1
clusterid = a7a2b79e0
RMSE = 1715.78
spam score = 85.5
documents = 4
distance = 0
spam score = 32
title = ''

distance = 0
spam score = 64
title = ''

distance = 0
spam score = 62
title = ''

distance = 0
spam score = 46
title = ''

distance = 0
spam score = 78
title = ''

distance = 0
spam score = 19
title = ''

distance = 2
spam score = 98
title = ''

distance = 3
spam score = 99
title = ''

distance = 3
spam score = 99
title = ''

distance = 8
spam score = 43
title = ''

distance = 12
spam score = 38
title = ''

distance = 12
spam score = 97
title = 'information technology it system resources'

distance = 12
spam score = 96
title = 'information technology it system resources'

distance = 13
spam score = 96
title = 'information technology it system resources'

distance = 15
spam score = 96
title = 'information technology it system resources'

distance = 15
spam score = 96
title = 'information technology it system resources'

distance = 15
spam score = 96
title = 'information technology it system resources'

distance = 15
spam score = 96
title = 'information technology it system resources'

distance = 15
spam score = 96
title = 'information technology it system resources'

distance = 16
spam score = 96
title = 'information technology it system resources'

distance = 16
spam score = 96
title = 'information technology it system resources'

distance = 16
spam score = 97
title = 'information technology it system resources'

distance = 16
spam score = 96
title = 'information technology it system resources'

distance = 16
spam score = 96
title = 'information technology it system resources'

distance = 17
spam score = 96
title = 'information technology it system resources'

distance = 17
spam score = 96
title = 'information technology it system resources'

distance = 17
spam score = 97
title = 'information technology it system resources'

distance = 17
spam score = 96
title = 'information technology it system resources'

distance = 17
spam score = 96
title = 'information technology it system resources'

distance = 18
spam score = 96
title = 'information technology it system resources'

distance = 18
spam score = 97
title = 'information technology it system resources'

distance = 19
spam score = 96
title = 'information technology it system resources'

distance = 20
spam score = 96
title = 'information technology it system resources'

distance = 20
spam score = 96
title = 'information technology it system resources'

distance = 20
spam score = 96
title = 'information technology it system resources'

distance = 21
spam score = 96
title = 'information technology it system resources'

distance = 21
spam score = 96
title = 'information technology it system resources'

distance = 21
spam score = 96
title = 'information technology it system resources'

distance = 21
spam score = 96
title = 'information technology it system resources'

distance = 21
spam score = 96
title = 'information technology it system resources'

distance = 21
spam score = 96
title = 'information technology it system resources'

distance = 22
spam score = 96
title = 'information technology it system resources'

distance = 22
spam score = 96
title = 'information technology it system resources'

distance = 22
spam score = 96
title = 'information technology it system resources'

distance = 22
spam score = 96
title = 'information technology it system resources'

distance = 22
spam score = 96
title = 'information technology it system resources'

distance = 22
spam score = 96
title = 'information technology it system resources'

distance = 23
spam score = 96
title = 'information technology it system resources'

distance = 23
spam score = 96
title = 'information technology it system resources'

distance = 23
spam score = 96
title = 'information technology it system resources'

distance = 23
spam score = 96
title = 'information technology it system resources'

distance = 24
spam score = 96
title = 'information technology it system resources'

distance = 24
spam score = 96
title = 'information technology it system resources'

distance = 25
spam score = 96
title = 'information technology it system resources'

distance = 25
spam score = 96
title = 'information technology it system resources'

distance = 25
spam score = 96
title = 'information technology it system resources'

distance = 25
spam score = 96
title = 'information technology it system resources'

distance = 25
spam score = 96
title = 'information technology it system resources'

distance = 25
spam score = 96
title = 'information technology it system resources'

distance = 25
spam score = 96
title = 'information technology it system resources'

distance = 25
spam score = 96
title = 'information technology it system resources'

distance = 27
spam score = 96
title = 'information technology it system resources'

distance = 27
spam score = 96
title = 'information technology it system resources'

distance = 27
spam score = 96
title = 'information technology it system resources'

distance = 27
spam score = 96
title = 'information technology it system resources'

distance = 27
spam score = 97
title = 'information technology it system resources'

distance = 27
spam score = 96
title = 'information technology it system resources'

distance = 28
spam score = 96
title = 'information technology it system resources'

distance = 28
spam score = 96
title = 'information technology it system resources'

distance = 28
spam score = 96
title = 'information technology it system resources'

distance = 28
spam score = 96
title = 'information technology it system resources'

distance = 30
spam score = 96
title = 'information technology it system resources'

distance = 30
spam score = 96
title = 'information technology it system resources'

distance = 30
spam score = 96
title = 'information technology it system resources'

distance = 30
spam score = 96
title = 'information technology it system resources'

distance = 30
spam score = 96
title = 'information technology it system resources'

distance = 30
spam score = 96
title = 'information technology it system resources'

distance = 30
spam score = 96
title = 'information technology it system resources'

distance = 30
spam score = 96
title = 'information technology it system resources'

distance = 31
spam score = 96
title = 'information technology it system resources'

distance = 31
spam score = 96
title = 'information technology it system resources'

distance = 33
spam score = 96
title = 'information technology it system resources'

distance = 33
spam score = 96
title = 'information technology it system resources'

distance = 33
spam score = 96
title = 'information technology it system resources'

distance = 34
spam score = 96
title = 'information technology it system resources'

distance = 34
spam score = 96
title = 'information technology it system resources'

distance = 34
spam score = 96
title = 'information technology it system resources'

distance = 34
spam score = 97
title = 'information technology it system resources'

distance = 35
spam score = 96
title = 'information technology it system resources'

distance = 35
spam score = 96
title = 'information technology it system resources'

distance = 35
spam score = 96
title = 'information technology it system resources'

distance = 38
spam score = 96
title = 'information technology it system resources'

distance = 38
spam score = 96
title = 'information technology it system resources'

distance = 39
spam score = 97
title = 'information technology it system resources'

distance = 39
spam score = 96
title = 'information technology it system resources'

distance = 40
spam score = 95
title = 'information technology it system resources'

distance = 41
spam score = 98
title = 'information technology it system resources'

distance = 41
spam score = 96
title = 'information technology it system resources'

distance = 42
spam score = 96
title = 'information technology it system resources'

distance = 42
spam score = 96
title = 'information technology it system resources'

distance = 42
spam score = 98
title = 'information technology it system resources'

distance = 46
spam score = 96
title = 'information technology it system resources'

distance = 47
spam score = 96
title = 'information technology it system resources'

distance = 47
spam score = 96
title = 'information technology it system resources'

distance = 47
spam score = 96
title = 'information technology it system resources'

distance = 48
spam score = 96
title = 'information technology it system resources'

distance = 49
spam score = 96
title = 'information technology it system resources'

distance = 50
spam score = 97
title = 'information technology it system resources'

distance = 51
spam score = 97
title = 'information technology it system resources'

distance = 51
spam score = 96
title = 'information technology it system resources'

distance = 52
spam score = 98
title = 'information technology it system resources'

distance = 57
spam score = 98
title = 'information technology it system resources'

distance = 58
spam score = 96
title = 'information technology it system resources'

distance = 58
spam score = 98
title = 'information technology it system resources'

distance = 64
spam score = 98
title = 'information technology it system resources'

distance = 68
spam score = 98
title = 'information technology it system resources'

distance = 72
spam score = 98
title = 'information technology it system resources'

distance = 10
spam score = 66
title = ''

distance = 18
spam score = 47
title = ''

distance = 76
spam score = 53
title = ''

distance = 19
spam score = 43
title = ''

distance = 19
spam score = 46
title = ''

distance = 22
spam score = 52
title = ''

distance = 22
spam score = 50
title = ''

distance = 23
spam score = 47
title = ''

distance = 28
spam score = 48
title = ''

distance = 30
spam score = 40
title = ''

distance = 31
spam score = 44
title = ''

distance = 31
spam score = 53
title = ''

distance = 35
spam score = 46
title = ''

distance = 36
spam score = 45
title = ''

distance = 37
spam score = 41
title = ''

distance = 39
spam score = 42
title = ''

distance = 39
spam score = 42
title = ''

distance = 40
spam score = 44
title = ''

distance = 46
spam score = 47
title = ''

distance = 49
spam score = 49
title = ''

distance = 52
spam score = 51
title = ''

distance = 60
spam score = 45
title = ''

distance = 65
spam score = 45
title = ''

distance = 67
spam score = 48
title = ''

distance = 75
spam score = 47
title = ''

distance = 79
spam score = 45
title = ''

distance = 82
spam score = 38
title = ''

distance = 83
spam score = 46
title = ''

distance = 117
spam score = 47
title = ''

distance = 149
spam score = 45
title = ''

distance = 157
spam score = 51
title = ''

distance = 167
spam score = 47
title = ''

distance = 180
spam score = 54
title = ''

distance = 182
spam score = 49
title = ''

distance = 217
spam score = 63
title = ''

distance = 24
spam score = 39
title = ''

distance = 52
spam score = 36
title = ''

distance = 134
spam score = 39
title = ''

distance = 238
spam score = 39
title = ''

distance = 17
spam score = 36
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 37
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 37
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 36
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 37
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 36
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 17
spam score = 34
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 35
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 34
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 40
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 36
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 21
spam score = 34
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 37
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 35
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 41
spam score = 36
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 45
spam score = 34
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 45
spam score = 34
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 52
spam score = 47
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 52
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 53
spam score = 45
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 53
spam score = 44
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 53
spam score = 46
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 55
spam score = 49
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 55
spam score = 49
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 35
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 32
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 35
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 35
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 35
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 34
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 32
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 68
spam score = 34
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 70
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 70
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 70
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 70
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 70
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 70
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 70
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 70
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 70
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 73
spam score = 35
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 91
spam score = 49
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 93
spam score = 35
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 95
spam score = 37
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 98
spam score = 44
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 98
spam score = 48
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 102
spam score = 37
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 103
spam score = 45
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 103
spam score = 45
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 103
spam score = 37
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 105
spam score = 36
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 139
spam score = 36
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 139
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 139
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 141
spam score = 37
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 141
spam score = 37
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 143
spam score = 48
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 146
spam score = 34
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 146
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 146
spam score = 40
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 146
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 163
spam score = 36
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 166
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 171
spam score = 46
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 174
spam score = 36
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 176
spam score = 46
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 177
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 178
spam score = 38
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 178
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 178
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 178
spam score = 39
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 294
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 294
spam score = 33
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 296
spam score = 52
title = 'department of statistics of lithuania mdash statistical yearbook of lithuania 2005'

distance = 1519
spam score = 91
title = 'chinadataeconomicybk90'

distance = 1525
spam score = 79
title = 'chinadataeconomicybk90'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 56
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 56
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 56
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 56
title = 'drjack registration system'

distance = 6
spam score = 56
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 53
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 54
title = 'drjack registration system'

distance = 6
spam score = 55
title = 'drjack registration system'

distance = 6
spam score = 53
title = 'drjack registration system'

distance = 9
spam score = 59
title = 'drjack registration system'

distance = 9
spam score = 59
title = 'drjack registration system'

distance = 9
spam score = 61
title = 'drjack registration system'

distance = 9
spam score = 59
title = 'drjack registration system'

distance = 9
spam score = 59
title = 'drjack registration system'

distance = 9
spam score = 59
title = 'drjack registration system'

distance = 9
spam score = 59
title = 'drjack registration system'

distance = 9
spam score = 59
title = 'drjack registration system'

distance = 9
spam score = 59
title = 'drjack registration system'

distance = 9
spam score = 59
title = 'drjack registration system'

distance = 10
spam score = 59
title = 'drjack registration system'

distance = 10
spam score = 59
title = 'drjack registration system'

distance = 10
spam score = 59
title = 'drjack registration system'

distance = 10
spam score = 59
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 59
title = 'drjack registration system'

distance = 10
spam score = 59
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 59
title = 'drjack registration system'

distance = 10
spam score = 59
title = 'drjack registration system'

distance = 10
spam score = 57
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 10
spam score = 58
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 54
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 56
title = 'drjack registration system'

distance = 12
spam score = 56
title = 'drjack registration system'

distance = 12
spam score = 56
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 59
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 54
title = 'drjack registration system'

distance = 12
spam score = 54
title = 'drjack registration system'

distance = 12
spam score = 54
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 54
title = 'drjack registration system'

distance = 12
spam score = 54
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 55
title = 'drjack registration system'

distance = 12
spam score = 54
title = 'drjack registration system'

distance = 12
spam score = 54
title = 'drjack registration system'

distance = 1722
spam score = 22
title = '24 7x03 amp 7x04 350mb hdtvestrenosubtulado archivo free descargas'

distance = 1732
spam score = 16
title = '24 t3 dvdripdual490mb2424rsmg archivo free descargas'

distance = 1754
spam score = 3
title = 'photoshop topsectret 5 to 5 los mejor secretos archivo denunciando'

distance = 1803
spam score = 8
title = 'qualche foto archivio il termitano forum'

distance = 1834
spam score = 13
title = 'planit fusion 132 crack find and free download'

distance = 3
spam score = 90
title = 'africa view g6a base page 2'

distance = 3
spam score = 91
title = 'africa view g6c base page 8'

distance = 3
spam score = 90
title = 'africa view g9a base page 5'

distance = 3
spam score = 93
title = 'africa view h5d base page 9'

distance = 3
spam score = 90
title = 'africa view h11c base page 7'

distance = 3
spam score = 93
title = 'africa view h6a base page 1'

distance = 3
spam score = 91
title = 'africa view h5c base page 8'

distance = 3
spam score = 90
title = 'africa view h7c base page 7'

distance = 3
spam score = 90
title = 'africa view h9a base page 7'

distance = 3
spam score = 93
title = 'africa view h9c base page 8'

distance = 3
spam score = 92
title = 'africa view h9d base page 7'

distance = 3
spam score = 92
title = 'africa view j5d base page 9'

distance = 3
spam score = 92
title = 'africa view j6c base page 7'

distance = 3
spam score = 92
title = 'africa view k5b base page 3'

distance = 3
spam score = 90
title = 'africa view l4b base page 3'

distance = 5
spam score = 91
title = 'africa view l6b base page 4'

distance = 5
spam score = 89
title = 'africa view l4a base page 1'

distance = 5
spam score = 90
title = 'africa view k4c base page 7'

distance = 5
spam score = 89
title = 'africa view g9a base page 7'

distance = 5
spam score = 90
title = 'africa view j5b base page 3'

distance = 11
spam score = 91
title = 'africa view i10b base page 6'

distance = 11
spam score = 91
title = 'africa view i10a base page 1'

distance = 11
spam score = 90
title = 'africa view i9b base page 6'

distance = 11
spam score = 90
title = 'africa view i9c base page 6'

distance = 11
spam score = 92
title = 'africa view j6a base page 7'

distance = 11
spam score = 93
title = 'africa view h8c base page 8'

distance = 11
spam score = 92
title = 'africa view k8d base page 9'

distance = 11
spam score = 90
title = 'africa view j6a base page 1'

distance = 11
spam score = 91
title = 'africa view l5b base page 9'

distance = 12
spam score = 91
title = 'africa view h6a base page 2'

distance = 14
spam score = 93
title = 'africa view j9a base page 8'

distance = 14
spam score = 92
title = 'africa view i11b base page 1'

distance = 14
spam score = 91
title = 'africa view h2d base page 9'

distance = 14
spam score = 90
title = 'africa view i5a base page 2'

distance = 14
spam score = 91
title = 'africa view h6d base page 9'

distance = 14
spam score = 91
title = 'africa view l2b base page 6'

distance = 14
spam score = 93
title = 'africa view i7a base page 8'

distance = 15
spam score = 90
title = 'africa view h4c base page 8'

distance = 16
spam score = 93
title = 'africa view k9a base page 3'

distance = 16
spam score = 91
title = 'africa view l6c base page 2'

distance = 18
spam score = 89
title = 'africa view i9a base page 7'

distance = 18
spam score = 90
title = 'africa view i9b base page 4'

distance = 18
spam score = 91
title = 'africa view i9b base page 2'

distance = 18
spam score = 91
title = 'africa view k5c base page 7'

distance = 18
spam score = 91
title = 'africa view l3b base page 6'

distance = 18
spam score = 92
title = 'africa view l6a base page 3'

distance = 18
spam score = 91
title = 'africa view l6a base page 5'

distance = 18
spam score = 89
title = 'africa view g9c base page 8'

distance = 18
spam score = 90
title = 'africa view i9b base page 8'

distance = 18
spam score = 90
title = 'africa view j8b base page 9'

distance = 22
spam score = 90
title = 'africa view j9a base page 4'

distance = 22
spam score = 89
title = 'africa view h9a base page 2'

distance = 23
spam score = 92
title = 'africa view l5d base page 6'

distance = 24
spam score = 90
title = 'africa view i6a base page 6'

distance = 24
spam score = 91
title = 'africa view l3b base page 3'

distance = 24
spam score = 89
title = 'africa view i7a base page 7'

distance = 24
spam score = 91
title = 'africa view i6a base page 8'

distance = 25
spam score = 92
title = 'africa view k6a base page 1'

distance = 25
spam score = 89
title = 'africa view i11b base page 3'

distance = 25
spam score = 90
title = 'africa view k9a base page 1'

distance = 36
spam score = 93
title = 'africa view j8d base page 9'

distance = 36
spam score = 90
title = 'africa view i8b base page 9'

distance = 37
spam score = 90
title = 'africa view i4b base page 9'

distance = 38
spam score = 91
title = 'africa view i4b base page 6'

distance = 38
spam score = 92
title = 'africa view h8c base page 7'

distance = 38
spam score = 92
title = 'africa view h8b base page 3'

distance = 38
spam score = 92
title = 'africa view l4a base page 4'

distance = 38
spam score = 93
title = 'africa view l5b base page 3'

distance = 38
spam score = 92
title = 'africa view f9c base page 7'

distance = 38
spam score = 92
title = 'africa view g9a base page 1'

distance = 52
spam score = 92
title = 'africa view i9c base page 4'

distance = 55
spam score = 93
title = 'africa view k9a base page 2'

distance = 56
spam score = 92
title = 'africa view i8a base page 1'

distance = 59
spam score = 92
title = 'africa view i6a base page 4'

distance = 59
spam score = 92
title = 'africa view i7b base page 3'

distance = 73
spam score = 92
title = 'africa view i6c base page 1'

distance = 266
spam score = 91
title = 'africa view h9 base page 8'

distance = 266
spam score = 88
title = 'africa view h6 base page 8'

distance = 266
spam score = 90
title = 'africa view h6 base page 9'

distance = 269
spam score = 86
title = 'africa view f8 base page 9'

distance = 275
spam score = 90
title = 'africa view i4 base page 1'

distance = 275
spam score = 91
title = 'africa view j11 base page 1'

distance = 276
spam score = 91
title = 'africa view l5 base page 1'

distance = 276
spam score = 90
title = 'africa view g10 base page 1'

distance = 276
spam score = 90
title = 'africa view i9 base page 1'

distance = 276
spam score = 88
title = 'africa view h5 base page 1'

distance = 276
spam score = 89
title = 'africa view h12 base page 1'

distance = 277
spam score = 91
title = 'africa view l8 base page 1'

distance = 277
spam score = 91
title = 'africa view i5 base page 3'

distance = 278
spam score = 91
title = 'africa view g12 base page 1'

distance = 283
spam score = 91
title = 'africa view h7 base page 1'

distance = 283
spam score = 91
title = 'africa view l4 base page 1'

distance = 283
spam score = 91
title = 'africa view i5 base page 1'

distance = 284
spam score = 90
title = 'africa view g3 base page 1'

distance = 286
spam score = 91
title = 'africa view l12 base page 1'

distance = 286
spam score = 91
title = 'africa view l11 base page 1'

distance = 286
spam score = 91
title = 'africa view i10 base page 1'

distance = 287
spam score = 91
title = 'africa view i6 base page 2'

distance = 287
spam score = 91
title = 'africa view k8 base page 1'

distance = 292
spam score = 91
title = 'africa view j9 base page 1'

distance = 309
spam score = 91
title = 'africa view i12 base page 1'

distance = 311
spam score = 89
title = 'africa view g4 base page 1'

distance = 321
spam score = 97
title = 'africa view mali base page 1'

distance = 323
spam score = 90
title = 'africa view j8 base page 1'

distance = 339
spam score = 98
title = 'africa view indxad1 base page 1'

distance = 1777
spam score = 51
title = 'sypha mirandas new vertigo xg graphics processor supports hdsd simulcasting'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 41
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 42
title = 'realtime ae index daily plot'

distance = 102
spam score = 42
title = 'realtime ae index daily plot'

distance = 102
spam score = 41
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 42
title = 'realtime ae index daily plot'

distance = 102
spam score = 42
title = 'realtime ae index daily plot'

distance = 102
spam score = 41
title = 'realtime ae index daily plot'

distance = 102
spam score = 39
title = 'realtime ae index daily plot'

distance = 102
spam score = 40
title = 'realtime ae index daily plot'

distance = 102
spam score = 44
title = 'realtime ae index daily plot'

distance = 102
spam score = 44
title = 'realtime ae index daily plot'

distance = 102
spam score = 42
title = 'realtime ae index daily plot'

distance = 102
spam score = 38
title = 'realtime ae index daily plot'

distance = 102
spam score = 44
title = 'realtime ae index daily plot'

distance = 102
spam score = 45
title = 'realtime ae index daily plot'

distance = 102
spam score = 44
title = 'realtime ae index daily plot'

distance = 102
spam score = 44
title = 'realtime ae index daily plot'

distance = 102
spam score = 38
title = 'realtime ae index daily plot'

distance = 102
spam score = 38
title = 'realtime ae index daily plot'

distance = 105
spam score = 40
title = 'realtime ae index daily plot'

distance = 106
spam score = 39
title = 'realtime ae index daily plot'

distance = 107
spam score = 37
title = 'realtime ae index daily plot'

distance = 107
spam score = 44
title = 'realtime ae index daily plot'

distance = 107
spam score = 41
title = 'realtime ae index daily plot'

distance = 107
spam score = 38
title = 'realtime ae index daily plot'

distance = 107
spam score = 39
title = 'realtime ae index daily plot'

distance = 107
spam score = 40
title = 'realtime ae index daily plot'

distance = 108
spam score = 40
title = 'realtime ae index daily plot'

distance = 108
spam score = 40
title = 'realtime ae index daily plot'

distance = 112
spam score = 37
title = 'realtime ae index daily plot'

distance = 112
spam score = 40
title = 'realtime ae index daily plot'

distance = 112
spam score = 40
title = 'realtime ae index daily plot'

distance = 112
spam score = 43
title = 'realtime ae index daily plot'

distance = 112
spam score = 39
title = 'realtime ae index daily plot'

distance = 112
spam score = 37
title = 'realtime ae index daily plot'

distance = 112
spam score = 37
title = 'realtime ae index daily plot'

distance = 112
spam score = 40
title = 'realtime ae index daily plot'

distance = 112
spam score = 37
title = 'realtime ae index daily plot'

distance = 112
spam score = 45
title = 'realtime ae index daily plot'

distance = 119
spam score = 38
title = 'realtime ae index daily plot'

distance = 119
spam score = 45
title = 'realtime ae index daily plot'

distance = 119
spam score = 37
title = 'realtime ae index daily plot'

distance = 119
spam score = 39
title = 'realtime ae index daily plot'

distance = 119
spam score = 40
title = 'realtime ae index daily plot'

distance = 119
spam score = 44
title = 'realtime ae index daily plot'

distance = 120
spam score = 41
title = 'realtime ae index daily plot'

distance = 120
spam score = 42
title = 'realtime ae index daily plot'

distance = 120
spam score = 45
title = 'realtime ae index daily plot'

distance = 121
spam score = 44
title = 'realtime ae index daily plot'

distance = 123
spam score = 39
title = 'realtime ae index daily plot'

distance = 123
spam score = 39
title = 'realtime ae index daily plot'

distance = 123
spam score = 38
title = 'realtime ae index daily plot'

distance = 123
spam score = 39
title = 'realtime ae index daily plot'

distance = 123
spam score = 38
title = 'realtime ae index daily plot'

distance = 123
spam score = 37
title = 'realtime ae index daily plot'

distance = 123
spam score = 38
title = 'realtime ae index daily plot'

distance = 123
spam score = 37
title = 'realtime ae index daily plot'

distance = 123
spam score = 37
title = 'realtime ae index daily plot'

distance = 123
spam score = 38
title = 'realtime ae index daily plot'

distance = 131
spam score = 38
title = 'realtime ae index daily plot'

distance = 131
spam score = 38
title = 'realtime ae index daily plot'

distance = 131
spam score = 38
title = 'realtime ae index daily plot'

distance = 131
spam score = 38
title = 'realtime ae index daily plot'

distance = 131
spam score = 40
title = 'realtime ae index daily plot'

distance = 131
spam score = 38
title = 'realtime ae index daily plot'

distance = 131
spam score = 38
title = 'realtime ae index daily plot'

distance = 131
spam score = 38
title = 'realtime ae index daily plot'

distance = 131
spam score = 38
title = 'realtime ae index daily plot'

distance = 131
spam score = 39
title = 'realtime ae index daily plot'

distance = 139
spam score = 38
title = 'realtime ae index daily plot'

distance = 139
spam score = 39
title = 'realtime ae index daily plot'

distance = 139
spam score = 39
title = 'realtime ae index daily plot'

distance = 139
spam score = 37
title = 'realtime ae index daily plot'

distance = 139
spam score = 38
title = 'realtime ae index daily plot'

distance = 140
spam score = 41
title = 'realtime ae index daily plot'

distance = 141
spam score = 39
title = 'realtime ae index daily plot'

distance = 142
spam score = 38
title = 'realtime ae index daily plot'

distance = 143
spam score = 39
title = 'realtime ae index daily plot'

distance = 143
spam score = 39
title = 'realtime ae index daily plot'

distance = 197
spam score = 39
title = 'realtime ae index daily plot'

distance = 197
spam score = 41
title = 'realtime ae index daily plot'

distance = 199
spam score = 41
title = 'realtime ae index daily plot'

distance = 200
spam score = 38
title = 'realtime ae index daily plot'

distance = 200
spam score = 39
title = 'realtime ae index daily plot'

distance = 201
spam score = 37
title = 'realtime ae index daily plot'

distance = 202
spam score = 55
title = 'realtime ae index daily plot'

distance = 202
spam score = 41
title = 'realtime ae index daily plot'

distance = 202
spam score = 38
title = 'realtime ae index daily plot'

distance = 205
spam score = 37
title = 'realtime ae index daily plot'

distance = 374
spam score = 37
title = 'realtime ae index daily plot'

distance = 379
spam score = 40
title = 'realtime ae index daily plot'

distance = 379
spam score = 47
title = 'realtime ae index daily plot'

distance = 384
spam score = 39
title = 'realtime ae index daily plot'

distance = 1616
spam score = 84
title = 'wdc kyoto for geomagnetism whats new'

distance = 1673
spam score = 14
title = 'econstats euronext amsterdam aex general weekly index and correlations with sp500 stock markets'

distance = 1752
spam score = 59
title = 'magnetometer stations and data'

distance = 1773
spam score = 61
title = 'transauroral short wave communications'

distance = 48
spam score = 65
title = ''

distance = 48
spam score = 61
title = ''

distance = 48
spam score = 62
title = ''

distance = 49
spam score = 63
title = ''

distance = 54
spam score = 58
title = ''

distance = 128
spam score = 52
title = ''

distance = 144
spam score = 45
title = ''

distance = 171
spam score = 69
title = ''

distance = 173
spam score = 74
title = ''

distance = 194
spam score = 53
title = ''

distance = 196
spam score = 69
title = ''

distance = 196
spam score = 67
title = ''

distance = 196
spam score = 56
title = ''

distance = 197
spam score = 59
title = ''

distance = 198
spam score = 77
title = ''

distance = 201
spam score = 47
title = ''

distance = 202
spam score = 74
title = ''

distance = 207
spam score = 68
title = ''

distance = 222
spam score = 47
title = ''

distance = 228
spam score = 72
title = ''

distance = 288
spam score = 76
title = ''

distance = 300
spam score = 40
title = ''

distance = 354
spam score = 31
title = ''

distance = 527
spam score = 43
title = ''

distance = 113
spam score = 29
title = 'dhaka meteorological elements 2006 may 05 125'

distance = 113
spam score = 27
title = 'dhaka meteorological elements 2006 may 30 150'

distance = 113
spam score = 26
title = 'dhaka meteorological elements 2007 may 17 137'

distance = 113
spam score = 26
title = 'dhaka meteorological elements 2006 may 27 147'

distance = 113
spam score = 29
title = 'dhaka meteorological elements 2006 may 22 142'

distance = 113
spam score = 27
title = 'dhaka meteorological elements 2006 may 21 141'

distance = 113
spam score = 27
title = 'dhaka meteorological elements 2006 may 19 139'

distance = 113
spam score = 26
title = 'dhaka meteorological elements 2007 may 20 140'

distance = 113
spam score = 27
title = 'dhaka meteorological elements 2006 may 13 133'

distance = 113
spam score = 28
title = 'dhaka meteorological elements 2006 may 04 124'

distance = 113
spam score = 29
title = 'dhaka meteorological elements 2004 may 02 123'

distance = 113
spam score = 27
title = 'dhaka meteorological elements 2007 may 18 138'

distance = 113
spam score = 27
title = 'dhaka meteorological elements 2007 may 26 146'

distance = 113
spam score = 28
title = 'dhaka meteorological elements 2008 may 08 129'

distance = 114
spam score = 28
title = 'dhaka meteorological elements 2005 may 05 125'

distance = 115
spam score = 29
title = 'dhaka meteorological elements 2004 may 27 148'

distance = 115
spam score = 29
title = 'dhaka meteorological elements 2006 may 10 130'

distance = 115
spam score = 30
title = 'dhaka meteorological elements 2004 may 05 126'

distance = 115
spam score = 30
title = 'dhaka meteorological elements 2004 150 may 29'

distance = 115
spam score = 29
title = 'dhaka meteorological elements 2004 151 may 30'

distance = 154
spam score = 30
title = 'dhaka meteorological elements 2008 jan 23 023'

distance = 154
spam score = 26
title = 'dhaka meteorological elements 2004 nov 06 311'

distance = 154
spam score = 31
title = 'dhaka meteorological elements 2008 jan 29 029'

distance = 154
spam score = 30
title = 'dhaka meteorological elements 2008 nov 16 321'

distance = 154
spam score = 31
title = 'dhaka meteorological elements 2008 nov 11 316'

distance = 154
spam score = 31
title = 'dhaka meteorological elements 2008 nov 08 313'

distance = 154
spam score = 32
title = 'dhaka meteorological elements 2009 jan 14 014'

distance = 154
spam score = 31
title = 'dhaka meteorological elements 2008 nov 02 307'

distance = 154
spam score = 27
title = 'dhaka meteorological elements 2008 nov 19 324'

distance = 154
spam score = 30
title = 'dhaka meteorological elements 2007 jan 16 016'

distance = 157
spam score = 29
title = 'dhaka meteorological elements 2004 oct 08 282'

distance = 157
spam score = 29
title = 'dhaka meteorological elements 2005 oct 07 280'

distance = 157
spam score = 29
title = 'dhaka meteorological elements 2008 oct 20 294'

distance = 157
spam score = 31
title = 'dhaka meteorological elements 2004 oct 11 285'

distance = 157
spam score = 27
title = 'dhaka meteorological elements 2008 oct 26 300'

distance = 157
spam score = 27
title = 'dhaka meteorological elements 2008 oct 17 291'

distance = 157
spam score = 28
title = 'dhaka meteorological elements 2004 oct 17 291'

distance = 157
spam score = 28
title = 'dhaka meteorological elements 2008 oct 12 286'

distance = 157
spam score = 29
title = 'dhaka meteorological elements 2008 oct 09 283'

distance = 157
spam score = 28
title = 'dhaka meteorological elements 2005 oct 24 297'

distance = 160
spam score = 26
title = 'dhaka meteorological elements 2005 mar 30 089'

distance = 161
spam score = 29
title = 'dhaka meteorological elements 2006 jul 16 197'

distance = 161
spam score = 28
title = 'dhaka meteorological elements 2005 jul 18 199'

distance = 161
spam score = 26
title = 'dhaka meteorological elements 2005 oct 26 299'

distance = 161
spam score = 26
title = 'dhaka meteorological elements 2005 oct 17 290'

distance = 161
spam score = 26
title = 'dhaka meteorological elements 2008 oct 05 279'

distance = 161
spam score = 27
title = 'dhaka meteorological elements 2008 oct 28 302'

distance = 161
spam score = 29
title = 'dhaka meteorological elements 2006 jul 25 206'

distance = 161
spam score = 26
title = 'dhaka meteorological elements 2008 oct 19 293'

distance = 161
spam score = 30
title = 'dhaka meteorological elements 2006 jul 11 192'

distance = 164
spam score = 25
title = 'dhaka meteorological elements 2004 sep 03 247'

distance = 164
spam score = 28
title = 'dhaka meteorological elements 2006 jul 04 185'

distance = 164
spam score = 28
title = 'dhaka meteorological elements 2005 jul 05 186'

distance = 164
spam score = 27
title = 'dhaka meteorological elements 2005 jul 19 200'

distance = 164
spam score = 27
title = 'dhaka meteorological elements 2006 jul 18 199'

distance = 164
spam score = 28
title = 'dhaka meteorological elements 2006 jul 21 202'

distance = 164
spam score = 26
title = 'dhaka meteorological elements 2007 sep 25 268'

distance = 164
spam score = 27
title = 'dhaka meteorological elements 2007 sep 17 260'

distance = 164
spam score = 27
title = 'dhaka meteorological elements 2007 sep 03 246'

distance = 164
spam score = 26
title = 'dhaka meteorological elements 2008 sep 24 268'

distance = 169
spam score = 28
title = 'dhaka meteorological elements 2004 mar 22 082'

distance = 169
spam score = 28
title = 'dhaka meteorological elements 2005 aug 22 234'

distance = 169
spam score = 27
title = 'dhaka meteorological elements 2004 aug 14 227'

distance = 169
spam score = 27
title = 'dhaka meteorological elements 2004 aug 23 236'

distance = 169
spam score = 25
title = 'dhaka meteorological elements 2008 aug 18 231'

distance = 169
spam score = 26
title = 'dhaka meteorological elements 2008 mar 29 089'

distance = 169
spam score = 28
title = 'dhaka meteorological elements 2005 aug 13 225'

distance = 169
spam score = 27
title = 'dhaka meteorological elements 2005 aug 05 217'

distance = 169
spam score = 28
title = 'dhaka meteorological elements 2005 mar 04 063'

distance = 169
spam score = 26
title = 'dhaka meteorological elements 2004 aug 06 219'

distance = 174
spam score = 25
title = 'dhaka meteorological elements 2005 mar 26 085'

distance = 174
spam score = 30
title = 'dhaka meteorological elements 2006 mar 14 073'

distance = 174
spam score = 28
title = 'dhaka meteorological elements 2006 mar 08 067'

distance = 174
spam score = 29
title = 'dhaka meteorological elements 2006 mar 05 064'

distance = 175
spam score = 29
title = 'dhaka meteorological elements 2004 jun 16 168'

distance = 175
spam score = 28
title = 'dhaka meteorological elements 2005 jun 26 177'

distance = 175
spam score = 28
title = 'dhaka meteorological elements 2005 jun 06 157'

distance = 175
spam score = 29
title = 'dhaka meteorological elements 2004 jun 08 160'

distance = 175
spam score = 28
title = 'dhaka meteorological elements 2004 jun 07 159'

distance = 175
spam score = 28
title = 'dhaka meteorological elements 2006 jun 14 165'

distance = 188
spam score = 29
title = 'dhaka meteorological elements 2007 jun 27 178'

distance = 188
spam score = 27
title = 'dhaka meteorological elements 2004 jun 14 166'

distance = 188
spam score = 29
title = 'dhaka meteorological elements 2004 jun 17 169'

distance = 188
spam score = 31
title = 'dhaka meteorological elements 2004 jun 12 164'

distance = 188
spam score = 30
title = 'dhaka meteorological elements 2004 jun 03 155'

distance = 188
spam score = 30
title = 'dhaka meteorological elements 2005 jun 07 158'

distance = 188
spam score = 29
title = 'dhaka meteorological elements 2005 jun 16 167'

distance = 188
spam score = 30
title = 'dhaka meteorological elements 2004 jun 20 172'

distance = 188
spam score = 30
title = 'dhaka meteorological elements 2007 jun 14 165'

distance = 188
spam score = 30
title = 'dhaka meteorological elements 2007 jun 19 170'

distance = 353
spam score = 30
title = 'dhaka meteorological elements 2006 apr 15 105'

distance = 354
spam score = 30
title = 'dhaka meteorological elements 2004 jul 12 194'

distance = 354
spam score = 30
title = 'dhaka meteorological elements 2007 jul 06 187'

distance = 354
spam score = 28
title = 'dhaka meteorological elements 2005 jul 20 201'

distance = 354
spam score = 30
title = 'dhaka meteorological elements 2005 jul 08 189'

distance = 354
spam score = 30
title = 'dhaka meteorological elements 2005 jul 03 184'

distance = 354
spam score = 29
title = 'dhaka meteorological elements 2006 jul 24 205'

distance = 357
spam score = 29
title = 'dhaka meteorological elements 2006 mar 23 082'

distance = 357
spam score = 27
title = 'dhaka meteorological elements 2007 mar 19 078'

distance = 357
spam score = 28
title = 'dhaka meteorological elements 2007 mar 27 086'

distance = 738
spam score = 28
title = 'dhaka meteorological elements 2004 june'

distance = 746
spam score = 28
title = 'dhaka meteorological elements 2006 july'

distance = 1303
spam score = 45
title = 'dhaka meteorological elements'

distance = 98
spam score = 42
title = ''

distance = 160
spam score = 46
title = ''

distance = 173
spam score = 42
title = ''

distance = 178
spam score = 44
title = ''

distance = 180
spam score = 46
title = ''

distance = 182
spam score = 43
title = ''

distance = 192
spam score = 41
title = ''

distance = 194
spam score = 42
title = ''

distance = 209
spam score = 37
title = ''

distance = 211
spam score = 46
title = ''

distance = 212
spam score = 44
title = ''

distance = 233
spam score = 42
title = ''

distance = 244
spam score = 40
title = ''

distance = 267
spam score = 35
title = ''

distance = 277
spam score = 35
title = ''

distance = 282
spam score = 40
title = ''

distance = 293
spam score = 36
title = ''

distance = 336
spam score = 43
title = ''

distance = 434
spam score = 39
title = ''

distance = 107
spam score = 58
title = ''

distance = 107
spam score = 65
title = ''

distance = 110
spam score = 69
title = ''

distance = 112
spam score = 64
title = ''

distance = 121
spam score = 68
title = ''

distance = 126
spam score = 65
title = ''

distance = 126
spam score = 62
title = ''

distance = 126
spam score = 57
title = ''

distance = 131
spam score = 67
title = ''

distance = 161
spam score = 66
title = ''

distance = 163
spam score = 59
title = ''

distance = 166
spam score = 66
title = ''

distance = 166
spam score = 66
title = ''

distance = 166
spam score = 68
title = ''

distance = 167
spam score = 67
title = ''

distance = 168
spam score = 55
title = ''

distance = 170
spam score = 57
title = ''

distance = 170
spam score = 68
title = ''

distance = 174
spam score = 68
title = ''

distance = 190
spam score = 56
title = ''

distance = 191
spam score = 62
title = ''

distance = 192
spam score = 66
title = ''

distance = 197
spam score = 52
title = ''

distance = 202
spam score = 46
title = ''

distance = 204
spam score = 70
title = ''

distance = 216
spam score = 73
title = ''

distance = 218
spam score = 66
title = ''

distance = 223
spam score = 50
title = ''

distance = 231
spam score = 64
title = ''

distance = 232
spam score = 66
title = ''

distance = 233
spam score = 67
title = ''

distance = 234
spam score = 66
title = ''

distance = 235
spam score = 45
title = ''

distance = 235
spam score = 44
title = ''

distance = 235
spam score = 65
title = ''

distance = 236
spam score = 66
title = ''

distance = 241
spam score = 70
title = ''

distance = 246
spam score = 51
title = ''

distance = 257
spam score = 68
title = ''

distance = 258
spam score = 68
title = ''

distance = 259
spam score = 67
title = ''

distance = 273
spam score = 44
title = ''

distance = 293
spam score = 71
title = ''

distance = 296
spam score = 62
title = ''

distance = 307
spam score = 66
title = ''

distance = 311
spam score = 58
title = ''

distance = 311
spam score = 65
title = ''

distance = 325
spam score = 52
title = ''

distance = 326
spam score = 64
title = ''

distance = 327
spam score = 68
title = ''

distance = 327
spam score = 69
title = ''

distance = 327
spam score = 56
title = ''

distance = 330
spam score = 64
title = ''

distance = 331
spam score = 59
title = ''

distance = 332
spam score = 53
title = ''

distance = 334
spam score = 54
title = ''

distance = 335
spam score = 53
title = ''

distance = 367
spam score = 48
title = ''

distance = 375
spam score = 64
title = ''

distance = 392
spam score = 49
title = ''

distance = 425
spam score = 48
title = ''

distance = 444
spam score = 58
title = ''

distance = 445
spam score = 51
title = ''

distance = 74
spam score = 66
title = ''

distance = 74
spam score = 66
title = ''

distance = 76
spam score = 68
title = ''

distance = 76
spam score = 68
title = ''

distance = 83
spam score = 72
title = ''

distance = 84
spam score = 70
title = ''

distance = 84
spam score = 70
title = ''

distance = 88
spam score = 70
title = ''

distance = 94
spam score = 66
title = ''

distance = 98
spam score = 70
title = ''

distance = 102
spam score = 68
title = ''

distance = 102
spam score = 71
title = ''

distance = 118
spam score = 75
title = ''

distance = 121
spam score = 69
title = ''

distance = 124
spam score = 71
title = ''

distance = 125
spam score = 68
title = ''

distance = 131
spam score = 71
title = ''

distance = 132
spam score = 69
title = ''

distance = 133
spam score = 75
title = ''

distance = 135
spam score = 74
title = ''

distance = 140
spam score = 69
title = ''

distance = 145
spam score = 63
title = ''

distance = 179
spam score = 75
title = ''

distance = 183
spam score = 81
title = ''

distance = 223
spam score = 72
title = ''

distance = 228
spam score = 65
title = ''

distance = 236
spam score = 77
title = ''

distance = 256
spam score = 83
title = ''

distance = 277
spam score = 70
title = ''

distance = 284
spam score = 93
title = ''

distance = 297
spam score = 79
title = ''

distance = 299
spam score = 68
title = ''

distance = 306
spam score = 66
title = ''

distance = 372
spam score = 80
title = ''

distance = 374
spam score = 76
title = ''

distance = 389
spam score = 78
title = ''

distance = 450
spam score = 72
title = ''

distance = 605
spam score = 80
title = ''

distance = 670
spam score = 89
title = ''

distance = 745
spam score = 76
title = ''

distance = 75
spam score = 49
title = ''

distance = 76
spam score = 41
title = ''

distance = 81
spam score = 48
title = ''

distance = 94
spam score = 55
title = ''

distance = 99
spam score = 53
title = ''

distance = 100
spam score = 45
title = ''

distance = 106
spam score = 48
title = ''

distance = 116
spam score = 46
title = ''

distance = 121
spam score = 48
title = ''

distance = 124
spam score = 54
title = ''

distance = 125
spam score = 57
title = ''

distance = 129
spam score = 49
title = ''

distance = 129
spam score = 63
title = ''

distance = 130
spam score = 42
title = ''

distance = 130
spam score = 42
title = ''

distance = 133
spam score = 44
title = ''

distance = 133
spam score = 51
title = ''

distance = 137
spam score = 42
title = ''

distance = 142
spam score = 51
title = ''

distance = 142
spam score = 44
title = ''

distance = 142
spam score = 43
title = ''

distance = 145
spam score = 53
title = ''

distance = 146
spam score = 41
title = ''

distance = 148
spam score = 39
title = ''

distance = 149
spam score = 57
title = ''

distance = 150
spam score = 45
title = ''

distance = 153
spam score = 54
title = ''

distance = 153
spam score = 48
title = ''

distance = 153
spam score = 45
title = ''

distance = 155
spam score = 57
title = ''

distance = 156
spam score = 48
title = ''

distance = 161
spam score = 44
title = ''

distance = 161
spam score = 37
title = ''

distance = 163
spam score = 48
title = ''

distance = 163
spam score = 37
title = ''

distance = 163
spam score = 46
title = ''

distance = 168
spam score = 63
title = ''

distance = 171
spam score = 56
title = ''

distance = 171
spam score = 47
title = ''

distance = 172
spam score = 47
title = ''

distance = 175
spam score = 52
title = ''

distance = 175
spam score = 48
title = ''

distance = 178
spam score = 52
title = ''

distance = 180
spam score = 65
title = ''

distance = 184
spam score = 44
title = ''

distance = 186
spam score = 46
title = ''

distance = 191
spam score = 51
title = ''

distance = 191
spam score = 58
title = ''

distance = 193
spam score = 36
title = ''

distance = 197
spam score = 49
title = ''

distance = 199
spam score = 64
title = ''

distance = 199
spam score = 59
title = ''

distance = 205
spam score = 44
title = ''

distance = 207
spam score = 49
title = ''

distance = 208
spam score = 52
title = ''

distance = 211
spam score = 52
title = ''

distance = 211
spam score = 55
title = ''

distance = 213
spam score = 55
title = ''

distance = 213
spam score = 54
title = ''

distance = 220
spam score = 53
title = ''

distance = 221
spam score = 60
title = ''

distance = 224
spam score = 54
title = ''

distance = 225
spam score = 41
title = ''

distance = 226
spam score = 44
title = ''

distance = 227
spam score = 41
title = ''

distance = 229
spam score = 55
title = ''

distance = 230
spam score = 47
title = ''

distance = 231
spam score = 47
title = ''

distance = 233
spam score = 50
title = ''

distance = 235
spam score = 45
title = ''

distance = 235
spam score = 55
title = ''

distance = 237
spam score = 53
title = ''

distance = 243
spam score = 50
title = ''

distance = 243
spam score = 43
title = ''

distance = 244
spam score = 45
title = ''

distance = 246
spam score = 41
title = ''

distance = 247
spam score = 50
title = ''

distance = 247
spam score = 61
title = ''

distance = 248
spam score = 44
title = ''

distance = 248
spam score = 61
title = ''

distance = 252
spam score = 45
title = ''

distance = 256
spam score = 46
title = ''

distance = 258
spam score = 66
title = ''

distance = 269
spam score = 49
title = ''

distance = 270
spam score = 41
title = ''

distance = 273
spam score = 53
title = ''

distance = 284
spam score = 42
title = ''

distance = 286
spam score = 56
title = ''

distance = 288
spam score = 63
title = ''

distance = 294
spam score = 49
title = ''

distance = 299
spam score = 49
title = ''

distance = 303
spam score = 44
title = ''

distance = 311
spam score = 47
title = ''

distance = 344
spam score = 41
title = ''

distance = 358
spam score = 49
title = ''

distance = 362
spam score = 42
title = ''

distance = 409
spam score = 45
title = ''

distance = 1838
spam score = 26
title = ''

distance = 17
spam score = 53
title = ''

distance = 20
spam score = 49
title = ''

distance = 23
spam score = 49
title = ''

distance = 25
spam score = 49
title = ''

distance = 38
spam score = 49
title = ''

distance = 38
spam score = 48
title = ''

distance = 39
spam score = 47
title = ''

distance = 41
spam score = 44
title = ''

distance = 46
spam score = 52
title = ''

distance = 46
spam score = 44
title = ''

distance = 47
spam score = 46
title = ''

distance = 47
spam score = 49
title = ''

distance = 47
spam score = 51
title = ''

distance = 48
spam score = 50
title = ''

distance = 49
spam score = 47
title = ''

distance = 49
spam score = 50
title = ''

distance = 49
spam score = 54
title = ''

distance = 50
spam score = 51
title = ''

distance = 51
spam score = 50
title = ''

distance = 52
spam score = 48
title = ''

distance = 52
spam score = 65
title = ''

distance = 53
spam score = 49
title = ''

distance = 53
spam score = 47
title = ''

distance = 54
spam score = 49
title = ''

distance = 54
spam score = 50
title = ''

distance = 55
spam score = 46
title = ''

distance = 61
spam score = 47
title = ''

distance = 63
spam score = 52
title = ''

distance = 65
spam score = 44
title = ''

distance = 65
spam score = 42
title = ''

distance = 69
spam score = 40
title = ''

distance = 71
spam score = 51
title = ''

distance = 71
spam score = 43
title = ''

distance = 77
spam score = 40
title = ''

distance = 81
spam score = 43
title = ''

distance = 84
spam score = 44
title = ''

distance = 87
spam score = 46
title = ''

distance = 93
spam score = 42
title = ''

distance = 166
spam score = 48
title = ''

distance = 1778
spam score = 73
title = ''

distance = 141
spam score = 26
title = 'kort val dacuteisre hoteller val dacuteisre vinter sport vinter reiser'

distance = 175
spam score = 23
title = 'kort la norma hoteller la norma vinter sport vinter reiser'

distance = 177
spam score = 27
title = 'langrenn val dacuteisre gruppereiser val dacuteisre billig skireise'

distance = 182
spam score = 23
title = 'kort val thorens hoteller val thorens vinter sport vinter reiser'

distance = 190
spam score = 22
title = 'langrenn val cenis gruppereiser val cenis billig skireise'

distance = 192
spam score = 25
title = 'billig skiferie val dacuteisre rimelig skiferie val dacuteisre billig vinterferie rimelig'

distance = 193
spam score = 22
title = 'bilde la plagne foto rsidence plagne lauze sparepris bilde rimelige hoteller'

distance = 197
spam score = 24
title = 'billig skiferie valmeinier rimelig skiferie valmeinier billig vinterferie rimelig'

distance = 204
spam score = 24
title = 'reiser val dacuteisre feriehus val dacuteisre hytte alpinski skireiser'

distance = 206
spam score = 21
title = 'kort chamrousse hoteller chamrousse vinter sport vinter reiser'

distance = 206
spam score = 20
title = 'langrenn valmeinier gruppereiser valmeinier billig skireise'

distance = 208
spam score = 23
title = 'billig skiferie val cenis rimelig skiferie val cenis billig vinterferie rimelig'

distance = 211
spam score = 24
title = 'mat drikke frankrike vintersport frankrike lastminute hotell overnatting'

distance = 213
spam score = 23
title = 'bilde bardonecchia foto residence campo smith bilde rimelige hoteller'

distance = 214
spam score = 25
title = 'bilde valmeinier foto chalets grand panorama bilde rimelige hoteller'

distance = 214
spam score = 26
title = 'bilde la joue du loup foto la crte du berger sparepris bilde rimelige hoteller'

distance = 218
spam score = 22
title = 'kort valmeinier hoteller valmeinier vinter sport vinter reiser'

distance = 218
spam score = 27
title = 'billig skiferie la joue du loup rimelig skiferie la joue du loup billig vinterferie rimelig'

distance = 220
spam score = 26
title = 'langrenn bardonecchia gruppereiser bardonecchia billig skireise'

distance = 221
spam score = 28
title = 'billig skiferie val thorens rimelig skiferie val thorens billig vinterferie rimelig'

distance = 225
spam score = 23
title = 'vr vrmelding les 2 alpes sndybde vrutsikt les 2 alpes skiferie'

distance = 225
spam score = 24
title = 'vr vrmelding val dacuteisre sndybde vrutsikt val dacuteisre skiferie'

distance = 225
spam score = 20
title = 'reiser la joue du loup feriehus la joue du loup hytte alpinski skireiser'

distance = 228
spam score = 24
title = 'skiomrder frankrike skilping frankrike skiferie alpereiser billig skireise'

distance = 229
spam score = 25
title = 'billig skiferie hemsedal rimelig skiferie hemsedal billig vinterferie rimelig'

distance = 229
spam score = 24
title = 'leiligheter bardonecchia skireise bardonecchia leilighet reise'

distance = 229
spam score = 28
title = 'langrenn superdvoluy gruppereiser superdvoluy billig skireise'

distance = 230
spam score = 24
title = 'vr vrmelding chamrousse sndybde vrutsikt chamrousse skiferie'

distance = 230
spam score = 23
title = 'bilde bardonecchia foto best western hotel riv bilde rimelige hoteller'

distance = 232
spam score = 24
title = 'vr vrmelding chamonix sndybde vrutsikt chamonix skiferie'

distance = 235
spam score = 25
title = 'skireiser snbrettreiser skiferie snbrettferie vinterferie'

distance = 236
spam score = 26
title = 'mat drikke sverige vintersport sverige lastminute hotell overnatting'

distance = 236
spam score = 24
title = 'billig skiferie davos rimelig skiferie davos billig vinterferie rimelig'

distance = 237
spam score = 27
title = 'vr vrmelding la norma sndybde vrutsikt la norma skiferie'

distance = 237
spam score = 25
title = 'vr vrmelding re sndybde vrutsikt re skiferie'

distance = 238
spam score = 24
title = 'bilde val dacuteisre foto rsidence la daille bilde rimelige hoteller'

distance = 238
spam score = 26
title = 'ferie re ferie last minute re lastminute alpereiser'

distance = 239
spam score = 24
title = 'vr vrmelding val cenis sndybde vrutsikt val cenis skiferie'

distance = 239
spam score = 25
title = 'vinterferie skiferie skireiser skitur skisport'

distance = 240
spam score = 25
title = 'vr vrmelding s caterina sndybde vrutsikt s caterina skiferie'

distance = 243
spam score = 25
title = 'mat drikke tyskland vintersport tyskland lastminute hotell overnatting'

distance = 246
spam score = 25
title = 'mat drikke italia vintersport italia lastminute hotell overnatting'

distance = 246
spam score = 24
title = 'vr vrmelding valfrjus sndybde vrutsikt valfrjus skiferie'

distance = 248
spam score = 26
title = 'bilde lillehammer foto birkebeineren hotell leiligheter bilde rimelige hoteller'

distance = 248
spam score = 26
title = 'vr vrmelding val thorens sndybde vrutsikt val thorens skiferie'

distance = 248
spam score = 23
title = 'vr vrmelding la plagne sndybde vrutsikt la plagne skiferie'

distance = 249
spam score = 23
title = 'ferie valmeinier ferie last minute valmeinier lastminute alpereiser'

distance = 254
spam score = 34
title = 'mat drikke finland vintersport finland lastminute hotell overnatting'

distance = 255
spam score = 25
title = 'vr vrmelding levi sndybde vrutsikt levi skiferie'

distance = 256
spam score = 21
title = 'vr vrmelding rasen sndybde vrutsikt rasen skiferie'

distance = 259
spam score = 25
title = 'vr vrmelding superdvoluy sndybde vrutsikt superdvoluy skiferie'

distance = 262
spam score = 26
title = 'ferie la norma ferie last minute la norma lastminute alpereiser'

distance = 262
spam score = 28
title = 'skiomrder italia skilping italia skiferie alpereiser billig skireise'

distance = 263
spam score = 23
title = 'ferie val thorens ferie last minute val thorens lastminute alpereiser'

distance = 264
spam score = 32
title = 'mat drikke sveits vintersport sveits lastminute hotell overnatting'

distance = 265
spam score = 32
title = 'chalets de solaise innkvartering chalets val disre'

distance = 266
spam score = 27
title = 'vr vrmelding livigno sndybde vrutsikt livigno skiferie'

distance = 266
spam score = 25
title = 'skiomrder norge skilping norge skiferie alpereiser billig skireise'

distance = 267
spam score = 26
title = 'vr vrmelding hemsedal sndybde vrutsikt hemsedal skiferie'

distance = 268
spam score = 34
title = 'skiomrder finland skilping finland skiferie alpereiser billig skireise'

distance = 268
spam score = 26
title = 'vr vrmelding cervinia sndybde vrutsikt cervinia skiferie'

distance = 269
spam score = 29
title = 'skiomrder sverige skilping sverige skiferie alpereiser billig skireise'

distance = 269
spam score = 26
title = 'vr vrmelding bormio sndybde vrutsikt bormio skiferie'

distance = 272
spam score = 33
title = 'vinterferie norge'

distance = 274
spam score = 25
title = 'ferie davos ferie last minute davos lastminute alpereiser'

distance = 278
spam score = 24
title = 'ferie valfrjus ferie last minute valfrjus lastminute alpereiser'

distance = 281
spam score = 22
title = 'vr vrmelding bardonecchia sndybde vrutsikt bardonecchia skiferie'

distance = 282
spam score = 21
title = 'reiser valmeinier feriehus valmeinier hytte alpinski skireiser'

distance = 283
spam score = 23
title = 'ferie s caterina ferie last minute s caterina lastminute alpereiser'

distance = 287
spam score = 23
title = 'vinterferie skiferie skireiser skitur skisport'

distance = 290
spam score = 23
title = 'ferie bardonecchia ferie last minute bardonecchia lastminute alpereiser'

distance = 296
spam score = 25
title = 'vr vrmelding davos sndybde vrutsikt davos skiferie'

distance = 299
spam score = 26
title = 'hotel mont blanc innkvartering courmayeur italia'

distance = 301
spam score = 32
title = 'vinterferie sveits skiferie berner oberland'

distance = 328
spam score = 27
title = 'bonheur des pistes sparepris innkvartering val cenis frankrike'

distance = 334
spam score = 24
title = 'rsidence plagne lauze innkvartering la plagne leiligheter frankrike'

distance = 334
spam score = 22
title = 'hotel viktoria innkvartering hasliberg meiringenhasliberg'

distance = 336
spam score = 24
title = 'fossheim hytter innkvartering hemsedal'

distance = 356
spam score = 35
title = 'pension hochdlehen innkvartering schnau am knigssee chalet schnau'

distance = 360
spam score = 28
title = 'skiomrde val thorens skilping skihytter val thorens vintersport overnatting'

distance = 365
spam score = 27
title = 'rsidence la turra innkvartering valfrjus leilighet frankrike'

distance = 366
spam score = 25
title = 'reiser hafjell feriehus hafjell hytte alpinski skireiser'

distance = 367
spam score = 24
title = 'chalets darrondaz innkvartering valfrjus chalet frankrike'

distance = 375
spam score = 24
title = 'norlandia trysil hotell hotell trysil innkvartering'

distance = 380
spam score = 27
title = 'hotel binderhusl innkvartering berchtesgaden berchtesgadener land'

distance = 384
spam score = 38
title = 'les chalets de la vanoise sparepris innkvartering la norma leilighet frankrike'

distance = 388
spam score = 32
title = 'vinterferie val cenis val disre'

distance = 389
spam score = 24
title = 'vr vrmelding hasliberg sndybde vrutsikt hasliberg skiferie'

distance = 392
spam score = 42
title = 'vinterferie frankrike skiferie savoyen'

distance = 395
spam score = 27
title = 'les valmonts de vaujany innkvartering leiligheter alpe dhuez'

distance = 399
spam score = 29
title = 'skiutleie snbrettutleie skireiser skiferie'

distance = 401
spam score = 24
title = 'skiomrde hemsedal skilping skihytter hemsedal vintersport overnatting'

distance = 406
spam score = 21
title = 'bakkeplan nendaz ferieleilighet nendaz ferieleiligheter'

distance = 413
spam score = 36
title = 'nermo hotell leiligheter hotell hafjell innkvartering'

distance = 417
spam score = 27
title = 'rsidence plagne lauze sparepris innkvartering la plagne leiligheter frankrike'

distance = 423
spam score = 26
title = 'rsidence le pracondu innkvartering nendaz sveits'

distance = 428
spam score = 25
title = 'bakkeplan hafjell ferieleilighet hafjell ferieleiligheter'

distance = 436
spam score = 20
title = 'skiomrde rasen skilping skihytter rasen vintersport overnatting'

distance = 463
spam score = 29
title = 'skikurser skiundervisning snbrettkurser snbrettundervisning skireiser'

distance = 497
spam score = 25
title = 'rsidence laiguille innkvartering chamonix leiligheter frankrike'

distance = 9
spam score = 97
title = ''

distance = 10
spam score = 97
title = ''

distance = 12
spam score = 98
title = ''

distance = 13
spam score = 97
title = ''

distance = 13
spam score = 98
title = ''

distance = 13
spam score = 97
title = ''

distance = 14
spam score = 97
title = ''

distance = 14
spam score = 97
title = ''

distance = 14
spam score = 97
title = ''

distance = 15
spam score = 97
title = ''

distance = 15
spam score = 97
title = ''

distance = 16
spam score = 97
title = ''

distance = 17
spam score = 97
title = ''

distance = 17
spam score = 97
title = ''

distance = 17
spam score = 97
title = ''

distance = 18
spam score = 97
title = ''

distance = 21
spam score = 97
title = ''

distance = 21
spam score = 97
title = ''

distance = 22
spam score = 97
title = ''

distance = 25
spam score = 97
title = ''

distance = 25
spam score = 98
title = ''

distance = 27
spam score = 97
title = ''

distance = 28
spam score = 97
title = ''

distance = 29
spam score = 97
title = ''

distance = 30
spam score = 97
title = ''

distance = 37
spam score = 97
title = ''

distance = 39
spam score = 97
title = ''

distance = 40
spam score = 97
title = ''

distance = 60
spam score = 97
title = ''

distance = 61
spam score = 97
title = ''

distance = 72
spam score = 97
title = ''

distance = 72
spam score = 98
title = ''

distance = 76
spam score = 97
title = ''

distance = 77
spam score = 98
title = ''

distance = 78
spam score = 97
title = ''

distance = 79
spam score = 97
title = ''

distance = 81
spam score = 97
title = ''

distance = 88
spam score = 97
title = ''

distance = 239
spam score = 98
title = ''

distance = 588
spam score = 98
title = ''

distance = 1440
spam score = 84
title = ''

distance = 1498
spam score = 80
title = ''

distance = 132
spam score = 91
title = ''

distance = 134
spam score = 91
title = ''

distance = 134
spam score = 89
title = ''

distance = 134
spam score = 89
title = ''

distance = 140
spam score = 91
title = ''

distance = 142
spam score = 89
title = ''

distance = 153
spam score = 91
title = ''

distance = 178
spam score = 92
title = ''

distance = 183
spam score = 88
title = ''

distance = 184
spam score = 91
title = ''

distance = 188
spam score = 95
title = ''

distance = 191
spam score = 89
title = ''

distance = 192
spam score = 91
title = ''

distance = 193
spam score = 92
title = ''

distance = 198
spam score = 93
title = ''

distance = 199
spam score = 90
title = ''

distance = 202
spam score = 89
title = ''

distance = 203
spam score = 92
title = ''

distance = 203
spam score = 94
title = ''

distance = 204
spam score = 93
title = ''

distance = 206
spam score = 91
title = ''

distance = 209
spam score = 93
title = ''

distance = 210
spam score = 93
title = ''

distance = 212
spam score = 88
title = ''

distance = 214
spam score = 95
title = ''

distance = 215
spam score = 83
title = ''

distance = 222
spam score = 93
title = ''

distance = 227
spam score = 91
title = ''

distance = 241
spam score = 93
title = ''

distance = 241
spam score = 92
title = ''

distance = 243
spam score = 91
title = ''

distance = 244
spam score = 88
title = ''

distance = 245
spam score = 89
title = ''

distance = 247
spam score = 91
title = ''

distance = 249
spam score = 92
title = ''

distance = 249
spam score = 91
title = ''

distance = 250
spam score = 91
title = ''

distance = 252
spam score = 86
title = ''

distance = 252
spam score = 90
title = ''

distance = 253
spam score = 89
title = ''

distance = 253
spam score = 92
title = ''

distance = 262
spam score = 89
title = ''

distance = 263
spam score = 92
title = ''

distance = 264
spam score = 91
title = ''

distance = 266
spam score = 92
title = ''

distance = 268
spam score = 93
title = ''

distance = 276
spam score = 92
title = ''

distance = 278
spam score = 92
title = ''

distance = 278
spam score = 89
title = ''

distance = 285
spam score = 93
title = ''

distance = 289
spam score = 91
title = ''

distance = 290
spam score = 94
title = ''

distance = 296
spam score = 89
title = ''

distance = 298
spam score = 92
title = ''

distance = 303
spam score = 89
title = ''

distance = 304
spam score = 94
title = ''

distance = 305
spam score = 93
title = ''

distance = 309
spam score = 92
title = ''

distance = 322
spam score = 91
title = ''

distance = 325
spam score = 89
title = ''

distance = 334
spam score = 92
title = ''

distance = 336
spam score = 95
title = ''

distance = 338
spam score = 93
title = ''

distance = 339
spam score = 92
title = ''

distance = 339
spam score = 90
title = ''

distance = 342
spam score = 89
title = ''

distance = 356
spam score = 92
title = ''

distance = 363
spam score = 94
title = ''

distance = 371
spam score = 91
title = ''

distance = 374
spam score = 93
title = ''

distance = 382
spam score = 89
title = ''

distance = 390
spam score = 95
title = ''

distance = 395
spam score = 90
title = ''

distance = 399
spam score = 92
title = ''

distance = 417
spam score = 93
title = ''

distance = 433
spam score = 92
title = ''

distance = 444
spam score = 92
title = ''

distance = 450
spam score = 92
title = ''

distance = 454
spam score = 83
title = ''

distance = 460
spam score = 93
title = ''

distance = 467
spam score = 93
title = ''

distance = 471
spam score = 84
title = ''

distance = 475
spam score = 84
title = ''

distance = 486
spam score = 84
title = ''

distance = 488
spam score = 91
title = ''

distance = 493
spam score = 93
title = ''

distance = 495
spam score = 84
title = ''

distance = 497
spam score = 84
title = ''

distance = 498
spam score = 84
title = ''

distance = 500
spam score = 85
title = ''

distance = 501
spam score = 93
title = ''

distance = 503
spam score = 83
title = ''

distance = 514
spam score = 85
title = ''

distance = 1587
spam score = 37
title = ''

distance = 81
spam score = 58
title = 'used cisco at optimum data used cisco 7603 used 7603 cisco 7603s new 7603'

distance = 82
spam score = 57
title = 'used cisco at optimum data used cisco 7613 used 7613 cisco 7613s new 7613'

distance = 108
spam score = 60
title = 'used cisco at optimum data used cisco 2514 used 2514 cisco 2514s new 2514'

distance = 109
spam score = 60
title = 'used cisco at optimum data used cisco 7609 used 7609 cisco 7609s new 7609'

distance = 139
spam score = 66
title = 'used cisco at optimum data used cisco 831k9 used 831k9 cisco 831k9s new 831k9'

distance = 146
spam score = 64
title = 'used cisco at optimum data used cisco 4700 used 4700 cisco 4700s new 4700'

distance = 148
spam score = 61
title = 'used cisco at optimum data used cisco 10720fan used 10720fan cisco 10720fans new 10720fan'

distance = 151
spam score = 64
title = 'used cisco at optimum data used cisco 7507 used 7507 cisco 7507s new 7507'

distance = 157
spam score = 63
title = 'used cisco at optimum data used cisco 7505 used 7505 cisco 7505s new 7505'

distance = 159
spam score = 63
title = 'used cisco at optimum data used cisco 3620 used 3620 cisco 3620s new 3620'

distance = 163
spam score = 59
title = 'used cisco at optimum data used cisco 4500 used 4500 cisco 4500s new 4500'

distance = 169
spam score = 64
title = 'used cisco at optimum data used cisco 1760 used 1760 cisco 1760s new 1760'

distance = 170
spam score = 62
title = 'used cisco at optimum data used cisco 1721 used 1721 cisco 1721s new 1721'

distance = 172
spam score = 64
title = 'used cisco at optimum data used cisco 75134 used 75134 cisco 75134s new 75134'

distance = 176
spam score = 59
title = 'used cisco at optimum data used cisco 2525 used 2525 cisco 2525s new 2525'

distance = 180
spam score = 63
title = 'used cisco at optimum data used cisco 1720 used 1720 cisco 1720s new 1720'

distance = 182
spam score = 64
title = 'used cisco at optimum data used cisco 2515 used 2515 cisco 2515s new 2515'

distance = 189
spam score = 62
title = 'used cisco at optimum data used cisco 3662 used 3662 cisco 3662s new 3662'

distance = 192
spam score = 64
title = 'used cisco at optimum data used cisco 7206 used 7206 cisco 7206s new 7206'

distance = 194
spam score = 63
title = 'used cisco at optimum data used cisco 2502 used 2502 cisco 2502s new 2502'

distance = 223
spam score = 59
title = 'used cisco at optimum data used cisco wsc4506 used wsc4506 cisco wsc4506s new wsc4506'

distance = 224
spam score = 60
title = 'used cisco at optimum data used cisco 12810csc used 12810csc cisco 12810cscs new 12810csc'

distance = 225
spam score = 63
title = 'used cisco at optimum data used cisco chas7505 used chas7505 cisco chas7505s new chas7505'

distance = 226
spam score = 61
title = 'used cisco at optimum data used cisco sm25t1 used sm25t1 cisco sm25t1s new sm25t1'

distance = 226
spam score = 62
title = 'used cisco at optimum data used cisco 2613 used 2613 cisco 2613 new cisco 2613'

distance = 227
spam score = 63
title = 'used cisco at optimum data used cisco 3725dcu used 3725dcu cisco 3725dcus new 3725dcu'

distance = 228
spam score = 63
title = 'used cisco at optimum data used cisco 75074x2 used 75074x2 cisco 75074x2s new 75074x2'

distance = 232
spam score = 61
title = 'used cisco at optimum data used cisco wsc4003s1 used wsc4003s1 cisco wsc4003s1s new wsc4003s1'

distance = 233
spam score = 62
title = 'used cisco at optimum data used cisco 7606cha used 7606chass cisco 7606chasss new 7606chass'

distance = 235
spam score = 62
title = 'used cisco at optimum data used cisco 7206vxr used 7206vxr cisco 7206vxrs new 7206vxr'

distance = 258
spam score = 57
title = 'used cisco at optimum data used cisco kitmntg09 used kitmntg09 cisco kitmntg09s new kitmntg09'

distance = 258
spam score = 61
title = 'used cisco at optimum data used cisco 2512 used 2512 cisco 2512s new 2512'

distance = 260
spam score = 62
title = 'used cisco at optimum data used cisco 1760v3pnk9 used 1760v3pnk9 cisco 1760v3pnk9s new 1760v3pnk9'

distance = 261
spam score = 58
title = 'used cisco at optimum data used cisco c85ge1x16k used c85ge1x16k cisco c85ge1x16ks new c85ge1x16k'

distance = 263
spam score = 61
title = 'used cisco at optimum data used cisco 7613acbun used 7613acbun cisco 7613acbuns new 7613acbun'

distance = 265
spam score = 59
title = 'used cisco at optimum data used cisco 128161280ac3 used 128161280ac3 cisco 128161280ac3s new 128161280ac3'

distance = 266
spam score = 66
title = 'used cisco at optimum data used cisco 836seck9 used 836seck9 cisco 836seck9s new 836seck9'

distance = 268
spam score = 58
title = 'used cisco at optimum data used cisco 128161280dc used 128161280dc cisco 128161280dcs new 128161280dc'

distance = 269
spam score = 65
title = 'used cisco at optimum data used cisco cabac used cabac cisco cabacs new cabac'

distance = 270
spam score = 61
title = 'used cisco at optimum data used cisco sm25bri used sm25bri cisco sm25bris new sm25bri'

distance = 287
spam score = 59
title = 'used cisco at optimum data used cisco c8540pwrdc used c8540pwrdc cisco c8540pwrdcs new c8540pwrdc'

distance = 288
spam score = 62
title = 'used cisco at optimum data used cisco 12006ac used 12006ac cisco 12006acs new 12006ac'

distance = 288
spam score = 63
title = 'used cisco at optimum data used cisco 12010ac used 12010ac cisco 12010acs new 12010ac'

distance = 288
spam score = 61
title = 'used cisco at optimum data used cisco 7603acbun used 7603acbun cisco 7603acbuns new 7603acbun'

distance = 289
spam score = 59
title = 'used cisco at optimum data used cisco 7613dcbun used 7613dcbun cisco 7613dcbuns new 7613dcbun'

distance = 290
spam score = 61
title = 'used cisco at optimum data used cisco acs3660rm23 used acs3660rm23 cisco acs3660rm23s new acs3660rm23'

distance = 290
spam score = 61
title = 'used cisco at optimum data used cisco acs3660rm19 used acs3660rm19 cisco acs3660rm19s new acs3660rm19'

distance = 290
spam score = 62
title = 'used cisco at optimum data used cisco 12006dc used 12006dc cisco 12006dcs new 12006dc'

distance = 293
spam score = 53
title = 'used cisco at optimum data used cisco ce560k9 used ce560k9 cisco ce560k9s new ce560k9'

distance = 293
spam score = 60
title = 'used cisco at optimum data used cisco wsc4006s4 used wsc4006s4 cisco wsc4006s4s new wsc4006s4'

distance = 307
spam score = 59
title = 'used cisco at optimum data used cisco cvpn3002bunk9 used cvpn3002bunk9 cisco cvpn3002bunk9s new cvpn3002bunk9'

distance = 307
spam score = 56
title = 'used cisco at optimum data used cisco c8540arm64k used c8540arm64k cisco c8540arm64ks new c8540arm64k'

distance = 309
spam score = 57
title = 'used cisco at optimum data used cisco c85fe8t64k used c85fe8t64k cisco c85fe8t64ks new c85fe8t64k'

distance = 310
spam score = 58
title = 'used cisco at optimum data used cisco c8510pwrac used c8510pwrac cisco c8510pwracs new c8510pwrac'

distance = 310
spam score = 58
title = 'used cisco at optimum data used cisco np1e used np1e cisco np1es new np1e'

distance = 311
spam score = 61
title = 'used cisco at optimum data used cisco 7206vxrdc used 7206vxrdc cisco 7206vxrdcs new 7206vxrdc'

distance = 311
spam score = 59
title = 'used cisco at optimum data used cisco 1751vpnk9a used 1751vpnk9a cisco 1751vpnk9as new 1751vpnk9a'

distance = 311
spam score = 64
title = 'used cisco at optimum data used cisco 7613dcbun2500w used 7613dcbun2500w cisco 7613dcbun2500ws new 7613dcbun2500w'

distance = 313
spam score = 64
title = 'used cisco at optimum data used cisco 836secik9 used 836secik9 cisco 836secik9s new 836secik9'

distance = 313
spam score = 62
title = 'used cisco at optimum data used cisco 751316mx used 751316mx cisco 751316mxs new 751316mx'

distance = 324
spam score = 60
title = 'used cisco at optimum data used cisco 7606sup720p used 7606sup720ps cisco 7606sup720pss new 7606sup720ps'

distance = 325
spam score = 56
title = 'used cisco at optimum data used cisco wsc4006s3dc used wsc4006s3dc cisco wsc4006s3dcs new wsc4006s3dc'

distance = 327
spam score = 61
title = 'used cisco at optimum data used cisco c85403clk used c85403clk cisco c85403clks new c85403clk'

distance = 329
spam score = 56
title = 'used cisco at optimum data used cisco c8510pwrdc used c8510pwrdc cisco c8510pwrdcs new c8510pwrdc'

distance = 331
spam score = 65
title = 'used cisco at optimum data used cisco cab232fc used cab232fc cisco cab232fcs new cab232fc'

distance = 334
spam score = 58
title = 'used cisco at optimum data used cisco acs3600asyn used acs3600asyn cisco acs3600asyns new acs3600asyn'

distance = 337
spam score = 59
title = 'used cisco at optimum data used cisco 7206vxrg12vpnk9 used 7206vxrg12vpnk9 cisco 7206vxrg12vpnk9s new 7206vxrg12vpnk9'

distance = 337
spam score = 60
title = 'used cisco at optimum data used cisco acs7200rmk used acs7200rmk cisco acs7200rmks new acs7200rmk'

distance = 341
spam score = 62
title = 'used cisco at optimum data used cisco cabe1db15 used cabe1db15 cisco cabe1db15s new cabe1db15'

distance = 341
spam score = 61
title = 'used cisco at optimum data used cisco 7204vxrch used 7204vxrch cisco 7204vxrchs new 7204vxrch'

distance = 363
spam score = 61
title = 'used cisco at optimum data used cisco 751316x2mx used 751316x2mx cisco 751316x2mxs new 751316x2mx'

distance = 365
spam score = 64
title = 'used cisco at optimum data used cisco cvpn3015nrbun used cvpn3015nrbun cisco cvpn3015nrbuns new cvpn3015nrbun'

distance = 365
spam score = 61
title = 'used cisco at optimum data used cisco cvpn3005efebun used cvpn3005efebun cisco cvpn3005efebuns new cvpn3005efebun'

distance = 365
spam score = 63
title = 'used cisco at optimum data used cisco 75138x2mx used 75138x2mx cisco 75138x2mxs new 75138x2mx'

distance = 369
spam score = 54
title = 'used cisco at optimum data used cisco ce590dck9 used ce590dck9 cisco ce590dck9s new ce590dck9'

distance = 371
spam score = 63
title = 'used cisco at optimum data used cisco chas7507mx used chas7507mx cisco chas7507mxs new chas7507mx'

distance = 375
spam score = 62
title = 'used cisco at optimum data used cisco cab7kac used cab7kac cisco cab7kacs new cab7kac'

distance = 375
spam score = 61
title = 'used cisco at optimum data used cisco 7609dcbun2500w used 7609dcbun2500w cisco 7609dcbun2500ws new 7609dcbun2500w'

distance = 376
spam score = 60
title = 'used cisco at optimum data used cisco cabac2800wtwlk used cabac2800wtwlk cisco cabac2800wtwlks new cabac2800wtwlk'

distance = 377
spam score = 64
title = 'used cisco at optimum data used cisco chas7513mx used chas7513mx cisco chas7513mxs new chas7513mx'

distance = 405
spam score = 61
title = 'used cisco at optimum data used cisco cabgsr4220vu used cabgsr4220vus cisco cabgsr4220vuss new cabgsr4220vus'

distance = 405
spam score = 62
title = 'used cisco at optimum data used cisco cabgsr6220vu used cabgsr6220vus cisco cabgsr6220vuss new cabgsr6220vus'

distance = 408
spam score = 65
title = 'used cisco at optimum data used cisco cab4502acu used cab4502acus cisco cab4502acuss new cab4502acus'

distance = 417
spam score = 60
title = 'used cisco at optimum data used cisco ubrmc16s used ubrmc16s cisco ubrmc16ss new ubrmc16s'

distance = 419
spam score = 65
title = 'used cisco at optimum data used cisco cab4502dc60cm used cab4502dc60cm cisco cab4502dc60cms new cab4502dc60cm'

distance = 423
spam score = 60
title = 'used cisco at optimum data used cisco c3725vpnidsk9 used c3725vpnidsk9 cisco c3725vpnidsk9s new c3725vpnidsk9'

distance = 425
spam score = 59
title = 'used cisco at optimum data used cisco ubr7200io2fee used ubr7200io2fee cisco ubr7200io2fees new ubr7200io2fee'

distance = 426
spam score = 59
title = 'used cisco at optimum data used cisco 2610xmrp used 2610xmrps cisco 2610xmrpss new 2610xmrps'

distance = 426
spam score = 58
title = 'used cisco at optimum data used cisco cvpn3005memkit used cvpn3005memkit cisco cvpn3005memkits new cvpn3005memkit'

distance = 429
spam score = 60
title = 'used cisco at optimum data used cisco 10720fefxsm used 10720fefxsm cisco 10720fefxsms new 10720fefxsm'

distance = 461
spam score = 60
title = 'used cisco at optimum data used cisco aimvpnhpii used aimvpnhpii cisco aimvpnhpiis new aimvpnhpii'

distance = 465
spam score = 63
title = 'used cisco at optimum data used cisco 2620xmrp used 2620xmrps cisco 2620xmrpss new 2620xmrps'

distance = 466
spam score = 59
title = 'used cisco at optimum data used cisco aimvpnepii used aimvpnepii cisco aimvpnepiis new aimvpnepii'

distance = 471
spam score = 60
title = 'used cisco at optimum data used cisco acsubr7200rmk used acsubr7200rmk cisco acsubr7200rmks new acsubr7200rmk'

distance = 485
spam score = 58
title = 'used cisco at optimum data used cisco c8540msrskitdc used c8540msrskitdc cisco c8540msrskitdcs new c8540msrskitdc'

distance = 485
spam score = 59
title = 'used cisco at optimum data used cisco aimvpnep used aimvpnep cisco aimvpneps new aimvpnep'

distance = 486
spam score = 59
title = 'used cisco at optimum data used cisco c8540msrskitac used c8540msrskitac cisco c8540msrskitacs new c8540msrskitac'

distance = 493
spam score = 65
title = 'used cisco at optimum data used cisco cabgs1m used cabgs1m cisco cabgs1ms new cabgs1m'

distance = 497
spam score = 60
title = 'used cisco at optimum data used cisco ubr7246vxr4mc16s used ubr7246vxr4mc16s cisco ubr7246vxr4mc16ss new ubr7246vxr4mc16s'

distance = 502
spam score = 60
title = 'used cisco at optimum data used cisco 10720irlcpo used 10720irlcpos cisco 10720irlcposs new 10720irlcpos'

distance = 675
spam score = 54
title = 'used cisco at optimum data 2500 series'

distance = 683
spam score = 56
title = 'used cisco at optimum data 8500 series'

distance = 706
spam score = 82
title = 'used cisco at optimum data cisco access servers'

distance = 740
spam score = 62
title = 'used cisco at optimum data 7300 series'

distance = 748
spam score = 70
title = 'used cisco at optimum data as5800 series'

distance = 748
spam score = 69
title = 'used cisco at optimum data as5400 series'

distance = 767
spam score = 70
title = 'used cisco at optimum data cisco cables'

distance = 1050
spam score = 58
title = 'used cisco at optimum data content services switch'

distance = 1545
spam score = 87
title = 'used cisco routers used cisco switches and other equipment from warwick data'

distance = 161
spam score = 55
title = 'armed conflict qatar 18001999'

distance = 166
spam score = 54
title = 'armed conflict gabon 18001999'

distance = 167
spam score = 55
title = 'armed conflict mauritius 18001999'

distance = 167
spam score = 45
title = 'armed conflict qatar 18001999'

distance = 168
spam score = 48
title = 'armed conflict gabon 18001999'

distance = 170
spam score = 56
title = 'armed conflict mauritius 18001999'

distance = 174
spam score = 48
title = 'armed conflict macedonia 18001999'

distance = 175
spam score = 54
title = 'armed conflict kazakhstan 18001999'

distance = 181
spam score = 51
title = 'armed conflict kazakhstan 18001999'

distance = 181
spam score = 47
title = 'armed conflict mauritania 18001999'

distance = 185
spam score = 56
title = 'armed conflict iceland 18001999'

distance = 186
spam score = 51
title = 'armed conflict macedonia 18001999'

distance = 188
spam score = 48
title = 'armed conflict gambia 18001999'

distance = 188
spam score = 53
title = 'armed conflict gambia 18001999'

distance = 188
spam score = 48
title = 'armed conflict guinea 18001999'

distance = 190
spam score = 59
title = 'armed conflict guinea 18001999'

distance = 192
spam score = 44
title = 'armed conflict mauritania 18001999'

distance = 193
spam score = 59
title = 'armed conflict slovenia 18001999'

distance = 193
spam score = 51
title = 'armed conflict djibouti 18001999'

distance = 193
spam score = 50
title = 'armed conflict slovenia 18001999'

distance = 232
spam score = 46
title = 'armed conflict seychelles 18001999'

distance = 234
spam score = 46
title = 'armed conflict gaza 18001999'

distance = 234
spam score = 59
title = 'armed conflict lesotho 18001999'

distance = 238
spam score = 53
title = 'armed conflict malaysia 18001999'

distance = 238
spam score = 40
title = 'armed conflict malaysia 18001999'

distance = 239
spam score = 51
title = 'armed conflict croatia 18001999'

distance = 239
spam score = 51
title = 'armed conflict gaza 18001999'

distance = 239
spam score = 58
title = 'armed conflict croatia 18001999'

distance = 240
spam score = 55
title = 'armed conflict denmark 18001999'

distance = 241
spam score = 44
title = 'armed conflict seychelles 18001999'

distance = 257
spam score = 51
title = 'armed conflict tajikistan 18001999'

distance = 257
spam score = 55
title = 'armed conflict fiji 18001999'

distance = 257
spam score = 50
title = 'armed conflict tajikistan 18001999'

distance = 258
spam score = 46
title = 'armed conflict bhutan 18001999'

distance = 258
spam score = 50
title = 'armed conflict united arab emirates 18001999'

distance = 259
spam score = 63
title = 'armed conflict sokoto 18001999'

distance = 260
spam score = 59
title = 'armed conflict cameroon 18001999'

distance = 260
spam score = 43
title = 'armed conflict singapore 18001999'

distance = 261
spam score = 54
title = 'armed conflict singapore 18001999'

distance = 261
spam score = 59
title = 'armed conflict druse 18001999'

distance = 282
spam score = 48
title = 'armed conflict kyrgyzstan 18001999'

distance = 285
spam score = 58
title = 'armed conflict bhutan 18001999'

distance = 290
spam score = 51
title = 'armed conflict grenada 18001999'

distance = 291
spam score = 49
title = 'armed conflict estonia 18001999'

distance = 292
spam score = 49
title = 'armed conflict oyo 18001999'

distance = 293
spam score = 54
title = 'armed conflict estonia 18001999'

distance = 294
spam score = 53
title = 'armed conflict mozambique 18001999'

distance = 294
spam score = 49
title = 'armed conflict dahomey 18001999'

distance = 296
spam score = 53
title = 'armed conflict grenada 18001999'

distance = 297
spam score = 53
title = 'armed conflict dahomey 18001999'

distance = 313
spam score = 60
title = 'armed conflict benin 18001897'

distance = 314
spam score = 52
title = 'armed conflict jamaica 18001999'

distance = 314
spam score = 49
title = 'armed conflict merina 18001999'

distance = 315
spam score = 52
title = 'armed conflict benin 18001897'

distance = 316
spam score = 45
title = 'armed conflict prussia 18001871'

distance = 318
spam score = 53
title = 'armed conflict bosniahercegovina 18001999'

distance = 319
spam score = 49
title = 'armed conflict prussia 18001871'

distance = 320
spam score = 44
title = 'armed conflict maldives 18001999'

distance = 320
spam score = 46
title = 'armed conflict bosniahercegovina 18001999'

distance = 322
spam score = 46
title = 'armed conflict liberia 18001999'

distance = 330
spam score = 54
title = 'armed conflict namibia 18001999'

distance = 334
spam score = 42
title = 'armed conflict tibet 18001999'

distance = 334
spam score = 44
title = 'armed conflict tibet 18001999'

distance = 335
spam score = 54
title = 'armed conflict jordan 19201999'

distance = 337
spam score = 46
title = 'armed conflict tanzania 18001999'

distance = 338
spam score = 57
title = 'armed conflict tanzania 18001999'

distance = 340
spam score = 50
title = 'armed conflict georgia18001999'

distance = 340
spam score = 56
title = 'armed conflict georgia18001999'

distance = 341
spam score = 44
title = 'armed conflict vatican 18001999'

distance = 342
spam score = 48
title = 'armed conflict kuwait 18001999'

distance = 369
spam score = 43
title = 'armed conflict nepal 18001999'

distance = 375
spam score = 39
title = 'armed conflict armenia 18001999'

distance = 376
spam score = 46
title = 'armed conflict belgium 18001999'

distance = 378
spam score = 47
title = 'armed conflict chad 18001999'

distance = 379
spam score = 42
title = 'armed conflict ghana 18001999'

distance = 392
spam score = 48
title = 'armed conflict new zealand 18001999'

distance = 392
spam score = 57
title = 'armed conflict lithuania 18001999'

distance = 394
spam score = 55
title = 'armed conflict angola 18001999'

distance = 394
spam score = 53
title = 'armed conflict angola 18001999'

distance = 394
spam score = 59
title = 'armed conflict eritrea 18001999'

distance = 448
spam score = 55
title = 'armed conflict montenegro 18001999'

distance = 457
spam score = 45
title = 'armed conflict montenegro 18001999'

distance = 459
spam score = 38
title = 'armed conflict netherlands 18001999'

distance = 460
spam score = 50
title = 'armed conflict netherlands 18001999'

distance = 462
spam score = 46
title = 'armed conflict kokand 18001920'

distance = 464
spam score = 52
title = 'armed conflict asante 18001999'

distance = 465
spam score = 54
title = 'armed conflict asante 18001999'

distance = 466
spam score = 46
title = 'armed conflict kokand 18001920'

distance = 480
spam score = 45
title = 'armed conflict bukhara 18001999'

distance = 512
spam score = 46
title = 'armed conflict morocco 18001999'

distance = 562
spam score = 56
title = 'armed conflict comoros 18001999'

distance = 570
spam score = 54
title = 'armed conflict uruguay 18001999'

distance = 577
spam score = 51
title = 'armed conflict uruguay 18001999'

distance = 585
spam score = 57
title = 'armed conflict panama 18001999'

distance = 588
spam score = 55
title = 'armed conflict costa rica 18001999'

distance = 589
spam score = 45
title = 'armed conflict kurds 18001999'

distance = 591
spam score = 50
title = 'armed conflict panama 18001999'

distance = 595
spam score = 42
title = 'armed conflict kurds 18001999'

distance = 606
spam score = 45
title = 'armed conflict costa rica 18001999'

distance = 626
spam score = 55
title = 'algiers constantine secession 1826'

distance = 858
spam score = 51
title = 'armed conflict haiti 18001999'

distance = 858
spam score = 49
title = 'armed conflict haiti 18001999'

distance = 859
spam score = 39
title = 'armed conflict events timeline 18701874'

distance = 866
spam score = 48
title = 'armed conflict events timeline 18701874'

distance = 133
spam score = 61
title = ''

distance = 136
spam score = 51
title = ''

distance = 137
spam score = 40
title = ''

distance = 137
spam score = 41
title = ''

distance = 138
spam score = 62
title = ''

distance = 138
spam score = 42
title = ''

distance = 138
spam score = 61
title = ''

distance = 138
spam score = 39
title = ''

distance = 138
spam score = 38
title = ''

distance = 139
spam score = 43
title = ''

distance = 139
spam score = 39
title = ''

distance = 139
spam score = 44
title = ''

distance = 139
spam score = 40
title = ''

distance = 139
spam score = 51
title = ''

distance = 139
spam score = 62
title = ''

distance = 141
spam score = 39
title = ''

distance = 141
spam score = 50
title = ''

distance = 141
spam score = 51
title = ''

distance = 141
spam score = 59
title = ''

distance = 141
spam score = 61
title = ''

distance = 143
spam score = 57
title = ''

distance = 144
spam score = 60
title = ''

distance = 144
spam score = 52
title = ''

distance = 146
spam score = 47
title = ''

distance = 146
spam score = 49
title = ''

distance = 147
spam score = 60
title = ''

distance = 147
spam score = 57
title = ''

distance = 148
spam score = 60
title = ''

distance = 148
spam score = 40
title = ''

distance = 149
spam score = 62
title = ''

distance = 149
spam score = 59
title = ''

distance = 152
spam score = 53
title = ''

distance = 157
spam score = 50
title = ''

distance = 160
spam score = 38
title = ''

distance = 161
spam score = 44
title = ''

distance = 163
spam score = 39
title = ''

distance = 164
spam score = 52
title = ''

distance = 173
spam score = 41
title = ''

distance = 174
spam score = 42
title = ''

distance = 175
spam score = 57
title = ''

distance = 247
spam score = 52
title = ''

distance = 249
spam score = 57
title = ''

distance = 673
spam score = 40
title = ''

distance = 676
spam score = 40
title = ''

distance = 677
spam score = 38
title = ''

distance = 677
spam score = 38
title = ''

distance = 678
spam score = 38
title = ''

distance = 678
spam score = 34
title = ''

distance = 679
spam score = 40
title = ''

distance = 681
spam score = 43
title = ''

distance = 681
spam score = 36
title = ''

distance = 682
spam score = 38
title = ''

distance = 683
spam score = 38
title = ''

distance = 684
spam score = 40
title = ''

distance = 688
spam score = 36
title = ''

distance = 691
spam score = 38
title = ''

distance = 692
spam score = 41
title = ''

distance = 695
spam score = 36
title = ''

distance = 700
spam score = 37
title = ''

distance = 178
spam score = 53
title = ''

distance = 185
spam score = 46
title = ''

distance = 187
spam score = 49
title = ''

distance = 191
spam score = 53
title = ''

distance = 199
spam score = 54
title = ''

distance = 203
spam score = 44
title = ''

distance = 211
spam score = 50
title = ''

distance = 213
spam score = 44
title = ''

distance = 213
spam score = 46
title = ''

distance = 213
spam score = 46
title = ''

distance = 220
spam score = 46
title = ''

distance = 231
spam score = 45
title = ''

distance = 235
spam score = 46
title = ''

distance = 236
spam score = 41
title = ''

distance = 237
spam score = 44
title = ''

distance = 238
spam score = 50
title = ''

distance = 240
spam score = 42
title = ''

distance = 241
spam score = 46
title = ''

distance = 244
spam score = 43
title = ''

distance = 248
spam score = 46
title = ''

distance = 250
spam score = 42
title = ''

distance = 254
spam score = 47
title = ''

distance = 257
spam score = 43
title = ''

distance = 257
spam score = 46
title = ''

distance = 259
spam score = 44
title = ''

distance = 271
spam score = 48
title = ''

distance = 276
spam score = 51
title = ''

distance = 281
spam score = 40
title = ''

distance = 286
spam score = 52
title = ''

distance = 287
spam score = 47
title = ''

distance = 289
spam score = 50
title = ''

distance = 291
spam score = 40
title = ''

distance = 293
spam score = 46
title = ''

distance = 294
spam score = 53
title = ''

distance = 298
spam score = 50
title = ''

distance = 298
spam score = 52
title = ''

distance = 300
spam score = 52
title = ''

distance = 306
spam score = 45
title = ''

distance = 316
spam score = 45
title = ''

distance = 325
spam score = 54
title = ''

distance = 332
spam score = 47
title = ''

distance = 338
spam score = 44
title = ''

distance = 346
spam score = 51
title = ''

distance = 350
spam score = 49
title = ''

distance = 353
spam score = 43
title = ''

distance = 361
spam score = 52
title = ''

distance = 362
spam score = 55
title = ''

distance = 371
spam score = 44
title = ''

distance = 380
spam score = 56
title = ''

distance = 383
spam score = 52
title = ''

distance = 389
spam score = 43
title = ''

distance = 392
spam score = 51
title = ''

distance = 393
spam score = 44
title = ''

distance = 398
spam score = 50
title = ''

distance = 399
spam score = 49
title = ''

distance = 404
spam score = 50
title = ''

distance = 405
spam score = 51
title = ''

distance = 408
spam score = 43
title = ''

distance = 409
spam score = 51
title = ''

distance = 410
spam score = 47
title = ''

distance = 414
spam score = 41
title = ''

distance = 419
spam score = 51
title = ''

distance = 423
spam score = 54
title = ''

distance = 465
spam score = 49
title = ''

distance = 468
spam score = 49
title = ''

distance = 470
spam score = 53
title = ''

distance = 473
spam score = 54
title = ''

distance = 479
spam score = 42
title = ''

distance = 507
spam score = 49
title = ''

distance = 562
spam score = 45
title = ''

distance = 570
spam score = 52
title = ''

distance = 588
spam score = 46
title = ''

distance = 648
spam score = 48
title = ''

distance = 741
spam score = 52
title = ''

distance = 817
spam score = 39
title = ''

distance = 991
spam score = 49
title = ''

distance = 1074
spam score = 44
title = ''

distance = 96
spam score = 25
title = ''

distance = 107
spam score = 27
title = ''

distance = 107
spam score = 27
title = ''

distance = 110
spam score = 27
title = ''

distance = 122
spam score = 27
title = ''

distance = 132
spam score = 24
title = ''

distance = 171
spam score = 26
title = ''

distance = 176
spam score = 24
title = ''

distance = 184
spam score = 26
title = ''

distance = 189
spam score = 25
title = ''

distance = 191
spam score = 26
title = ''

distance = 199
spam score = 25
title = ''

distance = 201
spam score = 23
title = ''

distance = 208
spam score = 26
title = ''

distance = 225
spam score = 25
title = ''

distance = 230
spam score = 25
title = ''

distance = 233
spam score = 25
title = ''

distance = 267
spam score = 22
title = ''

distance = 269
spam score = 25
title = ''

distance = 285
spam score = 25
title = ''

distance = 300
spam score = 24
title = ''

distance = 307
spam score = 23
title = ''

distance = 366
spam score = 26
title = ''

distance = 443
spam score = 23
title = ''

distance = 1638
spam score = 86
title = ''

distance = 292
spam score = 77
title = ''

distance = 296
spam score = 50
title = ''

distance = 298
spam score = 45
title = ''

distance = 300
spam score = 66
title = ''

distance = 301
spam score = 57
title = ''

distance = 305
spam score = 51
title = ''

distance = 305
spam score = 72
title = ''

distance = 309
spam score = 61
title = ''

distance = 311
spam score = 55
title = ''

distance = 322
spam score = 54
title = ''

distance = 325
spam score = 75
title = ''

distance = 325
spam score = 60
title = ''

distance = 326
spam score = 58
title = ''

distance = 328
spam score = 55
title = ''

distance = 329
spam score = 51
title = ''

distance = 329
spam score = 54
title = ''

distance = 329
spam score = 63
title = ''

distance = 331
spam score = 70
title = ''

distance = 332
spam score = 64
title = ''

distance = 333
spam score = 51
title = ''

distance = 349
spam score = 71
title = ''

distance = 349
spam score = 74
title = ''

distance = 350
spam score = 52
title = ''

distance = 350
spam score = 71
title = ''

distance = 352
spam score = 71
title = ''

distance = 354
spam score = 73
title = ''

distance = 355
spam score = 50
title = ''

distance = 355
spam score = 57
title = ''

distance = 360
spam score = 72
title = ''

distance = 361
spam score = 65
title = ''

distance = 374
spam score = 68
title = ''

distance = 374
spam score = 65
title = ''

distance = 374
spam score = 66
title = ''

distance = 376
spam score = 61
title = ''

distance = 376
spam score = 68
title = ''

distance = 376
spam score = 67
title = ''

distance = 377
spam score = 46
title = ''

distance = 378
spam score = 60
title = ''

distance = 379
spam score = 66
title = ''

distance = 379
spam score = 67
title = ''

distance = 385
spam score = 57
title = ''

distance = 385
spam score = 63
title = ''

distance = 386
spam score = 64
title = ''

distance = 388
spam score = 46
title = ''

distance = 388
spam score = 53
title = ''

distance = 389
spam score = 68
title = ''

distance = 389
spam score = 54
title = ''

distance = 391
spam score = 50
title = ''

distance = 391
spam score = 53
title = ''

distance = 392
spam score = 48
title = ''

distance = 402
spam score = 53
title = ''

distance = 406
spam score = 68
title = ''

distance = 406
spam score = 48
title = ''

distance = 407
spam score = 73
title = ''

distance = 410
spam score = 66
title = ''

distance = 411
spam score = 52
title = ''

distance = 411
spam score = 62
title = ''

distance = 413
spam score = 46
title = ''

distance = 414
spam score = 61
title = ''

distance = 417
spam score = 65
title = ''

distance = 429
spam score = 48
title = ''

distance = 430
spam score = 68
title = ''

distance = 431
spam score = 61
title = ''

distance = 431
spam score = 63
title = ''

distance = 432
spam score = 69
title = ''

distance = 432
spam score = 50
title = ''

distance = 433
spam score = 62
title = ''

distance = 433
spam score = 63
title = ''

distance = 433
spam score = 49
title = ''

distance = 435
spam score = 66
title = ''

distance = 443
spam score = 74
title = ''

distance = 444
spam score = 65
title = ''

distance = 444
spam score = 57
title = ''

distance = 445
spam score = 51
title = ''

distance = 446
spam score = 50
title = ''

distance = 446
spam score = 65
title = ''

distance = 447
spam score = 59
title = ''

distance = 448
spam score = 52
title = ''

distance = 448
spam score = 67
title = ''

distance = 449
spam score = 65
title = ''

distance = 464
spam score = 69
title = ''

distance = 468
spam score = 58
title = ''

distance = 469
spam score = 61
title = ''

distance = 473
spam score = 61
title = ''

distance = 473
spam score = 59
title = ''

distance = 474
spam score = 54
title = ''

distance = 477
spam score = 61
title = ''

distance = 478
spam score = 55
title = ''

distance = 484
spam score = 75
title = ''

distance = 486
spam score = 55
title = ''

distance = 503
spam score = 65
title = ''

distance = 504
spam score = 58
title = ''

distance = 508
spam score = 61
title = ''

distance = 510
spam score = 60
title = ''

distance = 510
spam score = 57
title = ''

distance = 511
spam score = 51
title = ''

distance = 513
spam score = 53
title = ''

distance = 514
spam score = 75
title = ''

distance = 515
spam score = 51
title = ''

distance = 515
spam score = 66
title = ''

distance = 557
spam score = 46
title = ''

distance = 558
spam score = 56
title = ''

distance = 573
spam score = 70
title = ''

distance = 600
spam score = 54
title = ''

distance = 601
spam score = 70
title = ''

distance = 608
spam score = 55
title = ''

distance = 611
spam score = 52
title = ''

distance = 264
spam score = 58
title = 'alioth developer profile'

distance = 265
spam score = 53
title = 'alioth developer profile'

distance = 267
spam score = 57
title = 'rubyforge developer profile'

distance = 270
spam score = 54
title = 'alioth developer profile'

distance = 279
spam score = 58
title = 'rubyforge developer profile'

distance = 280
spam score = 55
title = 'alioth developer profile'

distance = 281
spam score = 71
title = 'rubyforge developer profile'

distance = 283
spam score = 64
title = 'rubyforge developer profile'

distance = 285
spam score = 60
title = 'rubyforge developer profile'

distance = 286
spam score = 58
title = 'rubyforge developer profile'

distance = 286
spam score = 64
title = 'rubyforge developer profile'

distance = 287
spam score = 67
title = 'rubyforge developer profile'

distance = 289
spam score = 58
title = 'rubyforge developer profile'

distance = 290
spam score = 64
title = 'rubyforge developer profile'

distance = 292
spam score = 55
title = 'alioth developer profile'

distance = 292
spam score = 69
title = 'neesforge developer profile'

distance = 297
spam score = 60
title = 'rubyforge developer profile'

distance = 298
spam score = 54
title = 'ocamlforge developer profile'

distance = 300
spam score = 60
title = 'alioth developer profile'

distance = 301
spam score = 59
title = 'rubyforge developer profile'

distance = 348
spam score = 54
title = 'alioth developer profile'

distance = 349
spam score = 54
title = 'alioth developer profile'

distance = 349
spam score = 56
title = 'pgfoundry developer profile'

distance = 350
spam score = 50
title = 'alioth developer profile'

distance = 350
spam score = 60
title = 'luaforge developer profile'

distance = 351
spam score = 63
title = 'alioth developer profile'

distance = 351
spam score = 52
title = 'alioth developer profile'

distance = 352
spam score = 69
title = 'alioth developer profile'

distance = 352
spam score = 74
title = 'alioth developer profile'

distance = 352
spam score = 38
title = 'semwebcentral developer profile'

distance = 375
spam score = 53
title = 'semwebcentral developer profile'

distance = 376
spam score = 61
title = 'semwebcentral developer profile'

distance = 377
spam score = 35
title = 'semwebcentral developer profile'

distance = 377
spam score = 39
title = 'semwebcentral developer profile'

distance = 377
spam score = 56
title = 'alioth developer profile'

distance = 378
spam score = 39
title = 'semwebcentral developer profile'

distance = 378
spam score = 54
title = 'alioth developer profile'

distance = 378
spam score = 40
title = 'semwebcentral developer profile'

distance = 378
spam score = 45
title = 'semwebcentral developer profile'

distance = 379
spam score = 36
title = 'semwebcentral developer profile'

distance = 392
spam score = 51
title = 'pgfoundry developer profile'

distance = 393
spam score = 41
title = 'semwebcentral developer profile'

distance = 393
spam score = 59
title = 'luaforge developer profile'

distance = 394
spam score = 53
title = 'pgfoundry developer profile'

distance = 395
spam score = 57
title = 'alioth developer profile'

distance = 395
spam score = 64
title = 'alioth developer profile'

distance = 395
spam score = 55
title = 'alioth developer profile'

distance = 396
spam score = 55
title = 'luaforge developer profile'

distance = 396
spam score = 47
title = 'semwebcentral developer profile'

distance = 396
spam score = 70
title = 'alioth developer profile'

distance = 411
spam score = 34
title = 'semwebcentral developer profile'

distance = 411
spam score = 69
title = 'luaforge developer profile'

distance = 412
spam score = 55
title = 'luaforge developer profile'

distance = 412
spam score = 42
title = 'semwebcentral developer profile'

distance = 413
spam score = 59
title = 'ocamlforge developer profile'

distance = 413
spam score = 56
title = 'alioth developer profile'

distance = 413
spam score = 42
title = 'semwebcentral developer profile'

distance = 413
spam score = 41
title = 'semwebcentral developer profile'

distance = 413
spam score = 55
title = 'alioth developer profile'

distance = 415
spam score = 71
title = 'pgfoundry developer profile'

distance = 425
spam score = 61
title = 'luaforge developer profile'

distance = 426
spam score = 37
title = 'semwebcentral developer profile'

distance = 426
spam score = 44
title = 'semwebcentral developer profile'

distance = 426
spam score = 38
title = 'semwebcentral developer profile'

distance = 426
spam score = 45
title = 'semwebcentral developer profile'

distance = 427
spam score = 53
title = 'alioth developer profile'

distance = 427
spam score = 51
title = 'alioth developer profile'

distance = 427
spam score = 40
title = 'semwebcentral developer profile'

distance = 427
spam score = 41
title = 'semwebcentral developer profile'

distance = 428
spam score = 41
title = 'semwebcentral developer profile'

distance = 436
spam score = 70
title = 'pgfoundry developer profile'

distance = 437
spam score = 40
title = 'semwebcentral developer profile'

distance = 437
spam score = 44
title = 'semwebcentral developer profile'

distance = 437
spam score = 44
title = 'semwebcentral developer profile'

distance = 437
spam score = 41
title = 'semwebcentral developer profile'

distance = 439
spam score = 43
title = 'semwebcentral developer profile'

distance = 440
spam score = 59
title = 'pgfoundry developer profile'

distance = 440
spam score = 37
title = 'semwebcentral developer profile'

distance = 441
spam score = 53
title = 'semwebcentral developer profile'

distance = 441
spam score = 71
title = 'pgfoundry developer profile'

distance = 462
spam score = 51
title = 'pgfoundry developer profile'

distance = 462
spam score = 68
title = 'rforge developer profile'

distance = 463
spam score = 54
title = 'alioth developer profile'

distance = 464
spam score = 54
title = 'alioth developer profile'

distance = 465
spam score = 39
title = 'semwebcentral developer profile'

distance = 467
spam score = 64
title = 'alioth developer profile'

distance = 468
spam score = 66
title = 'pgfoundry developer profile'

distance = 468
spam score = 70
title = 'alioth developer profile'

distance = 469
spam score = 51
title = 'rforge developer profile'

distance = 470
spam score = 57
title = 'luaforge developer profile'

distance = 502
spam score = 59
title = 'alioth developer profile'

distance = 506
spam score = 52
title = 'pascal forge'

distance = 508
spam score = 54
title = 'pascal forge'

distance = 513
spam score = 48
title = 'rforge developer profile'

distance = 516
spam score = 75
title = 'rforge developer profile'

distance = 520
spam score = 65
title = 'pgfoundry developer profile'

distance = 521
spam score = 54
title = 'pascal forge'

distance = 524
spam score = 51
title = 'rforge developer profile'

distance = 524
spam score = 54
title = 'alioth developer profile'

distance = 528
spam score = 66
title = 'alioth developer profile'

distance = 678
spam score = 64
title = 'pgfoundry developer profile'

distance = 685
spam score = 78
title = 'neesforge developer profile'

distance = 733
spam score = 56
title = 'cropforge developer profile'

distance = 806
spam score = 54
title = 'cropforge developer profile'

distance = 918
spam score = 53
title = 'egovlabs entwicklerprofil'

distance = 974
spam score = 68
title = 'cropforge developer profile'

distance = 995
spam score = 57
title = 'cropforge developer profile'

distance = 1696
spam score = 67
title = 'preseason magazine review notes'

distance = 110
spam score = 45
title = ''

distance = 114
spam score = 61
title = ''

distance = 123
spam score = 44
title = ''

distance = 123
spam score = 59
title = ''

distance = 167
spam score = 61
title = ''

distance = 171
spam score = 61
title = ''

distance = 186
spam score = 75
title = ''

distance = 189
spam score = 57
title = ''

distance = 191
spam score = 58
title = ''

distance = 193
spam score = 61
title = ''

distance = 220
spam score = 60
title = ''

distance = 353
spam score = 48
title = ''

distance = 355
spam score = 39
title = ''

distance = 390
spam score = 72
title = ''

distance = 479
spam score = 45
title = ''

distance = 487
spam score = 34
title = ''

distance = 519
spam score = 62
title = ''

distance = 1452
spam score = 45
title = ''

distance = 214
spam score = 66
title = 'bt global services hourly city data'

distance = 215
spam score = 66
title = 'bt global services hourly city data'

distance = 218
spam score = 66
title = 'bt global services hourly city data'

distance = 218
spam score = 66
title = 'bt global services hourly city data'

distance = 218
spam score = 66
title = 'bt global services hourly city data'

distance = 219
spam score = 67
title = 'bt global services hourly city data'

distance = 220
spam score = 67
title = 'bt global services hourly city data'

distance = 221
spam score = 66
title = 'bt global services hourly city data'

distance = 222
spam score = 66
title = 'bt global services hourly city data'

distance = 223
spam score = 66
title = 'bt global services hourly city data'

distance = 224
spam score = 67
title = 'bt global services hourly city data'

distance = 224
spam score = 67
title = 'bt global services hourly city data'

distance = 226
spam score = 66
title = 'bt global services hourly city data'

distance = 226
spam score = 67
title = 'bt global services hourly city data'

distance = 231
spam score = 66
title = 'bt global services hourly city data'

distance = 233
spam score = 68
title = 'bt global services hourly city data'

distance = 234
spam score = 66
title = 'bt global services hourly city data'

distance = 235
spam score = 65
title = 'bt global services hourly city data'

distance = 239
spam score = 66
title = 'bt global services hourly city data'

distance = 257
spam score = 67
title = 'bt global services hourly city data'

distance = 287
spam score = 63
title = 'bt global services daily city data'

distance = 288
spam score = 67
title = 'bt global services monthly city data'

distance = 289
spam score = 63
title = 'bt global services daily city data'

distance = 289
spam score = 64
title = 'bt global services daily city data'

distance = 290
spam score = 66
title = 'bt global services monthly city data'

distance = 291
spam score = 65
title = 'bt global services monthly city data'

distance = 292
spam score = 63
title = 'bt global services daily city data'

distance = 298
spam score = 63
title = 'bt global services daily city data'

distance = 298
spam score = 64
title = 'bt global services daily city data'

distance = 300
spam score = 61
title = 'bt global services daily city data'

distance = 405
spam score = 66
title = 'bt global services hourly city data'

distance = 408
spam score = 58
title = 'bt global services hourly city data'

distance = 410
spam score = 64
title = 'bt global services hourly city data'

distance = 416
spam score = 59
title = 'bt global services hourly city data'

distance = 416
spam score = 67
title = 'bt global services hourly city data'

distance = 418
spam score = 63
title = 'bt global services hourly city data'

distance = 420
spam score = 63
title = 'bt global services hourly city data'

distance = 421
spam score = 65
title = 'bt global services hourly city data'

distance = 421
spam score = 66
title = 'bt global services hourly city data'

distance = 421
spam score = 63
title = 'bt global services hourly city data'

distance = 431
spam score = 65
title = 'bt global services hourly city data'

distance = 433
spam score = 64
title = 'bt global services hourly city data'

distance = 435
spam score = 63
title = 'bt global services hourly city data'

distance = 439
spam score = 63
title = 'bt global services hourly city data'

distance = 439
spam score = 64
title = 'bt global services hourly city data'

distance = 449
spam score = 61
title = 'bt global services hourly city data'

distance = 453
spam score = 63
title = 'bt global services hourly city data'

distance = 453
spam score = 67
title = 'bt global services hourly city data'

distance = 453
spam score = 62
title = 'bt global services hourly city data'

distance = 453
spam score = 65
title = 'bt global services hourly city data'

distance = 474
spam score = 62
title = 'bt global services monthly city data'

distance = 475
spam score = 77
title = 'bt global services daily city data'

distance = 476
spam score = 61
title = 'bt global services daily city data'

distance = 482
spam score = 61
title = 'bt global services monthly city data'

distance = 483
spam score = 61
title = 'bt global services monthly city data'

distance = 484
spam score = 58
title = 'bt global services monthly city data'

distance = 484
spam score = 62
title = 'bt global services monthly city data'

distance = 484
spam score = 67
title = 'bt global services hourly city data'

distance = 485
spam score = 60
title = 'bt global services monthly city data'

distance = 485
spam score = 58
title = 'bt global services monthly city data'

distance = 492
spam score = 62
title = 'bt global services hourly city data'

distance = 492
spam score = 60
title = 'bt global services daily city data'

distance = 493
spam score = 59
title = 'bt global services daily city data'

distance = 495
spam score = 60
title = 'bt global services daily city data'

distance = 496
spam score = 60
title = 'bt global services daily city data'

distance = 496
spam score = 64
title = 'bt global services hourly city data'

distance = 499
spam score = 63
title = 'bt global services hourly city data'

distance = 499
spam score = 58
title = 'bt global services daily city data'

distance = 502
spam score = 66
title = 'bt global services hourly city data'

distance = 502
spam score = 69
title = 'bt global services hourly city data'

distance = 507
spam score = 67
title = 'bt global services hourly city data'

distance = 509
spam score = 69
title = 'bt global services hourly city data'

distance = 511
spam score = 63
title = 'bt global services hourly city data'

distance = 511
spam score = 61
title = 'bt global services daily city data'

distance = 512
spam score = 64
title = 'bt global services monthly city data'

distance = 518
spam score = 66
title = 'bt global services hourly city data'

distance = 520
spam score = 65
title = 'bt global services hourly city data'

distance = 520
spam score = 71
title = 'bt global services hourly city data'

distance = 521
spam score = 66
title = 'bt global services hourly city data'

distance = 522
spam score = 66
title = 'bt global services hourly city data'

distance = 533
spam score = 61
title = 'bt global services daily city data'

distance = 533
spam score = 59
title = 'bt global services daily city data'

distance = 536
spam score = 53
title = 'bt global services daily city data'

distance = 537
spam score = 61
title = 'bt global services daily city data'

distance = 538
spam score = 73
title = 'bt global services hourly city data'

distance = 545
spam score = 61
title = 'bt global services daily city data'

distance = 552
spam score = 74
title = 'bt global services hourly city data'

distance = 553
spam score = 59
title = 'bt global services daily city data'

distance = 554
spam score = 73
title = 'bt global services hourly city data'

distance = 561
spam score = 60
title = 'bt global services daily city data'

distance = 578
spam score = 59
title = 'bt global services daily city data'

distance = 579
spam score = 78
title = 'bt global services hourly city data'

distance = 581
spam score = 66
title = 'bt global services hourly city data'

distance = 582
spam score = 76
title = 'bt global services hourly city data'

distance = 582
spam score = 67
title = 'bt global services daily city data'

distance = 582
spam score = 65
title = 'bt global services daily city data'

distance = 585
spam score = 60
title = 'bt global services monthly city data'

distance = 586
spam score = 69
title = 'bt global services daily city data'

distance = 588
spam score = 53
title = 'bt global services hourly city data'

distance = 592
spam score = 66
title = 'bt global services daily city data'

distance = 208
spam score = 29
title = 'webgis free terrain data usa new york yates gis'

distance = 221
spam score = 29
title = 'webgis free terrain data usa tennessee henderson gis'

distance = 227
spam score = 30
title = 'webgis free lulc data usa new york seneca gis'

distance = 233
spam score = 31
title = 'webgis free lulc data usa kentucky boyle gis'

distance = 239
spam score = 31
title = 'webgis free lulc data usa iowa osceola gis'

distance = 244
spam score = 31
title = 'webgis free lulc data usa indiana blackford gis'

distance = 249
spam score = 30
title = 'webgis free lulc data usa tennessee hancock gis'

distance = 250
spam score = 30
title = 'webgis free lulc data usa maryland frederick gis'

distance = 254
spam score = 33
title = 'webgis free lulc data usa kentucky larue gis'

distance = 254
spam score = 31
title = 'webgis free terrain data usa west virginia summers gis'

distance = 257
spam score = 31
title = 'webgis free lulc data usa maryland st marys gis'

distance = 257
spam score = 32
title = 'webgis free lulc data usa ohio geauga gis'

distance = 261
spam score = 31
title = 'webgis free lulc data usa indiana parke gis'

distance = 265
spam score = 34
title = 'webgis free lulc data usa indiana adams gis'

distance = 278
spam score = 31
title = 'webgis free lulc data usa ohio highland gis'

distance = 279
spam score = 32
title = 'webgis free terrain data usa idaho lewis gis'

distance = 279
spam score = 33
title = 'webgis free lulc data usa missouri mercer gis'

distance = 280
spam score = 31
title = 'webgis free lulc data usa missouri jefferson gis'

distance = 283
spam score = 30
title = 'webgis free lulc data usa pennsylvania armstrong gis'

distance = 283
spam score = 30
title = 'webgis free lulc data usa missouri jefferson gis'

distance = 337
spam score = 31
title = 'webgis free terrain data usa michigan oceana gis'

distance = 339
spam score = 30
title = 'webgis free lulc data usa georgia candler gis'

distance = 339
spam score = 29
title = 'webgis free lulc data usa mississippi itawamba gis'

distance = 340
spam score = 34
title = 'webgis free lulc data usa louisiana east baton rouge gis'

distance = 340
spam score = 29
title = 'webgis free lulc data usa north carolina buncombe gis'

distance = 340
spam score = 31
title = 'webgis free terrain data usa idaho payette gis'

distance = 340
spam score = 30
title = 'webgis free lulc data usa south carolina newberry gis'

distance = 342
spam score = 31
title = 'webgis free lulc data usa south carolina newberry gis'

distance = 343
spam score = 27
title = 'webgis free lulc data usa kansas lyon gis'

distance = 345
spam score = 32
title = 'webgis free terrain data usa georgia dawson gis'

distance = 355
spam score = 26
title = 'webgis free lulc data usa illinois mason gis'

distance = 356
spam score = 25
title = 'webgis free lulc data usa illinois christian gis'

distance = 357
spam score = 32
title = 'webgis free terrain data usa georgia bartow gis'

distance = 357
spam score = 30
title = 'webgis free lulc data usa colorado douglas gis'

distance = 358
spam score = 32
title = 'webgis free lulc data usa kansas crawford gis'

distance = 358
spam score = 32
title = 'webgis free lulc data usa massachusetts dukes gis'

distance = 358
spam score = 32
title = 'webgis free lulc data usa wisconsin rock gis'

distance = 359
spam score = 28
title = 'webgis free terrain data usa michigan crawford gis'

distance = 360
spam score = 31
title = 'webgis free lulc data usa arkansas nevada gis'

distance = 361
spam score = 31
title = 'webgis free lulc data usa tennessee hardeman gis'

distance = 375
spam score = 33
title = 'webgis free lulc data usa georgia dougherty gis'

distance = 376
spam score = 30
title = 'webgis free lulc data usa illinois jo daviess gis'

distance = 376
spam score = 24
title = 'webgis free lulc data usa arkansas crittenden gis'

distance = 377
spam score = 22
title = 'webgis free terrain data usa texas collin gis'

distance = 377
spam score = 31
title = 'webgis free lulc data usa kansas cherokee gis'

distance = 377
spam score = 31
title = 'webgis free terrain data usa indiana newton gis'

distance = 377
spam score = 27
title = 'webgis free lulc data usa oklahoma greer gis'

distance = 377
spam score = 31
title = 'webgis free lulc data usa georgia brooks gis'

distance = 378
spam score = 24
title = 'webgis free lulc data usa kansas mitchell gis'

distance = 378
spam score = 23
title = 'webgis free lulc data usa alabama blount gis'

distance = 399
spam score = 24
title = 'webgis free lulc data usa arkansas saline gis'

distance = 399
spam score = 26
title = 'webgis free lulc data usa tennessee cocke gis'

distance = 399
spam score = 24
title = 'webgis free lulc data usa massachusetts plymouth gis'

distance = 399
spam score = 25
title = 'webgis free lulc data usa wisconsin waushara gis'

distance = 399
spam score = 28
title = 'webgis free terrain data usa pennsylvania franklin gis'

distance = 399
spam score = 27
title = 'webgis free lulc data usa iowa adair gis'

distance = 400
spam score = 25
title = 'webgis free lulc data usa maryland somerset gis'

distance = 400
spam score = 25
title = 'webgis free lulc data usa nebraska burt gis'

distance = 401
spam score = 31
title = 'webgis free terrain data usa iowa greene gis'

distance = 401
spam score = 30
title = 'webgis free lulc data usa michigan eaton gis'

distance = 421
spam score = 36
title = 'webgis free lulc data usa hawaii maui gis'

distance = 423
spam score = 26
title = 'webgis free lulc data usa iowa butler gis'

distance = 423
spam score = 26
title = 'webgis free lulc data usa south carolina dorchester gis'

distance = 423
spam score = 30
title = 'webgis free lulc data usa wisconsin langlade gis'

distance = 423
spam score = 26
title = 'webgis free lulc data usa kansas elk gis'

distance = 425
spam score = 26
title = 'webgis free terrain data usa new york ulster gis'

distance = 426
spam score = 27
title = 'webgis free lulc data usa south dakota lincoln gis'

distance = 426
spam score = 27
title = 'webgis free lulc data usa arkansas perry gis'

distance = 427
spam score = 29
title = 'webgis free lulc data usa michigan ionia gis'

distance = 428
spam score = 33
title = 'webgis free lulc data usa hawaii maui gis'

distance = 459
spam score = 26
title = 'webgis free lulc data usa south carolina sumter gis'

distance = 461
spam score = 25
title = 'webgis free lulc data usa oklahoma seminole gis'

distance = 461
spam score = 24
title = 'webgis free lulc data usa louisiana claiborne gis'

distance = 461
spam score = 33
title = 'webgis free lulc data usa florida collier gis'

distance = 461
spam score = 21
title = 'webgis free lulc data usa south carolina laurens gis'

distance = 462
spam score = 23
title = 'webgis free lulc data usa pennsylvania centre gis'

distance = 466
spam score = 31
title = 'webgis free lulc data usa iowa buena vista gis'

distance = 468
spam score = 24
title = 'webgis free lulc data usa alabama etowah gis'

distance = 469
spam score = 31
title = 'webgis free lulc data usa pennsylvania monroe gis'

distance = 475
spam score = 26
title = 'webgis free lulc data usa texas calhoun gis'

distance = 508
spam score = 28
title = 'webgis free lulc data usa illinois la salle gis'

distance = 510
spam score = 25
title = 'webgis free lulc data usa colorado fremont gis'

distance = 514
spam score = 26
title = 'webgis free lulc data usa louisiana lafourche gis'

distance = 514
spam score = 23
title = 'webgis free lulc data usa oklahoma blaine gis'

distance = 515
spam score = 26
title = 'webgis free lulc data usa louisiana lafourche gis'

distance = 515
spam score = 22
title = 'webgis free lulc data usa texas burnet gis'

distance = 517
spam score = 26
title = 'webgis free lulc data usa louisiana lafourche gis'

distance = 519
spam score = 26
title = 'webgis free lulc data usa oklahoma tulsa gis'

distance = 520
spam score = 25
title = 'webgis free lulc data usa michigan ontonagon gis'

distance = 523
spam score = 27
title = 'webgis free lulc data usa colorado chaffee gis'

distance = 626
spam score = 35
title = 'webgis free lulc data usa washington san juan gis'

distance = 629
spam score = 22
title = 'webgis free lulc data usa maine hancock gis'

distance = 631
spam score = 34
title = 'webgis free terrain data usa hawaii maui gis'

distance = 633
spam score = 23
title = 'webgis free lulc data usa south dakota potter gis'

distance = 637
spam score = 24
title = 'webgis free lulc data usa north dakota billings gis'

distance = 649
spam score = 23
title = 'webgis free lulc data usa montana wibaux gis'

distance = 653
spam score = 20
title = 'webgis free lulc data usa maine hancock gis'

distance = 657
spam score = 24
title = 'webgis free lulc data usa montana toole gis'

distance = 661
spam score = 27
title = 'webgis free lulc data usa idaho fremont gis'

distance = 668
spam score = 26
title = 'webgis free terrain data usa idaho twin falls gis'

distance = 250
spam score = 49
title = ''

distance = 250
spam score = 47
title = ''

distance = 251
spam score = 52
title = ''

distance = 255
spam score = 48
title = ''

distance = 255
spam score = 47
title = ''

distance = 259
spam score = 54
title = ''

distance = 259
spam score = 51
title = ''

distance = 259
spam score = 51
title = ''

distance = 260
spam score = 48
title = ''

distance = 274
spam score = 47
title = ''

distance = 285
spam score = 47
title = ''

distance = 288
spam score = 47
title = ''

distance = 289
spam score = 48
title = ''

distance = 295
spam score = 45
title = ''

distance = 296
spam score = 50
title = ''

distance = 297
spam score = 53
title = ''

distance = 300
spam score = 45
title = ''

distance = 301
spam score = 38
title = ''

distance = 302
spam score = 51
title = ''

distance = 307
spam score = 50
title = ''

distance = 349
spam score = 55
title = ''

distance = 349
spam score = 50
title = ''

distance = 350
spam score = 37
title = ''

distance = 351
spam score = 50
title = ''

distance = 351
spam score = 52
title = ''

distance = 351
spam score = 49
title = ''

distance = 352
spam score = 40
title = ''

distance = 352
spam score = 51
title = ''

distance = 353
spam score = 38
title = ''

distance = 354
spam score = 41
title = ''

distance = 380
spam score = 35
title = ''

distance = 381
spam score = 42
title = ''

distance = 382
spam score = 50
title = ''

distance = 382
spam score = 50
title = ''

distance = 384
spam score = 52
title = ''

distance = 385
spam score = 38
title = ''

distance = 386
spam score = 48
title = ''

distance = 387
spam score = 38
title = ''

distance = 387
spam score = 51
title = ''

distance = 388
spam score = 40
title = ''

distance = 401
spam score = 42
title = ''

distance = 402
spam score = 53
title = ''

distance = 402
spam score = 52
title = ''

distance = 402
spam score = 53
title = ''

distance = 403
spam score = 41
title = ''

distance = 403
spam score = 60
title = ''

distance = 405
spam score = 52
title = ''

distance = 405
spam score = 46
title = ''

distance = 405
spam score = 44
title = ''

distance = 405
spam score = 43
title = ''

distance = 414
spam score = 47
title = ''

distance = 414
spam score = 53
title = ''

distance = 414
spam score = 48
title = ''

distance = 415
spam score = 45
title = ''

distance = 415
spam score = 48
title = ''

distance = 415
spam score = 47
title = ''

distance = 416
spam score = 52
title = ''

distance = 417
spam score = 44
title = ''

distance = 417
spam score = 41
title = ''

distance = 417
spam score = 39
title = ''

distance = 427
spam score = 48
title = ''

distance = 427
spam score = 47
title = ''

distance = 428
spam score = 55
title = ''

distance = 428
spam score = 44
title = ''

distance = 429
spam score = 46
title = ''

distance = 429
spam score = 48
title = ''

distance = 432
spam score = 53
title = ''

distance = 432
spam score = 46
title = ''

distance = 433
spam score = 41
title = ''

distance = 434
spam score = 56
title = ''

distance = 445
spam score = 46
title = ''

distance = 447
spam score = 47
title = ''

distance = 449
spam score = 45
title = ''

distance = 450
spam score = 46
title = ''

distance = 451
spam score = 41
title = ''

distance = 451
spam score = 45
title = ''

distance = 451
spam score = 47
title = ''

distance = 451
spam score = 48
title = ''

distance = 457
spam score = 45
title = ''

distance = 466
spam score = 44
title = ''

distance = 568
spam score = 42
title = ''

distance = 568
spam score = 40
title = ''

distance = 570
spam score = 42
title = ''

distance = 571
spam score = 40
title = ''

distance = 575
spam score = 41
title = ''

distance = 576
spam score = 42
title = ''

distance = 576
spam score = 40
title = ''

distance = 578
spam score = 40
title = ''

distance = 580
spam score = 41
title = ''

distance = 582
spam score = 42
title = ''

distance = 652
spam score = 40
title = ''

distance = 653
spam score = 38
title = ''

distance = 655
spam score = 41
title = ''

distance = 655
spam score = 40
title = ''

distance = 655
spam score = 41
title = ''

distance = 655
spam score = 39
title = ''

distance = 657
spam score = 39
title = ''

distance = 657
spam score = 41
title = ''

distance = 660
spam score = 38
title = ''

distance = 660
spam score = 40
title = ''

distance = 700
spam score = 40
title = ''

distance = 700
spam score = 42
title = ''

distance = 703
spam score = 38
title = ''

distance = 706
spam score = 43
title = ''

distance = 717
spam score = 38
title = ''

distance = 1530
spam score = 75
title = 'access conditions for soapex data'

distance = 1563
spam score = 45
title = 'uk solas conditions of use'

distance = 1807
spam score = 52
title = 'missionary settlement in southern africa 1800 1925'

distance = 1820
spam score = 54
title = 'missionary settlement in southern africa 1800 1925'

distance = 191
spam score = 36
title = 'stalking users who searched for inderaero'

distance = 193
spam score = 44
title = 'stalking users who searched for ubai'

distance = 225
spam score = 40
title = 'stalking users who searched for teenscatshitting'

distance = 235
spam score = 35
title = 'stalking users who searched for woodflooring'

distance = 243
spam score = 45
title = 'stalking users who searched for gheto story'

distance = 248
spam score = 34
title = 'stalking users who searched for all around pool'

distance = 249
spam score = 35
title = 'stalking users who searched for arlingonas us'

distance = 255
spam score = 45
title = 'stalking users who searched for jon norris'

distance = 271
spam score = 47
title = 'stalking users who searched for rooseleny sanchez'

distance = 280
spam score = 30
title = 'stalking users who searched for infinite computers'

distance = 288
spam score = 40
title = 'stalking users who searched for phili diner'

distance = 288
spam score = 29
title = 'stalking users who searched for atlanta price'

distance = 288
spam score = 38
title = 'stalking users who searched for acangel'

distance = 289
spam score = 46
title = 'stalking users who searched for convaderm dressing'

distance = 290
spam score = 34
title = 'stalking users who searched for effexo'

distance = 293
spam score = 28
title = 'stalking users who searched for weigie board'

distance = 298
spam score = 26
title = 'stalking users who searched for edmund lowe'

distance = 298
spam score = 26
title = 'stalking users who searched for bautysupplies'

distance = 308
spam score = 45
title = 'stalking users who searched for united 20airlines 20reservations'

distance = 310
spam score = 37
title = 'stalking users who searched for new york times'

distance = 413
spam score = 49
title = 'stalking users who searched for is the show merge stil on the air'

distance = 413
spam score = 33
title = 'stalking users who searched for le'

distance = 414
spam score = 41
title = 'stalking users who searched for travel industry magazines'

distance = 414
spam score = 50
title = 'stalking users who searched for can you paint laminate'

distance = 414
spam score = 51
title = 'stalking users who searched for big city rock lyrics'

distance = 414
spam score = 33
title = 'stalking users who searched for www p'

distance = 414
spam score = 55
title = 'stalking users who searched for legend of the lost key movie'

distance = 415
spam score = 45
title = 'stalking users who searched for fall out boy music video extras'

distance = 415
spam score = 48
title = 'stalking users who searched for coster furniture'

distance = 415
spam score = 47
title = 'stalking users who searched for dimensions online'

distance = 428
spam score = 23
title = 'stalking users who searched for career counslers new york'

distance = 428
spam score = 55
title = 'stalking users who searched for www dsc edu'

distance = 428
spam score = 44
title = 'stalking users who searched for picture of a blue bird'

distance = 428
spam score = 56
title = 'stalking users who searched for laser tag nyc'

distance = 428
spam score = 41
title = 'stalking users who searched for teaching fcat science'

distance = 429
spam score = 40
title = 'stalking users who searched for mickey mouse softball'

distance = 429
spam score = 45
title = 'stalking users who searched for www future fta info'

distance = 429
spam score = 54
title = 'stalking users who searched for paywatch org'

distance = 429
spam score = 53
title = 'stalking users who searched for naked white girls'

distance = 430
spam score = 57
title = 'stalking users who searched for azfcu org'

distance = 440
spam score = 26
title = 'stalking users who searched for clementine oranges for sale'

distance = 440
spam score = 56
title = 'stalking users who searched for keira knightly quotes'

distance = 441
spam score = 56
title = 'stalking users who searched for 1 2 beans is coming for you'

distance = 441
spam score = 45
title = 'stalking users who searched for asain porno'

distance = 441
spam score = 59
title = 'stalking users who searched for www nycotbfcu org'

distance = 442
spam score = 37
title = 'stalking users who searched for k mart in pontiac illinois'

distance = 442
spam score = 56
title = 'stalking users who searched for mt juilet middle school'

distance = 442
spam score = 62
title = 'stalking users who searched for city of tempe az parks and recreations'

distance = 442
spam score = 52
title = 'stalking users who searched for g g'

distance = 442
spam score = 36
title = 'stalking users who searched for acord liability insurance'

distance = 458
spam score = 40
title = 'stalking users who searched for fun kids furniture'

distance = 459
spam score = 53
title = 'stalking users who searched for zac efron pictures'

distance = 459
spam score = 47
title = 'stalking users who searched for how to get on the show merge'

distance = 459
spam score = 49
title = 'stalking users who searched for myspace org'

distance = 460
spam score = 46
title = 'stalking users who searched for car dvd cd receivers'

distance = 460
spam score = 37
title = 'stalking users who searched for www zonzviva net'

distance = 460
spam score = 33
title = 'stalking users who searched for dreamtime baby'

distance = 460
spam score = 45
title = 'stalking users who searched for bars in southern california'

distance = 460
spam score = 55
title = 'stalking users who searched for nacogdoches maps'

distance = 460
spam score = 51
title = 'stalking users who searched for cut and paste'

distance = 472
spam score = 47
title = 'stalking users who searched for homan s sign'

distance = 472
spam score = 46
title = 'stalking users who searched for sell recipes'

distance = 472
spam score = 46
title = 'stalking users who searched for home decor stores'

distance = 472
spam score = 47
title = 'stalking users who searched for teen shopping stores'

distance = 473
spam score = 40
title = 'stalking users who searched for women s athletic wear'

distance = 473
spam score = 33
title = 'stalking users who searched for 9 0 se'

distance = 473
spam score = 44
title = 'stalking users who searched for health south of orange park florida'

distance = 473
spam score = 47
title = 'stalking users who searched for flowers aster'

distance = 473
spam score = 41
title = 'stalking users who searched for army corp of engineers parks in oklahoma'

distance = 473
spam score = 45
title = 'stalking users who searched for capex n aol'

distance = 487
spam score = 26
title = 'stalking users who searched for bike trail baltimore'

distance = 487
spam score = 51
title = 'stalking users who searched for green bulldogs ohio'

distance = 487
spam score = 52
title = 'stalking users who searched for lynchburgpark s'

distance = 487
spam score = 55
title = 'stalking users who searched for asain porn'

distance = 487
spam score = 52
title = 'stalking users who searched for laser beam history'

distance = 487
spam score = 43
title = 'stalking users who searched for southlake carroll school district'

distance = 487
spam score = 36
title = 'stalking users who searched for laser print paper'

distance = 487
spam score = 52
title = 'stalking users who searched for www myspace comwwww my'

distance = 487
spam score = 48
title = 'stalking users who searched for weston athletic club'

distance = 487
spam score = 55
title = 'stalking users who searched for www eastwidsorlittlelegue org'

distance = 500
spam score = 45
title = 'stalking users who searched for www henderson seniorcenter gov'

distance = 501
spam score = 45
title = 'stalking users who searched for aetna jobs in jacksonville florida'

distance = 501
spam score = 42
title = 'stalking users who searched for homedic products'

distance = 501
spam score = 50
title = 'stalking users who searched for wachovia human resources miami'

distance = 502
spam score = 48
title = 'stalking users who searched for www nyc gov courtofficer'

distance = 502
spam score = 35
title = 'stalking users who searched for atm porn'

distance = 502
spam score = 52
title = 'stalking users who searched for sun sentinental'

distance = 502
spam score = 35
title = 'stalking users who searched for yahoo cursors'

distance = 503
spam score = 44
title = 'stalking users who searched for aol fix it for me delete temporary files'

distance = 503
spam score = 29
title = 'stalking users who searched for science experiments with violin strings'

distance = 528
spam score = 33
title = 'stalking users who searched for mtv news tony yayo says he wishes he had outdone kanye but i m'

distance = 528
spam score = 40
title = 'stalking users who searched for community college of rhode island'

distance = 529
spam score = 44
title = 'stalking users who searched for why don t you use a thermometer as a stiring rod for scintific experiments'

distance = 529
spam score = 44
title = 'stalking users who searched for lexmark computor printer parts'

distance = 529
spam score = 34
title = 'stalking users who searched for http tna impack com'

distance = 529
spam score = 44
title = 'stalking users who searched for why don t you use a thermometer as a stiring rod in scintific experiments'

distance = 530
spam score = 33
title = 'stalking users who searched for www modlesnylons net'

distance = 530
spam score = 31
title = 'stalking users who searched for eastman kodak pictures in bird house 1933'

distance = 531
spam score = 30
title = 'stalking users who searched for wholesale curtain hardware'

distance = 532
spam score = 33
title = 'stalking users who searched for joquin phoenix pics'

distance = 1325
spam score = 48
title = 'using tags on aol stalker'

distance = 1523
spam score = 56
title = 'about aol search data scandal'

distance = 1567
spam score = 55
title = 'chris harrison searchclock aol data visualization'

distance = 1578
spam score = 73
title = '23c3 lectures and workshops'

distance = 1585
spam score = 17
title = 'aol search data mirrors'

distance = 1585
spam score = 23
title = 'aol search data mirrors'

distance = 1666
spam score = 27
title = 'stalking user 3319689'

distance = 1717
spam score = 40
title = 'tire mishap data input'

distance = 221
spam score = 38
title = 'haiti coup 1988'

distance = 224
spam score = 37
title = 'usa occupation cuba 19061909'

distance = 228
spam score = 38
title = 'china canton commune 1927'

distance = 234
spam score = 39
title = 'france tukolor war 18901892'

distance = 234
spam score = 38
title = 'france tukolor war 18901892'

distance = 243
spam score = 42
title = 'usa korea insurgency 19481949'

distance = 243
spam score = 45
title = 'britain france crisis 1895'

distance = 248
spam score = 40
title = 'britain france crisis 1895'

distance = 250
spam score = 41
title = 'usa korea insurgency 19481949'

distance = 251
spam score = 44
title = 'portugal coup 1975'

distance = 254
spam score = 50
title = 'haiti coup 1988'

distance = 255
spam score = 40
title = 'ottoman empire crete war independence 1905'

distance = 256
spam score = 41
title = 'russia tashkent conquest 1865'

distance = 256
spam score = 53
title = 'china canton commune 1927'

distance = 257
spam score = 53
title = 'usa occupation cuba 19061909'

distance = 258
spam score = 42
title = 'britain conquest bhurtpore 1826'

distance = 259
spam score = 39
title = 'korea revolt 1862'

distance = 261
spam score = 47
title = 'thailand coup 1976'

distance = 262
spam score = 40
title = 'poland riot 1957'

distance = 262
spam score = 38
title = 'france vietnam conflict 18511857'

distance = 326
spam score = 40
title = 'ecuador coup 1972'

distance = 326
spam score = 39
title = 'philippines army rebellion 1990'

distance = 326
spam score = 43
title = 'britain ceylon expedition 1815'

distance = 327
spam score = 38
title = 'usa ethnic violence ca 19661973'

distance = 327
spam score = 58
title = 'thailand massacre 1992'

distance = 327
spam score = 40
title = 'ethiopia coup 1928'

distance = 328
spam score = 41
title = 'venezuela revolution 1888'

distance = 329
spam score = 50
title = 'bangladesh military coup 1982'

distance = 330
spam score = 39
title = 'china muslim panthay uprising 18551861'

distance = 330
spam score = 41
title = 'italy ottoman empire war 19111912'

distance = 350
spam score = 55
title = 'bulgaria greece crisis 1925'

distance = 350
spam score = 53
title = 'china protests japan annexation 1879'

distance = 350
spam score = 47
title = 'philippines army rebellion 1990'

distance = 351
spam score = 43
title = 'venezuela revolution 1888'

distance = 351
spam score = 46
title = 'china rebellion 1913'

distance = 351
spam score = 42
title = 'rwanda massacre 19631964'

distance = 352
spam score = 41
title = 'india hindu muslim rioting 1982'

distance = 353
spam score = 43
title = 'italy eritrea mahdist invasion 1893'

distance = 353
spam score = 45
title = 'costa rica nicaragua rebel invasion 1960'

distance = 353
spam score = 41
title = 'usa iraq incident 1987'

distance = 381
spam score = 50
title = 'nepal demonstrations 1990'

distance = 381
spam score = 42
title = 'bolivia military coup 1951'

distance = 381
spam score = 59
title = 'canada quebec flq terrorism 19631970'

distance = 381
spam score = 35
title = 'peru bolivia war 1841'

distance = 381
spam score = 42
title = 'haiti rebel invasion 1963'

distance = 382
spam score = 40
title = 'israel plo tunis hq raid 1985'

distance = 383
spam score = 43
title = 'china japan confrontation 18821885'

distance = 383
spam score = 44
title = 'spain venezuelanbsp war 1821'

distance = 383
spam score = 40
title = 'suriname discontent 1982'

distance = 383
spam score = 61
title = 'chad coup february 1992'

distance = 415
spam score = 38
title = 'venezuela revolution 1868'

distance = 416
spam score = 50
title = 'laos thailand incident 1980'

distance = 416
spam score = 43
title = 'india gandhi assassination 1948'

distance = 416
spam score = 41
title = 'india gandhi assassination 1948'

distance = 417
spam score = 40
title = 'france morocco border clashes 1903'

distance = 417
spam score = 38
title = 'usa assassination 1901'

distance = 418
spam score = 42
title = 'britain palestine massacre 1948'

distance = 418
spam score = 37
title = 'philippines revolution 1986'

distance = 418
spam score = 44
title = 'guineabissau military coup 1980'

distance = 419
spam score = 43
title = 'britain palestine massacre 1948'

distance = 481
spam score = 42
title = 'cuba coup batista 1933'

distance = 482
spam score = 38
title = 'thailand revolt 1949'

distance = 483
spam score = 37
title = 'poland riots 1956'

distance = 483
spam score = 34
title = 'russia bukhara war 1867'

distance = 486
spam score = 36
title = 'north yemen pacification ca 19191934'

distance = 486
spam score = 38
title = 'kampuchean genocide 19751979'

distance = 487
spam score = 55
title = 'colombia rebellion 1876'

distance = 487
spam score = 31
title = 'russia bukhara war 1867'

distance = 488
spam score = 44
title = 'yoni raid ca 1870s'

distance = 490
spam score = 43
title = 'guatemala protest 1944'

distance = 545
spam score = 37
title = 'venezuela civil war 18681870'

distance = 546
spam score = 39
title = 'germany south west africa herero resistance 1885'

distance = 547
spam score = 38
title = 'cambodia batdambang massacre 1954'

distance = 549
spam score = 40
title = 'samoa civil war 18801881'

distance = 552
spam score = 50
title = 'poland ussr katyn massacre 1940'

distance = 554
spam score = 36
title = 'owu ife ijebu war 18161821'

distance = 556
spam score = 47
title = 'usa apache raiding geronimo 18851886'

distance = 558
spam score = 38
title = 'brazil balaiada rebellion 18381841'

distance = 560
spam score = 46
title = 'brazil communist revolt 1935'

distance = 562
spam score = 41
title = 'uruguay coup 1898'

distance = 628
spam score = 46
title = 'samoa civil war 18931894'

distance = 629
spam score = 63
title = 'portugal angola war 19071910'

distance = 629
spam score = 40
title = 'usa kiowa war 1874'

distance = 630
spam score = 36
title = 'usa kiowa war 1874'

distance = 631
spam score = 58
title = 'burundi tutsi hutu rebellion 1996present'

distance = 632
spam score = 49
title = 'ghana ethnic violence 19941995'

distance = 632
spam score = 39
title = 'france trarza war 1825'

distance = 633
spam score = 47
title = 'bolivia peru war 18271829'

distance = 633
spam score = 43
title = 'congo stanleyville secession 19601961'

distance = 635
spam score = 47
title = 'ottoman empire persia war 18211823'

distance = 732
spam score = 63
title = 'ceylon sri lanka pm assassination 1959'

distance = 732
spam score = 64
title = 'france algiers blockade 18271829'

distance = 734
spam score = 40
title = 'ibadan ilorin war 1840'

distance = 734
spam score = 50
title = 'ceylon sri lanka pm assassination 1959'

distance = 734
spam score = 52
title = 'lebanon beirut christian shia violence 19691970'

distance = 736
spam score = 44
title = 'mexico revolt 1996'

distance = 737
spam score = 45
title = 'assassination nadir shah 1933'

distance = 739
spam score = 39
title = 'mexico revolt 1996'

distance = 742
spam score = 56
title = 'czechoslovakia hungary war 1919'

distance = 744
spam score = 38
title = 'usa mexico california revolt 1846'

distance = 966
spam score = 70
title = 'britain netherlands algiers expedition 1816'

distance = 966
spam score = 58
title = 'britain blockade west africa 1827'

distance = 978
spam score = 60
title = 'britain blockade west africa 1827'

distance = 1034
spam score = 60
title = 'ottoman empire egypt sudan invasion 18201838'

distance = 1036
spam score = 44
title = 'ottoman empire egypt sudan invasion 18201838'

distance = 1042
spam score = 51
title = 'cambodia revolt 19671970'

distance = 1056
spam score = 41
title = 'lebanon druse leader assassination 1977'

distance = 1116
spam score = 40
title = 'peru apra rebellion 1932'

distance = 25
spam score = 29
title = ''

distance = 25
spam score = 32
title = ''

distance = 25
spam score = 27
title = ''

distance = 25
spam score = 32
title = ''

distance = 25
spam score = 27
title = ''

distance = 25
spam score = 25
title = ''

distance = 33
spam score = 27
title = ''

distance = 33
spam score = 31
title = ''

distance = 42
spam score = 29
title = ''

distance = 42
spam score = 26
title = ''

distance = 42
spam score = 26
title = ''

distance = 42
spam score = 30
title = ''

distance = 42
spam score = 26
title = ''

distance = 44
spam score = 29
title = ''

distance = 49
spam score = 24
title = ''

distance = 49
spam score = 29
title = ''

distance = 49
spam score = 28
title = ''

distance = 51
spam score = 27
title = ''

distance = 51
spam score = 27
title = ''

distance = 54
spam score = 26
title = ''

distance = 54
spam score = 26
title = ''

distance = 58
spam score = 50
title = ''

distance = 58
spam score = 51
title = ''

distance = 62
spam score = 47
title = ''

distance = 62
spam score = 40
title = ''

distance = 62
spam score = 46
title = ''

distance = 62
spam score = 46
title = ''

distance = 62
spam score = 50
title = ''

distance = 66
spam score = 26
title = ''

distance = 69
spam score = 43
title = ''

distance = 69
spam score = 39
title = ''

distance = 69
spam score = 43
title = ''

distance = 69
spam score = 32
title = ''

distance = 69
spam score = 38
title = ''

distance = 69
spam score = 49
title = ''

distance = 69
spam score = 44
title = ''

distance = 69
spam score = 39
title = ''

distance = 69
spam score = 34
title = ''

distance = 69
spam score = 48
title = ''

distance = 87
spam score = 42
title = ''

distance = 91
spam score = 35
title = ''

distance = 97
spam score = 41
title = ''

distance = 97
spam score = 38
title = ''

distance = 106
spam score = 34
title = ''

distance = 191
spam score = 24
title = ''

distance = 769
spam score = 20
title = ''

distance = 769
spam score = 21
title = ''

distance = 770
spam score = 22
title = ''

distance = 770
spam score = 22
title = ''

distance = 782
spam score = 23
title = ''

distance = 790
spam score = 22
title = ''

distance = 790
spam score = 22
title = ''

distance = 790
spam score = 22
title = ''

distance = 797
spam score = 20
title = ''

distance = 797
spam score = 20
title = ''

distance = 797
spam score = 21
title = ''

distance = 800
spam score = 21
title = ''

distance = 800
spam score = 22
title = ''

distance = 800
spam score = 20
title = ''

distance = 801
spam score = 21
title = ''

distance = 801
spam score = 21
title = ''

distance = 803
spam score = 22
title = ''

distance = 803
spam score = 21
title = ''

distance = 803
spam score = 21
title = ''

distance = 828
spam score = 33
title = ''

distance = 871
spam score = 20
title = ''

distance = 878
spam score = 20
title = ''

distance = 881
spam score = 19
title = ''

distance = 1412
spam score = 23
title = ''

distance = 1412
spam score = 23
title = ''

distance = 175
spam score = 30
title = ''

distance = 208
spam score = 27
title = ''

distance = 211
spam score = 26
title = ''

distance = 212
spam score = 28
title = ''

distance = 214
spam score = 24
title = ''

distance = 216
spam score = 26
title = ''

distance = 216
spam score = 26
title = ''

distance = 218
spam score = 25
title = ''

distance = 220
spam score = 28
title = ''

distance = 220
spam score = 34
title = ''

distance = 220
spam score = 28
title = ''

distance = 221
spam score = 33
title = ''

distance = 221
spam score = 27
title = ''

distance = 221
spam score = 38
title = ''

distance = 222
spam score = 43
title = ''

distance = 222
spam score = 28
title = ''

distance = 223
spam score = 30
title = ''

distance = 223
spam score = 24
title = ''

distance = 223
spam score = 30
title = ''

distance = 224
spam score = 36
title = ''

distance = 269
spam score = 35
title = ''

distance = 269
spam score = 32
title = ''

distance = 273
spam score = 39
title = ''

distance = 277
spam score = 43
title = ''

distance = 277
spam score = 27
title = ''

distance = 278
spam score = 29
title = ''

distance = 279
spam score = 32
title = ''

distance = 280
spam score = 26
title = ''

distance = 282
spam score = 40
title = ''

distance = 282
spam score = 30
title = ''

distance = 313
spam score = 40
title = ''

distance = 315
spam score = 37
title = ''

distance = 315
spam score = 31
title = ''

distance = 317
spam score = 35
title = ''

distance = 320
spam score = 28
title = ''

distance = 321
spam score = 36
title = ''

distance = 322
spam score = 27
title = ''

distance = 325
spam score = 26
title = ''

distance = 325
spam score = 29
title = ''

distance = 326
spam score = 45
title = ''

distance = 356
spam score = 32
title = ''

distance = 357
spam score = 33
title = ''

distance = 357
spam score = 26
title = ''

distance = 357
spam score = 27
title = ''

distance = 361
spam score = 29
title = ''

distance = 363
spam score = 25
title = ''

distance = 365
spam score = 40
title = ''

distance = 366
spam score = 26
title = ''

distance = 367
spam score = 35
title = ''

distance = 369
spam score = 24
title = ''

distance = 397
spam score = 30
title = ''

distance = 398
spam score = 27
title = ''

distance = 399
spam score = 36
title = ''

distance = 399
spam score = 35
title = ''

distance = 400
spam score = 27
title = ''

distance = 402
spam score = 42
title = ''

distance = 403
spam score = 30
title = ''

distance = 407
spam score = 31
title = ''

distance = 407
spam score = 28
title = ''

distance = 409
spam score = 47
title = ''

distance = 438
spam score = 31
title = ''

distance = 440
spam score = 38
title = ''

distance = 441
spam score = 28
title = ''

distance = 443
spam score = 39
title = ''

distance = 447
spam score = 39
title = ''

distance = 448
spam score = 31
title = ''

distance = 449
spam score = 31
title = ''

distance = 453
spam score = 36
title = ''

distance = 453
spam score = 42
title = ''

distance = 455
spam score = 32
title = ''

distance = 494
spam score = 23
title = ''

distance = 495
spam score = 41
title = ''

distance = 497
spam score = 27
title = ''

distance = 497
spam score = 33
title = ''

distance = 497
spam score = 25
title = ''

distance = 499
spam score = 26
title = ''

distance = 502
spam score = 43
title = ''

distance = 502
spam score = 37
title = ''

distance = 503
spam score = 28
title = ''

distance = 504
spam score = 33
title = ''

distance = 607
spam score = 27
title = ''

distance = 608
spam score = 29
title = ''

distance = 608
spam score = 38
title = ''

distance = 609
spam score = 35
title = ''

distance = 609
spam score = 26
title = ''

distance = 612
spam score = 40
title = ''

distance = 615
spam score = 37
title = ''

distance = 618
spam score = 32
title = ''

distance = 621
spam score = 48
title = ''

distance = 623
spam score = 32
title = ''

distance = 737
spam score = 37
title = ''

distance = 737
spam score = 25
title = ''

distance = 737
spam score = 31
title = ''

distance = 748
spam score = 41
title = ''

distance = 770
spam score = 35
title = ''

distance = 780
spam score = 35
title = ''

distance = 791
spam score = 29
title = ''

distance = 798
spam score = 40
title = ''

distance = 823
spam score = 29
title = ''

distance = 836
spam score = 33
title = ''

distance = 1138
spam score = 31
title = ''

distance = 1202
spam score = 37
title = ''

distance = 1267
spam score = 33
title = ''

distance = 1289
spam score = 47
title = ''

distance = 1559
spam score = 39
title = ''

distance = 1636
spam score = 64
title = 'wigenweb project a proud part of the usgenweb project'

distance = 1670
spam score = 40
title = 'absolute gamers files archive quake2levelsprefabs'

distance = 1770
spam score = 46
title = ''

distance = 233
spam score = 89
title = 'magnolia praecocissima information from the global compendium of weeds gcw'

distance = 242
spam score = 82
title = 'zanthoxylum piperitum information from the global compendium of weeds gcw'

distance = 244
spam score = 86
title = 'ilex serrata information from the global compendium of weeds gcw'

distance = 244
spam score = 89
title = 'ballota damascena information from the global compendium of weeds gcw'

distance = 247
spam score = 90
title = 'ilex integra information from the global compendium of weeds gcw'

distance = 252
spam score = 90
title = 'pancratium tortuosum information from the global compendium of weeds gcw'

distance = 255
spam score = 89
title = 'lactuca versicolor information from the global compendium of weeds gcw'

distance = 255
spam score = 89
title = 'lafoensia pacari information from the global compendium of weeds gcw'

distance = 255
spam score = 88
title = 'balanites aegyptiaca information from the global compendium of weeds gcw'

distance = 256
spam score = 86
title = 'fagonia glutinosa information from the global compendium of weeds gcw'

distance = 256
spam score = 90
title = 'jasminum floribundum information from the global compendium of weeds gcw'

distance = 257
spam score = 88
title = 'maerua crassifolia information from the global compendium of weeds gcw'

distance = 258
spam score = 89
title = 'pancratium sickenbergeri information from the global compendium of weeds gcw'

distance = 258
spam score = 90
title = 'lactuca runcinata information from the global compendium of weeds gcw'

distance = 258
spam score = 82
title = 'wedelia gracilis information from the global compendium of weeds gcw'

distance = 259
spam score = 89
title = 'najas armata information from the global compendium of weeds gcw'

distance = 259
spam score = 88
title = 'lactuca stolonifera information from the global compendium of weeds gcw'

distance = 260
spam score = 89
title = 'bacopa calycina information from the global compendium of weeds gcw'

distance = 260
spam score = 89
title = 'ilysanthes parviflora information from the global compendium of weeds gcw'

distance = 262
spam score = 82
title = 'wahlenbergia etbaica information from the global compendium of weeds gcw'

distance = 343
spam score = 87
title = 'ocimum micrantum information from the global compendium of weeds gcw'

distance = 343
spam score = 90
title = 'iberis pinnata information from the global compendium of weeds gcw'

distance = 343
spam score = 93
title = 'daphne odora information from the global compendium of weeds gcw'

distance = 343
spam score = 88
title = 'palicourea grandiflora information from the global compendium of weeds gcw'

distance = 343
spam score = 90
title = 'oberonia ponapensis information from the global compendium of weeds gcw'

distance = 343
spam score = 88
title = 'baccharis neglecta information from the global compendium of weeds gcw'

distance = 344
spam score = 89
title = 'echinodorus bolivianus information from the global compendium of weeds gcw'

distance = 344
spam score = 81
title = 'sagittaria chilensis information from the global compendium of weeds gcw'

distance = 344
spam score = 87
title = 'macroptilium prostratum information from the global compendium of weeds gcw'

distance = 344
spam score = 88
title = 'yushania microphylla information from the global compendium of weeds gcw'

distance = 372
spam score = 89
title = 'abutilon crispum information from the global compendium of weeds gcw'

distance = 373
spam score = 83
title = 'taeniophyllum petrophilium information from the global compendium of weeds gcw'

distance = 373
spam score = 95
title = 'narcissus jonquilla information from the global compendium of weeds gcw'

distance = 374
spam score = 84
title = 'baccharis trimera information from the global compendium of weeds gcw'

distance = 374
spam score = 92
title = 'galaxia fugacissima information from the global compendium of weeds gcw'

distance = 374
spam score = 89
title = 'quercus douglasii information from the global compendium of weeds gcw'

distance = 375
spam score = 90
title = 'quercus prinoides information from the global compendium of weeds gcw'

distance = 375
spam score = 93
title = 'lagunaria patersonii information from the global compendium of weeds gcw'

distance = 375
spam score = 93
title = 'paeonia lactiflora information from the global compendium of weeds gcw'

distance = 375
spam score = 86
title = 'machaerina falcata information from the global compendium of weeds gcw'

distance = 391
spam score = 86
title = 'machaeranthera gracilis information from the global compendium of weeds gcw'

distance = 391
spam score = 88
title = 'cacalia tuberosa information from the global compendium of weeds gcw'

distance = 391
spam score = 87
title = 'quercus shumardii information from the global compendium of weeds gcw'

distance = 392
spam score = 90
title = 'ilex cornuta information from the global compendium of weeds gcw'

distance = 392
spam score = 91
title = 'galanthus elewesii information from the global compendium of weeds gcw'

distance = 392
spam score = 86
title = 'magnolia x soulangiana information from the global compendium of weeds gcw'

distance = 392
spam score = 88
title = 'pandorea ricasoliana information from the global compendium of weeds gcw'

distance = 392
spam score = 90
title = 'quercus ellipsoidalis information from the global compendium of weeds gcw'

distance = 393
spam score = 90
title = 'hakea orthorrhyncha information from the global compendium of weeds gcw'

distance = 393
spam score = 88
title = 'macrozamia communis information from the global compendium of weeds gcw'

distance = 426
spam score = 81
title = 'xagropogon littoralis information from the global compendium of weeds gcw'

distance = 428
spam score = 90
title = 'ichnanthus nemorosus information from the global compendium of weeds gcw'

distance = 428
spam score = 88
title = 'laburnum x watereri information from the global compendium of weeds gcw'

distance = 429
spam score = 92
title = 'babiana disticha information from the global compendium of weeds gcw'

distance = 429
spam score = 90
title = 'baileya multiradiata information from the global compendium of weeds gcw'

distance = 429
spam score = 92
title = 'felicia heterophylla information from the global compendium of weeds gcw'

distance = 430
spam score = 88
title = 'echinodorus argentinensis information from the global compendium of weeds gcw'

distance = 430
spam score = 89
title = 'zaluzianskya divaricata information from the global compendium of weeds gcw'

distance = 431
spam score = 91
title = 'panax trifolius information from the global compendium of weeds gcw'

distance = 432
spam score = 86
title = 'gagea pratensis information from the global compendium of weeds gcw'

distance = 487
spam score = 90
title = 'echinochloa occidentalis information from the global compendium of weeds gcw'

distance = 488
spam score = 93
title = 'calamintha glabella information from the global compendium of weeds gcw'

distance = 488
spam score = 92
title = 'danthonia californica information from the global compendium of weeds gcw'

distance = 488
spam score = 88
title = 'calamintha grandiflora information from the global compendium of weeds gcw'

distance = 491
spam score = 92
title = 'fagonia schimperi information from the global compendium of weeds gcw'

distance = 491
spam score = 84
title = 'ranunculus californicus information from the global compendium of weeds gcw'

distance = 491
spam score = 83
title = 'sagina micropetala information from the global compendium of weeds gcw'

distance = 493
spam score = 91
title = 'echinochloa holubii information from the global compendium of weeds gcw'

distance = 494
spam score = 91
title = 'lachenalia mutabilis information from the global compendium of weeds gcw'

distance = 495
spam score = 94
title = 'abies balsamea information from the global compendium of weeds gcw'

distance = 576
spam score = 89
title = 'xeranthemum inapertum information from the global compendium of weeds gcw'

distance = 577
spam score = 85
title = 'fleurya interrupta information from the global compendium of weeds gcw'

distance = 577
spam score = 88
title = 'sageretia thea information from the global compendium of weeds gcw'

distance = 579
spam score = 91
title = 'calamagrostis canadensis information from the global compendium of weeds gcw'

distance = 580
spam score = 92
title = 'echinodorus berteroi information from the global compendium of weeds gcw'

distance = 580
spam score = 84
title = 'xanthosoma undipes information from the global compendium of weeds gcw'

distance = 581
spam score = 82
title = 'saccharum floridulum information from the global compendium of weeds gcw'

distance = 582
spam score = 90
title = 'bacopa caroliniana information from the global compendium of weeds gcw'

distance = 582
spam score = 90
title = 'calamagrostis stricta information from the global compendium of weeds gcw'

distance = 582
spam score = 93
title = 'odontites vernus information from the global compendium of weeds gcw'

distance = 713
spam score = 81
title = 'urochloa humidicola information from the global compendium of weeds gcw'

distance = 717
spam score = 95
title = 'odontites verna information from the global compendium of weeds gcw'

distance = 717
spam score = 94
title = 'abutilon pictum information from the global compendium of weeds gcw'

distance = 719
spam score = 93
title = 'oemleria cerasiformis information from the global compendium of weeds gcw'

distance = 719
spam score = 85
title = 'saccharum arundinaceum information from the global compendium of weeds gcw'

distance = 722
spam score = 89
title = 'nannochloropsis oculata information from the global compendium of weeds gcw'

distance = 725
spam score = 92
title = 'kalanchoe fedtschenkoi information from the global compendium of weeds gcw'

distance = 725
spam score = 93
title = 'narcissus bulbocodium information from the global compendium of weeds gcw'

distance = 732
spam score = 94
title = 'galanthus nivalis information from the global compendium of weeds gcw'

distance = 732
spam score = 83
title = 'xanthoxalis dillenii information from the global compendium of weeds gcw'

distance = 882
spam score = 90
title = 'acacia iteaphylla information from the global compendium of weeds gcw'

distance = 885
spam score = 88
title = 'lagopsis supina information from the global compendium of weeds gcw'

distance = 885
spam score = 74
title = 'global compendium of weeds references important0031'

distance = 887
spam score = 93
title = 'paraserianthes lophantha information from the global compendium of weeds gcw'

distance = 887
spam score = 95
title = 'caesalpinia bonduc information from the global compendium of weeds gcw'

distance = 889
spam score = 94
title = 'jasminum dichotomum information from the global compendium of weeds gcw'

distance = 890
spam score = 93
title = 'ochagavia carnea information from the global compendium of weeds gcw'

distance = 891
spam score = 97
title = 'nardus stricta information from the global compendium of weeds gcw'

distance = 892
spam score = 91
title = 'kalmia polifolia information from the global compendium of weeds gcw'

distance = 897
spam score = 95
title = 'sagina maritima information from the global compendium of weeds gcw'

distance = 1310
spam score = 95
title = 'abies nordmanniana information from the global compendium of weeds gcw'

distance = 1335
spam score = 93
title = 'abelia x grandiflora information from the global compendium of weeds gcw'

distance = 1338
spam score = 95
title = 'felicia amelloides information from the global compendium of weeds gcw'

distance = 1347
spam score = 94
title = 'mackaya bella information from the global compendium of weeds gcw'

distance = 1374
spam score = 92
title = 'halleria lucida information from the global compendium of weeds gcw'

distance = 1389
spam score = 85
title = 'waterhousea floribunda information from the global compendium of weeds gcw'

distance = 1392
spam score = 94
title = 'quercus palustris information from the global compendium of weeds gcw'

distance = 1414
spam score = 95
title = 'facelis retusa information from the global compendium of weeds gcw'

distance = 1565
spam score = 92
title = 'haleakala conservation biology field station'

distance = 186
spam score = 96
title = ''

distance = 189
spam score = 95
title = ''

distance = 192
spam score = 96
title = ''

distance = 193
spam score = 95
title = ''

distance = 195
spam score = 95
title = ''

distance = 199
spam score = 94
title = ''

distance = 752
spam score = 97
title = ''

distance = 762
spam score = 92
title = ''

distance = 798
spam score = 94
title = ''

distance = 833
spam score = 98
title = ''

distance = 1074
spam score = 94
title = ''

distance = 118
spam score = 68
title = 'ab canal nr johnstonville rating table'

distance = 123
spam score = 78
title = 'ab canal nr johnstonville rating table'

distance = 130
spam score = 92
title = 'rusnapriver0hr'

distance = 132
spam score = 92
title = 'truckeeriver2hr'

distance = 132
spam score = 91
title = 'uprsacriver0hr'

distance = 135
spam score = 92
title = 'rusnapriver1hr'

distance = 137
spam score = 95
title = 'truckeeriver1hr'

distance = 137
spam score = 93
title = 'truckeeriver0hr'

distance = 137
spam score = 93
title = 'uprsacriver1hr'

distance = 137
spam score = 92
title = 'lwrsacriver0hr'

distance = 138
spam score = 94
title = 'rsa1hrprecip'

distance = 138
spam score = 92
title = 'joaquinriver0hr'

distance = 139
spam score = 94
title = 'rsa24hrprecip'

distance = 141
spam score = 94
title = 'nca1hrprecip'

distance = 142
spam score = 92
title = 'ncoastriver0hr'

distance = 143
spam score = 91
title = 'lwrsacriver1hr'

distance = 143
spam score = 93
title = 'joaquinriver2hr'

distance = 143
spam score = 94
title = 'lwrsacriver2hr'

distance = 144
spam score = 92
title = 'ncoastriver1hr'

distance = 144
spam score = 94
title = 'sca1hrprecip'

distance = 246
spam score = 89
title = 'carson and walker rivers'

distance = 247
spam score = 88
title = 'data plots'

distance = 247
spam score = 81
title = 'reservoir data lake davis dwr'

distance = 247
spam score = 82
title = 'browse cdec'

distance = 247
spam score = 77
title = 'california data exchange center'

distance = 247
spam score = 80
title = 'obssac09'

distance = 247
spam score = 81
title = 'obssac22'

distance = 247
spam score = 81
title = 'obssac29'

distance = 248
spam score = 83
title = 'dlysweq26'

distance = 248
spam score = 83
title = 'dlysweq26'

distance = 268
spam score = 83
title = 'cosumnes and mokelumne rivers'

distance = 269
spam score = 86
title = 'browse cdec'

distance = 270
spam score = 80
title = 'reservoir data englebright usace'

distance = 270
spam score = 77
title = 'storsum200606'

distance = 271
spam score = 88
title = 'not found'

distance = 272
spam score = 79
title = 'storsum200608'

distance = 272
spam score = 88
title = 'not found'

distance = 273
spam score = 82
title = 'carmel river'

distance = 273
spam score = 85
title = 'reservoir data oroville dam'

distance = 275
spam score = 83
title = 'yuba river'

distance = 321
spam score = 80
title = 'merced streams chowchilla fresno river'

distance = 323
spam score = 74
title = 'previous reports'

distance = 324
spam score = 86
title = 'current reports'

distance = 325
spam score = 88
title = 'current reports'

distance = 325
spam score = 82
title = 'current reports'

distance = 325
spam score = 74
title = 'previous reports'

distance = 325
spam score = 89
title = 'water quality information'

distance = 325
spam score = 89
title = 'current reports'

distance = 325
spam score = 57
title = 'current reports'

distance = 326
spam score = 84
title = 'current reports'

distance = 390
spam score = 94
title = 'guidance plots los laureles canyon llc'

distance = 391
spam score = 81
title = 'current reports'

distance = 392
spam score = 77
title = 'browse cdec'

distance = 392
spam score = 97
title = 'california cooperative snow surveys snow surveys background'

distance = 392
spam score = 85
title = 'previous reports'

distance = 393
spam score = 76
title = 'alameda ck nr niles rating table'

distance = 394
spam score = 54
title = 'page620081216'

distance = 394
spam score = 53
title = 'page620081225'

distance = 394
spam score = 53
title = 'page620081226'

distance = 395
spam score = 53
title = 'page6'

distance = 439
spam score = 64
title = 'current reports'

distance = 440
spam score = 92
title = 'guidance plots russian river at guerneville bridge gvb'

distance = 440
spam score = 70
title = 'current reports'

distance = 442
spam score = 84
title = 'guidance plots sacto r at fremont weir crest 335 fre'

distance = 442
spam score = 82
title = 'formatted reports available'

distance = 444
spam score = 82
title = 'formatted reports available'

distance = 445
spam score = 86
title = 'browse cdec'

distance = 445
spam score = 92
title = 'california data exchange center'

distance = 445
spam score = 79
title = 'alameda ck above div dam nr sunol ca rating table'

distance = 446
spam score = 92
title = 'guidance plots scott river near fort jones sfj'

distance = 547
spam score = 96
title = 'california statewide water conditions'

distance = 551
spam score = 59
title = 'alameda ck above div dam nr sunol ca rating table'

distance = 552
spam score = 95
title = 'guidance plots santa ynez r at narrows nr lompoc nrw'

distance = 559
spam score = 84
title = 'sactrvl'

distance = 559
spam score = 50
title = 'bear river at pleasant grove rd rating table'

distance = 561
spam score = 89
title = 'water quality information'

distance = 562
spam score = 89
title = 'water quality information'

distance = 563
spam score = 93
title = 'water quality information'

distance = 566
spam score = 85
title = 'courses200709'

distance = 567
spam score = 85
title = 'courses200609'

distance = 747
spam score = 84
title = 'cenbul0042006'

distance = 752
spam score = 84
title = 'laxffwsgx'

distance = 752
spam score = 82
title = 'cenbul0062006'

distance = 755
spam score = 53
title = 'precipday200208'

distance = 766
spam score = 71
title = 'sanmean'

distance = 768
spam score = 50
title = 'precipday199912'

distance = 769
spam score = 87
title = 'b120200805'

distance = 770
spam score = 89
title = 'b120200605'

distance = 770
spam score = 87
title = 'b120200803'

distance = 771
spam score = 94
title = 'river stages flow'

distance = 926
spam score = 95
title = 'california data exchange center'

distance = 944
spam score = 94
title = 'california data exchange center'

distance = 951
spam score = 75
title = 'end of month reservoir storage'

distance = 960
spam score = 89
title = 'cenbul'

distance = 988
spam score = 84
title = 'cenbul0052005'

distance = 992
spam score = 85
title = 'cenbul0042005'

distance = 1020
spam score = 96
title = 'california data exchange center'

distance = 1037
spam score = 75
title = 'historical csv format'

distance = 1039
spam score = 93
title = 'historical csv format'

distance = 1042
spam score = 91
title = 'historical csv format'

distance = 1567
spam score = 42
title = 'sfe wireless data acquisition'

distance = 1567
spam score = 95
title = 'sierra south about river notes'

distance = 1583
spam score = 89
title = 'frequently asked questions realtime streamflow data usgs water resources of maryland delaware and dc area wrd mddedc'

distance = 1719
spam score = 52
title = 'scientific commons l see'

distance = 1840
spam score = 37
title = 'cisnet data 28day sediment exposure results for ampelisca abdita july 2000'

distance = 306
spam score = 38
title = ''

distance = 311
spam score = 23
title = ''

distance = 341
spam score = 21
title = ''

distance = 347
spam score = 24
title = ''

distance = 358
spam score = 23
title = ''

distance = 368
spam score = 37
title = ''

distance = 368
spam score = 18
title = ''

distance = 373
spam score = 24
title = ''

distance = 387
spam score = 32
title = ''

distance = 439
spam score = 18
title = ''

distance = 464
spam score = 32
title = ''

distance = 511
spam score = 21
title = ''

distance = 520
spam score = 19
title = ''

distance = 563
spam score = 21
title = ''

distance = 618
spam score = 26
title = ''

distance = 627
spam score = 22
title = ''

distance = 633
spam score = 24
title = ''

distance = 654
spam score = 22
title = ''

distance = 744
spam score = 29
title = ''

distance = 1249
spam score = 24
title = ''

distance = 1257
spam score = 31
title = ''

distance = 531
spam score = 39
title = ''

distance = 536
spam score = 56
title = ''

distance = 645
spam score = 72
title = ''

distance = 695
spam score = 53
title = ''

distance = 345
spam score = 38
title = ''

distance = 347
spam score = 40
title = ''

distance = 353
spam score = 38
title = ''

distance = 353
spam score = 35
title = ''

distance = 354
spam score = 39
title = ''

distance = 356
spam score = 37
title = ''

distance = 359
spam score = 39
title = ''

distance = 362
spam score = 40
title = ''

distance = 362
spam score = 40
title = ''

distance = 363
spam score = 36
title = ''

distance = 366
spam score = 37
title = ''

distance = 368
spam score = 36
title = ''

distance = 371
spam score = 36
title = ''

distance = 371
spam score = 35
title = ''

distance = 371
spam score = 38
title = ''

distance = 372
spam score = 39
title = ''

distance = 374
spam score = 35
title = ''

distance = 375
spam score = 34
title = ''

distance = 378
spam score = 37
title = ''

distance = 380
spam score = 37
title = ''

distance = 397
spam score = 40
title = ''

distance = 397
spam score = 37
title = ''

distance = 398
spam score = 39
title = ''

distance = 399
spam score = 35
title = ''

distance = 399
spam score = 38
title = ''

distance = 401
spam score = 36
title = ''

distance = 404
spam score = 33
title = ''

distance = 405
spam score = 34
title = ''

distance = 406
spam score = 35
title = ''

distance = 407
spam score = 35
title = ''

distance = 414
spam score = 41
title = ''

distance = 415
spam score = 39
title = ''

distance = 417
spam score = 39
title = ''

distance = 418
spam score = 38
title = ''

distance = 418
spam score = 37
title = ''

distance = 419
spam score = 42
title = ''

distance = 419
spam score = 40
title = ''

distance = 419
spam score = 42
title = ''

distance = 420
spam score = 34
title = ''

distance = 422
spam score = 36
title = ''

distance = 426
spam score = 38
title = ''

distance = 431
spam score = 39
title = ''

distance = 432
spam score = 37
title = ''

distance = 433
spam score = 42
title = ''

distance = 433
spam score = 37
title = ''

distance = 434
spam score = 35
title = ''

distance = 435
spam score = 38
title = ''

distance = 440
spam score = 39
title = ''

distance = 440
spam score = 42
title = ''

distance = 440
spam score = 39
title = ''

distance = 462
spam score = 37
title = ''

distance = 462
spam score = 39
title = ''

distance = 463
spam score = 35
title = ''

distance = 466
spam score = 30
title = ''

distance = 467
spam score = 34
title = ''

distance = 468
spam score = 41
title = ''

distance = 469
spam score = 29
title = ''

distance = 469
spam score = 30
title = ''

distance = 472
spam score = 36
title = ''

distance = 477
spam score = 30
title = ''

distance = 490
spam score = 29
title = ''

distance = 491
spam score = 32
title = ''

distance = 492
spam score = 32
title = ''

distance = 493
spam score = 28
title = ''

distance = 493
spam score = 37
title = ''

distance = 493
spam score = 36
title = ''

distance = 494
spam score = 33
title = ''

distance = 495
spam score = 30
title = ''

distance = 498
spam score = 34
title = ''

distance = 500
spam score = 32
title = ''

distance = 509
spam score = 32
title = ''

distance = 510
spam score = 35
title = ''

distance = 511
spam score = 37
title = ''

distance = 514
spam score = 37
title = ''

distance = 516
spam score = 32
title = ''

distance = 518
spam score = 32
title = ''

distance = 520
spam score = 35
title = ''

distance = 522
spam score = 31
title = ''

distance = 522
spam score = 34
title = ''

distance = 525
spam score = 31
title = ''

distance = 539
spam score = 36
title = ''

distance = 544
spam score = 32
title = ''

distance = 546
spam score = 42
title = ''

distance = 549
spam score = 32
title = ''

distance = 554
spam score = 39
title = ''

distance = 554
spam score = 35
title = ''

distance = 554
spam score = 34
title = ''

distance = 555
spam score = 33
title = ''

distance = 556
spam score = 36
title = ''

distance = 563
spam score = 36
title = ''

distance = 985
spam score = 33
title = ''

distance = 991
spam score = 33
title = ''

distance = 1008
spam score = 34
title = ''

distance = 1014
spam score = 33
title = ''

distance = 1014
spam score = 33
title = ''

distance = 1023
spam score = 35
title = ''

distance = 1029
spam score = 36
title = ''

distance = 1034
spam score = 37
title = ''

distance = 1066
spam score = 33
title = ''

distance = 1180
spam score = 40
title = ''

distance = 1772
spam score = 55
title = 'echo basic pcspeaker driver'

distance = 136
spam score = 75
title = 'united states montana park free gis data gis data depot'

distance = 143
spam score = 79
title = 'united states montana carter free gis data gis data depot'

distance = 148
spam score = 74
title = 'united states montana carbon free gis data gis data depot'

distance = 153
spam score = 76
title = 'united states kentucky butler free gis data gis data depot'

distance = 155
spam score = 80
title = 'united states wisconsin green free gis data gis data depot'

distance = 155
spam score = 77
title = 'united states kentucky caldwell free gis data gis data depot'

distance = 156
spam score = 76
title = 'united states pennsylvania centre free gis data gis data depot'

distance = 164
spam score = 76
title = 'united states pennsylvania adams free gis data gis data depot'

distance = 166
spam score = 76
title = 'united states pennsylvania lackawanna free gis data gis data depot'

distance = 166
spam score = 74
title = 'united states virginia grayson free gis data gis data depot'

distance = 167
spam score = 76
title = 'united states kentucky carroll free gis data gis data depot'

distance = 167
spam score = 75
title = 'united states kentucky elliott free gis data gis data depot'

distance = 170
spam score = 74
title = 'united states pennsylvania luzerne free gis data gis data depot'

distance = 174
spam score = 75
title = 'united states pennsylvania mercer free gis data gis data depot'

distance = 175
spam score = 79
title = 'united states tennessee coffee free gis data gis data depot'

distance = 176
spam score = 77
title = 'united states pennsylvania northumberland free gis data gis data depot'

distance = 176
spam score = 76
title = 'united states pennsylvania mifflin free gis data gis data depot'

distance = 176
spam score = 67
title = 'united states oregon lincoln free gis data gis data depot'

distance = 178
spam score = 74
title = 'united states new york seneca free gis data gis data depot'

distance = 178
spam score = 75
title = 'united states tennessee hardin free gis data gis data depot'

distance = 244
spam score = 68
title = 'united states new york montgomery free gis data gis data depot'

distance = 244
spam score = 63
title = 'united states pennsylvania beaver free gis data gis data depot'

distance = 245
spam score = 64
title = 'united states north dakota slope free gis data gis data depot'

distance = 245
spam score = 79
title = 'united states tennessee clay free gis data gis data depot'

distance = 245
spam score = 76
title = 'united states new york franklin free gis data gis data depot'

distance = 245
spam score = 77
title = 'united states florida jefferson free gis data gis data depot'

distance = 246
spam score = 77
title = 'united states pennsylvania franklin free gis data gis data depot'

distance = 248
spam score = 64
title = 'united states north carolina madison free gis data gis data depot'

distance = 250
spam score = 80
title = 'united states idaho boundary free gis data gis data depot'

distance = 250
spam score = 78
title = 'united states louisiana concordia free gis data gis data depot'

distance = 287
spam score = 66
title = 'united states new york broome free gis data gis data depot'

distance = 287
spam score = 67
title = 'united states ohio lawrence free gis data gis data depot'

distance = 289
spam score = 80
title = 'united states alabama montgomery free gis data gis data depot'

distance = 289
spam score = 69
title = 'united states idaho ada free gis data gis data depot'

distance = 289
spam score = 70
title = 'united states kentucky harlan free gis data gis data depot'

distance = 290
spam score = 80
title = 'united states washington yakima free gis data gis data depot'

distance = 290
spam score = 68
title = 'united states kentucky green free gis data gis data depot'

distance = 293
spam score = 71
title = 'united states colorado la plata free gis data gis data depot'

distance = 295
spam score = 66
title = 'united states new york steuben free gis data gis data depot'

distance = 296
spam score = 68
title = 'united states virginia halifax free gis data gis data depot'

distance = 328
spam score = 83
title = 'united states west virginia jackson free gis data gis data depot'

distance = 329
spam score = 80
title = 'united states south carolina sumter free gis data gis data depot'

distance = 329
spam score = 74
title = 'united states texas andrews free gis data gis data depot'

distance = 329
spam score = 73
title = 'united states louisiana washington free gis data gis data depot'

distance = 330
spam score = 85
title = 'united states arkansas lawrence free gis data gis data depot'

distance = 330
spam score = 68
title = 'united states kentucky boone free gis data gis data depot'

distance = 334
spam score = 67
title = 'united states new york columbia free gis data gis data depot'

distance = 334
spam score = 80
title = 'united states michigan menominee free gis data gis data depot'

distance = 334
spam score = 66
title = 'united states south carolina allendale free gis data gis data depot'

distance = 335
spam score = 88
title = 'united states maryland caroline free gis data gis data depot'

distance = 366
spam score = 87
title = 'united states maryland baltimore free gis data gis data depot'

distance = 369
spam score = 75
title = 'united states michigan gratiot free gis data gis data depot'

distance = 371
spam score = 84
title = 'united states connecticut hartford free gis data gis data depot'

distance = 371
spam score = 87
title = 'united states maryland harford free gis data gis data depot'

distance = 371
spam score = 86
title = 'united states new jersey bergen free gis data gis data depot'

distance = 371
spam score = 87
title = 'united states maryland cecil free gis data gis data depot'

distance = 372
spam score = 70
title = 'united states arkansas crittenden free gis data gis data depot'

distance = 372
spam score = 77
title = 'united states south carolina pickens free gis data gis data depot'

distance = 372
spam score = 84
title = 'united states arkansas lincoln free gis data gis data depot'

distance = 373
spam score = 86
title = 'united states new jersey monmouth free gis data gis data depot'

distance = 406
spam score = 91
title = 'united states maine washington free gis data gis data depot'

distance = 406
spam score = 67
title = 'united states nebraska douglas free gis data gis data depot'

distance = 407
spam score = 84
title = 'united states maryland frederick free gis data gis data depot'

distance = 407
spam score = 78
title = 'united states nevada churchill free gis data gis data depot'

distance = 408
spam score = 80
title = 'united states new jersey sussex free gis data gis data depot'

distance = 410
spam score = 82
title = 'united states massachusetts franklin free gis data gis data depot'

distance = 410
spam score = 92
title = 'united states maine somerset free gis data gis data depot'

distance = 410
spam score = 84
title = 'united states alabama pickens free gis data gis data depot'

distance = 410
spam score = 77
title = 'united states south carolina orangeburg free gis data gis data depot'

distance = 411
spam score = 92
title = 'united states maine oxford free gis data gis data depot'

distance = 455
spam score = 79
title = 'united states arkansas boone free gis data gis data depot'

distance = 456
spam score = 91
title = 'united states nevada lyon free gis data gis data depot'

distance = 456
spam score = 83
title = 'united states virginia charlottesville city free gis data gis data depot'

distance = 457
spam score = 85
title = 'united states arkansas grant free gis data gis data depot'

distance = 462
spam score = 70
title = 'united states south carolina dorchester free gis data gis data depot'

distance = 463
spam score = 84
title = 'united states virginia colonial heights city free gis data gis data depot'

distance = 465
spam score = 70
title = 'united states georgia burke free gis data gis data depot'

distance = 466
spam score = 68
title = 'united states colorado moffat free gis data gis data depot'

distance = 471
spam score = 89
title = 'united states nevada washoe free gis data gis data depot'

distance = 473
spam score = 75
title = 'united states virginia danville city free gis data gis data depot'

distance = 558
spam score = 78
title = 'united states arkansas cross free gis data gis data depot'

distance = 559
spam score = 78
title = 'united states arkansas greene free gis data gis data depot'

distance = 559
spam score = 90
title = 'united states new mexico cibola free gis data gis data depot'

distance = 560
spam score = 89
title = 'united states maryland baltimore city free gis data gis data depot'

distance = 564
spam score = 89
title = 'united states new mexico mckinley free gis data gis data depot'

distance = 578
spam score = 78
title = 'united states virginia galax city free gis data gis data depot'

distance = 581
spam score = 71
title = 'united states alabama baldwin free gis data gis data depot'

distance = 600
spam score = 77
title = 'united states west virginia boone free gis data gis data depot'

distance = 604
spam score = 76
title = 'united states west virginia wirt free gis data gis data depot'

distance = 605
spam score = 76
title = 'united states west virginia harrison free gis data gis data depot'

distance = 1270
spam score = 93
title = 'northern mariana islands free gis data gis data depot'

distance = 1273
spam score = 92
title = 'united states free gis data gis data depot'

distance = 1280
spam score = 90
title = 'united states louisiana lafayette national hydrography dataset medium res 1100k free gis data gis data depot'

distance = 1290
spam score = 77
title = 'united states tennessee free gis data gis data depot'

distance = 1294
spam score = 79
title = 'thailand free gis data gis data depot'

distance = 1295
spam score = 89
title = 'united states colorado free gis data gis data depot'

distance = 1298
spam score = 92
title = 'united states connecticut countywide free gis data gis data depot'

distance = 1300
spam score = 90
title = 'french guiana free gis data gis data depot'

distance = 1301
spam score = 91
title = 'guineabissau free gis data gis data depot'

distance = 1304
spam score = 82
title = 'united states pennsylvania mckean digital line graphs dlg 100k free gis data gis data depot'

distance = 1691
spam score = 45
title = 'free gis data by type'

distance = 314
spam score = 65
title = ''

distance = 820
spam score = 75
title = ''

distance = 453
spam score = 79
title = 'jbi connect connect'

distance = 456
spam score = 80
title = 'jbi connect connect'

distance = 459
spam score = 80
title = 'jbi connect connect'

distance = 459
spam score = 80
title = 'jbi connect connect'

distance = 461
spam score = 82
title = 'jbi connect connect'

distance = 463
spam score = 80
title = 'jbi connect connect'

distance = 464
spam score = 83
title = 'jbi connect connect'

distance = 464
spam score = 81
title = 'jbi connect connect'

distance = 464
spam score = 83
title = 'jbi connect connect'

distance = 466
spam score = 83
title = 'jbi connect connect'

distance = 466
spam score = 79
title = 'jbi connect aged care'

distance = 466
spam score = 87
title = 'jbi connect connect'

distance = 467
spam score = 81
title = 'jbi connect connect'

distance = 467
spam score = 84
title = 'jbi connect aged care'

distance = 468
spam score = 87
title = 'jbi connect aged care'

distance = 468
spam score = 85
title = 'jbi connect aged care'

distance = 469
spam score = 73
title = 'jbi connect connect'

distance = 469
spam score = 87
title = 'jbi connect aged care'

distance = 469
spam score = 83
title = 'jbi connect connect'

distance = 469
spam score = 82
title = 'jbi connect connect'

distance = 497
spam score = 80
title = 'jbi connect aged care'

distance = 497
spam score = 83
title = 'jbi connect aged care'

distance = 497
spam score = 77
title = 'jbi connect aged care'

distance = 497
spam score = 81
title = 'jbi connect aged care'

distance = 497
spam score = 88
title = 'jbi connect physio'

distance = 497
spam score = 81
title = 'jbi connect physio'

distance = 497
spam score = 88
title = 'jbi connect physio'

distance = 498
spam score = 80
title = 'jbi connect aged care'

distance = 498
spam score = 88
title = 'jbi connect acute care'

distance = 498
spam score = 86
title = 'jbi connect acute care'

distance = 511
spam score = 76
title = 'jbi connect acute care'

distance = 511
spam score = 88
title = 'jbi connect physio'

distance = 511
spam score = 77
title = 'jbi connect acute care'

distance = 512
spam score = 76
title = 'jbi connect acute care'

distance = 512
spam score = 90
title = 'jbi connect acute care'

distance = 513
spam score = 85
title = 'jbi connect occupational therapy'

distance = 514
spam score = 79
title = 'jbi connect connect'

distance = 515
spam score = 76
title = 'jbi connect aged care'

distance = 515
spam score = 77
title = 'jbi connect midwifery care'

distance = 515
spam score = 79
title = 'jbi connect connect'

distance = 530
spam score = 75
title = 'jbi connect midwifery care'

distance = 530
spam score = 75
title = 'jbi connect connect'

distance = 530
spam score = 77
title = 'jbi connect midwifery care'

distance = 531
spam score = 79
title = 'jbi connect acute care'

distance = 531
spam score = 75
title = 'jbi connect midwifery care'

distance = 531
spam score = 76
title = 'jbi connect aged care'

distance = 531
spam score = 82
title = 'jbi connect midwifery care'

distance = 531
spam score = 73
title = 'jbi connect midwifery care'

distance = 531
spam score = 73
title = 'jbi connect midwifery care'

distance = 533
spam score = 77
title = 'jbi connect aged care'

distance = 550
spam score = 76
title = 'jbi connect acute care'

distance = 551
spam score = 76
title = 'jbi connect occupational therapy'

distance = 551
spam score = 75
title = 'jbi connect midwifery care'

distance = 551
spam score = 74
title = 'jbi connect occupational therapy'

distance = 552
spam score = 71
title = 'jbi connect occupational therapy'

distance = 552
spam score = 76
title = 'jbi connect occupational therapy'

distance = 553
spam score = 72
title = 'jbi connect occupational therapy'

distance = 553
spam score = 77
title = 'jbi connect connect'

distance = 553
spam score = 74
title = 'jbi connect connect'

distance = 553
spam score = 73
title = 'jbi connect physio'

distance = 585
spam score = 79
title = 'jbi connect infection control'

distance = 586
spam score = 76
title = 'jbi connect infection control'

distance = 586
spam score = 75
title = 'jbi connect infection control'

distance = 587
spam score = 76
title = 'jbi connect infection control'

distance = 587
spam score = 76
title = 'jbi connect infection control'

distance = 588
spam score = 74
title = 'jbi connect infection control'

distance = 590
spam score = 75
title = 'jbi connect infection control'

distance = 590
spam score = 78
title = 'jbi connect infection control'

distance = 590
spam score = 76
title = 'jbi connect infection control'

distance = 593
spam score = 76
title = 'jbi connect infection control'

distance = 773
spam score = 94
title = 'jbi connect occupational therapy'

distance = 773
spam score = 90
title = 'jbi connect occupational therapy'

distance = 773
spam score = 91
title = 'jbi connect occupational therapy'

distance = 773
spam score = 93
title = 'jbi connect occupational therapy'

distance = 774
spam score = 92
title = 'jbi connect occupational therapy'

distance = 774
spam score = 90
title = 'jbi connect acute care'

distance = 774
spam score = 90
title = 'jbi connect occupational therapy'

distance = 774
spam score = 89
title = 'jbi connect acute care'

distance = 774
spam score = 92
title = 'jbi connect occupational therapy'

distance = 774
spam score = 86
title = 'jbi connect occupational therapy'

distance = 780
spam score = 88
title = 'jbi connect aged care'

distance = 780
spam score = 90
title = 'jbi connect physio'

distance = 780
spam score = 87
title = 'jbi connect midwifery care'

distance = 780
spam score = 86
title = 'jbi connect midwifery care'

distance = 780
spam score = 89
title = 'jbi connect infection control'

distance = 780
spam score = 91
title = 'jbi connect midwifery care'

distance = 780
spam score = 89
title = 'jbi connect infection control'

distance = 780
spam score = 90
title = 'jbi connect midwifery care'

distance = 780
spam score = 93
title = 'jbi connect acute care'

distance = 780
spam score = 92
title = 'jbi connect midwifery care'

distance = 784
spam score = 91
title = 'jbi connect occupational therapy'

distance = 784
spam score = 92
title = 'jbi connect aged care'

distance = 784
spam score = 93
title = 'jbi connect aged care'

distance = 784
spam score = 90
title = 'jbi connect acute care'

distance = 784
spam score = 89
title = 'jbi connect midwifery care'

distance = 784
spam score = 88
title = 'jbi connect occupational therapy'

distance = 784
spam score = 88
title = 'jbi connect infection control'

distance = 784
spam score = 92
title = 'jbi connect acute care'

distance = 784
spam score = 94
title = 'jbi connect aged care'

distance = 784
spam score = 90
title = 'jbi connect midwifery care'

distance = 1692
spam score = 49
title = 'jbi connect acute care'

distance = 82
spam score = 91
title = ''

distance = 90
spam score = 92
title = ''

distance = 94
spam score = 91
title = ''

distance = 98
spam score = 91
title = ''

distance = 101
spam score = 93
title = ''

distance = 106
spam score = 92
title = ''

distance = 111
spam score = 92
title = ''

distance = 115
spam score = 94
title = ''

distance = 117
spam score = 90
title = ''

distance = 121
spam score = 91
title = ''

distance = 123
spam score = 93
title = ''

distance = 124
spam score = 94
title = ''

distance = 131
spam score = 94
title = ''

distance = 132
spam score = 93
title = ''

distance = 133
spam score = 96
title = ''

distance = 149
spam score = 94
title = ''

distance = 1276
spam score = 88
title = ''

distance = 1276
spam score = 89
title = ''

distance = 1493
spam score = 62
title = ''

distance = 1558
spam score = 74
title = ''

distance = 283
spam score = 47
title = ''

distance = 301
spam score = 44
title = ''

distance = 303
spam score = 48
title = ''

distance = 323
spam score = 45
title = ''

distance = 330
spam score = 45
title = ''

distance = 330
spam score = 44
title = ''

distance = 331
spam score = 44
title = ''

distance = 334
spam score = 42
title = ''

distance = 358
spam score = 44
title = ''

distance = 361
spam score = 45
title = ''

distance = 363
spam score = 48
title = ''

distance = 363
spam score = 48
title = ''

distance = 365
spam score = 46
title = ''

distance = 371
spam score = 42
title = ''

distance = 375
spam score = 45
title = ''

distance = 375
spam score = 43
title = ''

distance = 401
spam score = 46
title = ''

distance = 405
spam score = 48
title = ''

distance = 414
spam score = 42
title = ''

distance = 414
spam score = 42
title = ''

distance = 425
spam score = 43
title = ''

distance = 431
spam score = 46
title = ''

distance = 432
spam score = 42
title = ''

distance = 438
spam score = 44
title = ''

distance = 440
spam score = 45
title = ''

distance = 447
spam score = 44
title = ''

distance = 450
spam score = 41
title = ''

distance = 453
spam score = 44
title = ''

distance = 459
spam score = 43
title = ''

distance = 493
spam score = 45
title = ''

distance = 504
spam score = 43
title = ''

distance = 511
spam score = 42
title = ''

distance = 514
spam score = 45
title = ''

distance = 518
spam score = 43
title = ''

distance = 524
spam score = 45
title = ''

distance = 533
spam score = 43
title = ''

distance = 534
spam score = 43
title = ''

distance = 557
spam score = 43
title = ''

distance = 564
spam score = 46
title = ''

distance = 568
spam score = 45
title = ''

distance = 575
spam score = 40
title = ''

distance = 591
spam score = 45
title = ''

distance = 610
spam score = 46
title = ''

distance = 615
spam score = 41
title = ''

distance = 639
spam score = 47
title = ''

distance = 645
spam score = 41
title = ''

distance = 647
spam score = 42
title = ''

distance = 655
spam score = 43
title = ''

distance = 660
spam score = 45
title = ''

distance = 687
spam score = 42
title = ''

distance = 688
spam score = 46
title = ''

distance = 696
spam score = 43
title = ''

distance = 707
spam score = 45
title = ''

distance = 727
spam score = 44
title = ''

distance = 732
spam score = 44
title = ''

distance = 733
spam score = 43
title = ''

distance = 753
spam score = 47
title = ''

distance = 781
spam score = 33
title = ''

distance = 801
spam score = 47
title = ''

distance = 820
spam score = 49
title = ''

distance = 834
spam score = 43
title = ''

distance = 836
spam score = 40
title = ''

distance = 844
spam score = 33
title = ''

distance = 847
spam score = 44
title = ''

distance = 847
spam score = 47
title = ''

distance = 881
spam score = 44
title = ''

distance = 906
spam score = 32
title = ''

distance = 928
spam score = 43
title = ''

distance = 928
spam score = 33
title = ''

distance = 945
spam score = 26
title = ''

distance = 1055
spam score = 46
title = ''

distance = 1057
spam score = 41
title = ''

distance = 1138
spam score = 29
title = ''

distance = 1313
spam score = 47
title = ''

distance = 1470
spam score = 42
title = ''

distance = 403
spam score = 42
title = 'articles searchtext desktop and corporate search engine information and data retrieval full text search engine'

distance = 413
spam score = 39
title = 'articles corporatesearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 413
spam score = 44
title = 'articles documentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 419
spam score = 38
title = 'articles desktopdocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 422
spam score = 42
title = 'articles desktopdocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 424
spam score = 39
title = 'articles corporatesearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 426
spam score = 31
title = 'articles desktopdocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 426
spam score = 38
title = 'articles corporatesearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 429
spam score = 50
title = 'articles searchtext desktop and corporate search engine information and data retrieval full text search engine'

distance = 430
spam score = 41
title = 'articles searchengine desktop and corporate search engine information and data retrieval full text search engine'

distance = 431
spam score = 28
title = 'articles desktopsearchcorporate desktop and corporate search engine information and data retrieval full text search engine'

distance = 431
spam score = 35
title = 'articles searchtext desktop and corporate search engine information and data retrieval full text search engine'

distance = 433
spam score = 39
title = 'articles searchtext desktop and corporate search engine information and data retrieval full text search engine'

distance = 434
spam score = 31
title = 'articles corporatesearchengines desktop and corporate search engine information and data retrieval full text search engine'

distance = 434
spam score = 41
title = 'articles searchtext desktop and corporate search engine information and data retrieval full text search engine'

distance = 434
spam score = 48
title = 'articles documentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 435
spam score = 50
title = 'articles corporatesearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 437
spam score = 45
title = 'articles desktopdocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 438
spam score = 44
title = 'articles corporatesearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 438
spam score = 25
title = 'articles desktopdocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 522
spam score = 28
title = 'articles enterprisedocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 522
spam score = 32
title = 'articles desktopsearchcorporate desktop and corporate search engine information and data retrieval full text search engine'

distance = 522
spam score = 25
title = 'articles desktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 523
spam score = 40
title = 'articles textsearchtools desktop and corporate search engine information and data retrieval full text search engine'

distance = 523
spam score = 25
title = 'articles desktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 523
spam score = 33
title = 'articles corporatesearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 523
spam score = 22
title = 'articles corporatesearchengine desktop and corporate search engine information and data retrieval full text search engine'

distance = 523
spam score = 26
title = 'articles enterprisedocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 523
spam score = 27
title = 'articles desktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 523
spam score = 23
title = 'articles desktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 25
title = 'articles oraclefulltextsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 36
title = 'articles finddocuments desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 31
title = 'articles fulltextindexer desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 35
title = 'articles searchtext desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 29
title = 'articles desktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 28
title = 'articles desktopdocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 27
title = 'articles desktopdocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 31
title = 'articles bestdesktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 29
title = 'articles searchengine desktop and corporate search engine information and data retrieval full text search engine'

distance = 545
spam score = 30
title = 'articles textsearchmysql desktop and corporate search engine information and data retrieval full text search engine'

distance = 566
spam score = 30
title = 'articles enterprisedocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 566
spam score = 24
title = 'articles enterprisedocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 567
spam score = 27
title = 'articles searchtext desktop and corporate search engine information and data retrieval full text search engine'

distance = 567
spam score = 27
title = 'articles documentretrieval desktop and corporate search engine information and data retrieval full text search engine'

distance = 567
spam score = 23
title = 'articles documentmanagementsystem desktop and corporate search engine information and data retrieval full text search engine'

distance = 567
spam score = 21
title = 'articles desktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 567
spam score = 33
title = 'articles desktopsearchcorporate desktop and corporate search engine information and data retrieval full text search engine'

distance = 567
spam score = 40
title = 'articles indexingtextfile desktop and corporate search engine information and data retrieval full text search engine'

distance = 567
spam score = 21
title = 'articles textsearchtools desktop and corporate search engine information and data retrieval full text search engine'

distance = 567
spam score = 32
title = 'articles corporatesearchengines desktop and corporate search engine information and data retrieval full text search engine'

distance = 590
spam score = 36
title = 'articles documentmanagement desktop and corporate search engine information and data retrieval full text search engine'

distance = 590
spam score = 23
title = 'articles corporatesearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 590
spam score = 26
title = 'articles fileretrievaltool desktop and corporate search engine information and data retrieval full text search engine'

distance = 590
spam score = 30
title = 'articles fulltextindexer desktop and corporate search engine information and data retrieval full text search engine'

distance = 590
spam score = 33
title = 'articles enterprisedocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 590
spam score = 26
title = 'articles finddocuments desktop and corporate search engine information and data retrieval full text search engine'

distance = 590
spam score = 22
title = 'articles documentmanagement desktop and corporate search engine information and data retrieval full text search engine'

distance = 590
spam score = 23
title = 'articles enterprisedocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 591
spam score = 32
title = 'articles desktopdocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 591
spam score = 37
title = 'articles enterprisedocumentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 616
spam score = 27
title = 'articles msaccessfulltextsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 616
spam score = 31
title = 'articles bestdesktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 616
spam score = 37
title = 'articles desktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 616
spam score = 32
title = 'articles msaccessfulltextsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 616
spam score = 21
title = 'articles documentmanagement desktop and corporate search engine information and data retrieval full text search engine'

distance = 617
spam score = 23
title = 'articles indexingtextfile desktop and corporate search engine information and data retrieval full text search engine'

distance = 617
spam score = 32
title = 'articles fulltextindexer desktop and corporate search engine information and data retrieval full text search engine'

distance = 617
spam score = 27
title = 'articles bestindexingsoftware desktop and corporate search engine information and data retrieval full text search engine'

distance = 617
spam score = 21
title = 'articles documentmanagement desktop and corporate search engine information and data retrieval full text search engine'

distance = 617
spam score = 21
title = 'articles dataretrievaltools desktop and corporate search engine information and data retrieval full text search engine'

distance = 659
spam score = 32
title = 'articles fileretrievalprogram desktop and corporate search engine information and data retrieval full text search engine'

distance = 659
spam score = 23
title = 'articles indexingtextfile desktop and corporate search engine information and data retrieval full text search engine'

distance = 660
spam score = 40
title = 'articles indexingtextfile desktop and corporate search engine information and data retrieval full text search engine'

distance = 660
spam score = 37
title = 'articles dataretrievaltools desktop and corporate search engine information and data retrieval full text search engine'

distance = 660
spam score = 28
title = 'articles oracledesktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 660
spam score = 33
title = 'articles oraclefulltextsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 661
spam score = 43
title = 'articles finddocuments desktop and corporate search engine information and data retrieval full text search engine'

distance = 661
spam score = 23
title = 'articles documentmanagement desktop and corporate search engine information and data retrieval full text search engine'

distance = 661
spam score = 33
title = 'articles dataretrievaltools desktop and corporate search engine information and data retrieval full text search engine'

distance = 662
spam score = 39
title = 'articles indexingtextfile desktop and corporate search engine information and data retrieval full text search engine'

distance = 754
spam score = 46
title = 'help for our indexingtextfile desktop and corporate search engine information and data retrieval full text search engine'

distance = 754
spam score = 40
title = 'help for our mysqlfulltextsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 755
spam score = 43
title = 'help for our indexingtextfile desktop and corporate search engine information and data retrieval full text search engine'

distance = 755
spam score = 23
title = 'articles dataretrievaltools desktop and corporate search engine information and data retrieval full text search engine'

distance = 756
spam score = 32
title = 'help for our documentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 757
spam score = 30
title = 'help for our documentsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 758
spam score = 36
title = 'help for our textsearchtools desktop and corporate search engine information and data retrieval full text search engine'

distance = 758
spam score = 45
title = 'help for our textsearchmysql desktop and corporate search engine information and data retrieval full text search engine'

distance = 758
spam score = 37
title = 'help for our textsearchtools desktop and corporate search engine information and data retrieval full text search engine'

distance = 759
spam score = 42
title = 'help for our documentsearchsoftware desktop and corporate search engine information and data retrieval full text search engine'

distance = 819
spam score = 30
title = 'help for our dataretrievaltools desktop and corporate search engine information and data retrieval full text search engine'

distance = 820
spam score = 27
title = 'help for our dataretrievaltools desktop and corporate search engine information and data retrieval full text search engine'

distance = 820
spam score = 29
title = 'help for our finddocuments desktop and corporate search engine information and data retrieval full text search engine'

distance = 821
spam score = 27
title = 'help for our textsearchmysql desktop and corporate search engine information and data retrieval full text search engine'

distance = 822
spam score = 30
title = 'help for our fileretrievaltool desktop and corporate search engine information and data retrieval full text search engine'

distance = 823
spam score = 28
title = 'help for our bestdesktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 823
spam score = 31
title = 'help for our desktopsearchcorporate desktop and corporate search engine information and data retrieval full text search engine'

distance = 824
spam score = 27
title = 'help for our fulltextindexer desktop and corporate search engine information and data retrieval full text search engine'

distance = 824
spam score = 43
title = 'help for our oraclefulltextsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 828
spam score = 31
title = 'help for our desktopsearch desktop and corporate search engine information and data retrieval full text search engine'

distance = 1461
spam score = 94
title = 'searchinform search engine sdkapi existing integrations lotsia pdm hummingbird dm ssa synergic systems company'

distance = 1532
spam score = 88
title = 'support of any data sources various formats databases mail correspondence history'

distance = 1698
spam score = 90
title = 'questions macys systems and technology macys inc'

distance = 483
spam score = 71
title = ''

distance = 487
spam score = 81
title = ''

distance = 548
spam score = 77
title = ''

distance = 550
spam score = 79
title = ''

distance = 551
spam score = 77
title = ''

distance = 552
spam score = 78
title = ''

distance = 552
spam score = 76
title = ''

distance = 554
spam score = 79
title = ''

distance = 554
spam score = 79
title = ''

distance = 558
spam score = 79
title = ''

distance = 582
spam score = 79
title = ''

distance = 583
spam score = 86
title = ''

distance = 627
spam score = 79
title = ''

distance = 627
spam score = 85
title = ''

distance = 628
spam score = 84
title = ''

distance = 629
spam score = 88
title = ''

distance = 629
spam score = 77
title = ''

distance = 629
spam score = 88
title = ''

distance = 630
spam score = 75
title = ''

distance = 630
spam score = 92
title = ''

distance = 631
spam score = 83
title = ''

distance = 631
spam score = 84
title = ''

distance = 632
spam score = 82
title = ''

distance = 632
spam score = 74
title = ''

distance = 633
spam score = 83
title = ''

distance = 633
spam score = 78
title = ''

distance = 634
spam score = 92
title = ''

distance = 637
spam score = 82
title = ''

distance = 638
spam score = 83
title = ''

distance = 639
spam score = 84
title = ''

distance = 704
spam score = 81
title = ''

distance = 707
spam score = 81
title = ''

distance = 707
spam score = 90
title = ''

distance = 709
spam score = 87
title = ''

distance = 711
spam score = 85
title = ''

distance = 746
spam score = 81
title = ''

distance = 748
spam score = 86
title = ''

distance = 748
spam score = 82
title = ''

distance = 749
spam score = 81
title = ''

distance = 749
spam score = 86
title = ''

distance = 752
spam score = 92
title = ''

distance = 752
spam score = 83
title = ''

distance = 753
spam score = 83
title = ''

distance = 754
spam score = 83
title = ''

distance = 755
spam score = 78
title = ''

distance = 755
spam score = 81
title = ''

distance = 756
spam score = 79
title = ''

distance = 757
spam score = 78
title = ''

distance = 757
spam score = 76
title = ''

distance = 757
spam score = 76
title = ''

distance = 758
spam score = 79
title = ''

distance = 758
spam score = 77
title = ''

distance = 759
spam score = 79
title = ''

distance = 759
spam score = 81
title = ''

distance = 759
spam score = 75
title = ''

distance = 759
spam score = 76
title = ''

distance = 764
spam score = 79
title = ''

distance = 781
spam score = 88
title = ''

distance = 782
spam score = 90
title = ''

distance = 355
spam score = 67
title = 'infochimpsorg dataset population by continent 1970 to 2050 statistical abstract 2008 table 1296'

distance = 355
spam score = 67
title = 'infochimpsorg dataset public high school graduates by state 1980 to 2005 statistical abstract 2008 table 0263'

distance = 359
spam score = 69
title = 'infochimpsorg dataset faculty in institutions of higher education 1970 to 2005 statistical abstract 2008 table 0290'

distance = 383
spam score = 70
title = 'infochimpsorg dataset institutions of higher educationcharges 1970 to 2006 statistical abstract 2008 table 0286'

distance = 384
spam score = 66
title = 'infochimpsorg dataset population and population change by development status 1950 to 2050 statistical abstract 2008 table 1297'

distance = 396
spam score = 64
title = 'infochimpsorg dataset crime rates by state 2004 and 2005 and by type 2005 statistical abstract 2008 table 0301'

distance = 407
spam score = 70
title = 'infochimpsorg dataset use of mammography for women 40 years old and over statistical abstract 2008 table 0191'

distance = 410
spam score = 68
title = 'infochimpsorg dataset nonus citizens awarded doctorates in science and engineering by visa type and country of citizenship 1996 to 2005 statistical abstract 2008 table 0788'

distance = 416
spam score = 77
title = 'infochimpsorg dataset persons with limitation of activity caused by chronic conditions 2000 to 2005 statistical abstract 2008 table 0181'

distance = 419
spam score = 66
title = 'infochimpsorg dataset nobel prize laureates in selected sciences 1901 to 2004 statistical abstract 2008 table 0798'

distance = 422
spam score = 66
title = 'infochimpsorg dataset veterans living statistical abstract 2008 table 0506'

distance = 422
spam score = 71
title = 'infochimpsorg dataset number of governments by typestates 2002 statistical abstract 2008 table 0415'

distance = 422
spam score = 74
title = 'infochimpsorg dataset school expenditures by type of control and level of statistical abstract 2008 table 0208'

distance = 423
spam score = 67
title = 'infochimpsorg dataset world crude oil production 1980 to 2004 statistical abstract 2008 table 1346'

distance = 424
spam score = 84
title = 'infochimpsorg dataset employees in higher education institutions by sex statistical abstract 2008 table 0289'

distance = 427
spam score = 66
title = 'infochimpsorg dataset world coal production by country 1980 to 2004 statistical abstract 2008 table 1348'

distance = 434
spam score = 71
title = 'infochimpsorg dataset deaths by age and selected causes 2004 statistical abstract 2008 table 0112'

distance = 435
spam score = 53
title = 'infochimpsorg dataset highest temperature of record selected cities statistical abstract 2008 table 0378'

distance = 436
spam score = 77
title = 'infochimpsorg dataset employment in the health service industries 1990 to 2006 statistical abstract 2008 table 0153'

distance = 437
spam score = 72
title = 'infochimpsorg dataset death rates for major causes of deathstates and island areas 2004 statistical abstract 2008 table 0114'

distance = 531
spam score = 71
title = 'infochimpsorg dataset drug arrest rates for drug abuse violations statistical abstract 2008 table 0321'

distance = 531
spam score = 50
title = 'infochimpsorg dataset carbon dioxide emissions from consumption of fossil fuels by country 1980 to 2004 statistical abstract 2008 table 1314'

distance = 531
spam score = 60
title = 'infochimpsorg dataset dowjones world stock index by country and industry 1995 to 2006 statistical abstract 2008 table 1356'

distance = 532
spam score = 79
title = 'infochimpsorg dataset national aeronautics and space administrationbudget appropriations 2007 and projections 2008 to 2012 statistical abstract 2008 table 0797'

distance = 532
spam score = 69
title = 'infochimpsorg dataset wetlands on nonfederal land and water areas by land coveruse statistical abstract 2008 table 0352'

distance = 533
spam score = 63
title = 'infochimpsorg dataset state and local governmentsper capita summary of finances by state 2004 statistical abstract 2008 table 0427'

distance = 533
spam score = 69
title = 'infochimpsorg dataset first professional degrees earned in selected professions 1970 to 2004 statistical abstract 2008 table 0297'

distance = 534
spam score = 81
title = 'infochimpsorg dataset select family planning and medical service use by women 15 to 44 years of age 2002 statistical abstract 2008 table 0094'

distance = 535
spam score = 77
title = 'infochimpsorg dataset us foreign trade in selected mineral fuels 1970 to 2005 statistical abstract 2008 table 0900'

distance = 538
spam score = 70
title = 'infochimpsorg dataset injuries associated with selected consumer products 2005 statistical abstract 2008 table 0185'

distance = 572
spam score = 65
title = 'infochimpsorg dataset value of state and local government construction put in place 1993 to 2006 statistical abstract 2008 table 0930'

distance = 573
spam score = 73
title = 'infochimpsorg dataset annual revenues of selected securities industries by kind of business 1998 to 2005 statistical abstract 2008 table 1191'

distance = 573
spam score = 68
title = 'infochimpsorg dataset quantity of books sold and value of us domestic consumer expenditures 2005 to 2010 statistical abstract 2008 table 1106'

distance = 573
spam score = 61
title = 'infochimpsorg dataset securities listed on ny stock exchange 1970 to 2006 statistical abstract 2008 table 1180'

distance = 573
spam score = 82
title = 'infochimpsorg dataset employment projections by industry 2004 to 2014 statistical abstract 2008 table 0603'

distance = 574
spam score = 78
title = 'infochimpsorg dataset fire lossestotal and per capita 1980 to 2005 statistical abstract 2008 table 0345'

distance = 574
spam score = 83
title = 'infochimpsorg dataset selected servicerelated industriesnonemployer establishments and receipts by kind of business statistical abstract 2008 table 1246'

distance = 574
spam score = 64
title = 'infochimpsorg dataset us international trade in goods by related parties 2000 to 2006 statistical abstract 2008 table 1273'

distance = 574
spam score = 72
title = 'infochimpsorg dataset temporary assistance for needy families tanffamilies and recipients 1936 to 2006 statistical abstract 2008 table 0546'

distance = 575
spam score = 55
title = 'infochimpsorg dataset college and professional football summary 1990 to 2006 statistical abstract 2008 table 1217'

distance = 604
spam score = 75
title = 'infochimpsorg dataset persons enrolled in health maintenance organizations hmos by state 2005 and 2006 statistical abstract 2008 table 0145'

distance = 604
spam score = 61
title = 'infochimpsorg dataset liquefied petroleum gases 1980 to 2006 statistical abstract 2008 table 0881'

distance = 605
spam score = 81
title = 'infochimpsorg dataset employees in nonfarm establishmentsstates 2006 statistical abstract 2008 table 0613'

distance = 605
spam score = 77
title = 'infochimpsorg dataset estimated accommodation and food services sales by kinds of business 1995 to 2005 statistical abstract 2008 table 1253'

distance = 605
spam score = 69
title = 'infochimpsorg dataset school enrollment faculty graduates and financesprojections 2006 to 2016 statistical abstract 2008 table 0209'

distance = 606
spam score = 65
title = 'infochimpsorg dataset total electric net summer capacity all sectors 1990 to 2005 statistical abstract 2008 table 0910'

distance = 606
spam score = 58
title = 'infochimpsorg dataset energy imports and exports by type of fuel 1970 to 2005 statistical abstract 2008 table 0899'

distance = 606
spam score = 77
title = 'infochimpsorg dataset federal grantsinaid to state and local governments 1990 to 2007 statistical abstract 2008 table 0418'

distance = 607
spam score = 79
title = 'infochimpsorg dataset median sales price of existing onefamily homes by statistical abstract 2008 table 0943'

distance = 608
spam score = 63
title = 'infochimpsorg dataset home remodelingwork done and amount spent 2006 statistical abstract 2008 table 0966'

distance = 632
spam score = 69
title = 'infochimpsorg dataset live births deaths marriages and divorces 1950 to 2006 statistical abstract 2008 table 0077'

distance = 633
spam score = 63
title = 'infochimpsorg dataset foreign trade destination of exports and source of imports for selected countries 2004 statistical abstract 2008 table 1362'

distance = 633
spam score = 68
title = 'infochimpsorg dataset electric energy retail sales by class of service and state 1999 to 2005 statistical abstract 2008 table 0914'

distance = 635
spam score = 72
title = 'infochimpsorg dataset teacher stayers movers and leavers by sector 198889 to 200405 statistical abstract 2008 table 0243'

distance = 636
spam score = 71
title = 'infochimpsorg dataset us majorityowned affiliates of foreign companies assets sales employment land exports and imports by industry 1997 to 2004 statistical abstract 2008 table 1264'

distance = 636
spam score = 76
title = 'infochimpsorg dataset united states total and aerospace foreign trade 1965 to 2005 statistical abstract 2008 table 1280'

distance = 636
spam score = 70
title = 'infochimpsorg dataset gross domestic product components in real 2000 dollars annual percent change 1960 to 2006 statistical abstract 2008 table 0646'

distance = 637
spam score = 73
title = 'infochimpsorg dataset producer price indexes by stage of processing 1990 to 2006 statistical abstract 2008 table 0713'

distance = 638
spam score = 80
title = 'infochimpsorg dataset annual indexes of output per hour for selected naics industries 1987 to 2005 statistical abstract 2008 table 0621'

distance = 638
spam score = 73
title = 'infochimpsorg dataset administrative and support and waste management and remediation services estimated revenue 2000 to 2005 statistical abstract 2008 table 1252'

distance = 667
spam score = 74
title = 'infochimpsorg dataset transportation and warehousingestablishments revenue payroll statistical abstract 2008 table 1037'

distance = 668
spam score = 70
title = 'infochimpsorg dataset occupational employment in guam puerto rico and virgin islands 2006 statistical abstract 2008 table 1287'

distance = 668
spam score = 59
title = 'infochimpsorg dataset us international trade in goods and services exports imports and trade balance 1995 to 2006 statistical abstract 2008 table 1272'

distance = 670
spam score = 66
title = 'infochimpsorg dataset top wealth holders with net worth of 1 million or morenumber and net worth by state 2001 statistical abstract 2008 table 0697'

distance = 670
spam score = 67
title = 'infochimpsorg dataset us aircraft shipments number and value 1970 to 2006 statistical abstract 2008 table 1006'

distance = 671
spam score = 61
title = 'infochimpsorg dataset state resources expenditures and balances 2005 and 2006 statistical abstract 2008 table 0432'

distance = 671
spam score = 70
title = 'infochimpsorg dataset value of manufacturers shipments inventories and new orders by market grouping 1992 t0 2006 statistical abstract 2008 table 0982'

distance = 672
spam score = 55
title = 'infochimpsorg dataset federal budget outlays by type 1990 to 2007 statistical abstract 2008 table 0457'

distance = 672
spam score = 67
title = 'infochimpsorg dataset construction materialsproducer price indexes 1990 to 2006 statistical abstract 2008 table 0927'

distance = 673
spam score = 38
title = 'infochimpsorg dataset value of domestic nonfuel mineral production by state 2000 to 2006 statistical abstract 2008 table 0871'

distance = 701
spam score = 57
title = 'infochimpsorg dataset sectoral contributions to gross value added 1994 and 2004 statistical abstract 2008 table 1318'

distance = 701
spam score = 70
title = 'infochimpsorg dataset military personnel on active duty by location 1980 to 2006 statistical abstract 2008 table 0497'

distance = 701
spam score = 63
title = 'infochimpsorg dataset meat supply and use 1990 to 2006 statistical abstract 2008 table 0833'

distance = 702
spam score = 67
title = 'infochimpsorg dataset broiler and turkey production by state 2004 to 2006 statistical abstract 2008 table 0842'

distance = 702
spam score = 72
title = 'infochimpsorg dataset selected timber productsproducer price indexes 1980 to 2006 statistical abstract 2008 table 0856'

distance = 703
spam score = 68
title = 'infochimpsorg dataset paper and paperboardproduction new supply and ratio of new supply to real gross domestic product gdp 1980 to 2005 statistical abstract 2008 table 0858'

distance = 703
spam score = 69
title = 'infochimpsorg dataset public charter and traditional schoolsselected characteristics 20042005 statistical abstract 2008 table 0227'

distance = 703
spam score = 69
title = 'infochimpsorg dataset wholesale tradeestablishments employees and payroll 2005 statistical abstract 2008 table 1010'

distance = 703
spam score = 66
title = 'infochimpsorg dataset participation in selected sports activities 2005 statistical abstract 2008 table 1222'

distance = 703
spam score = 64
title = 'infochimpsorg dataset software publishersestimated revenue expenses and inventories 2004 and 2005 statistical abstract 2008 table 1109'

distance = 742
spam score = 71
title = 'infochimpsorg dataset timber volume growth and removal on timberland by species group and region 2002 statistical abstract 2008 table 0849'

distance = 742
spam score = 73
title = 'infochimpsorg dataset indexes of spot primary market prices 1980 to 2006 statistical abstract 2008 table 0716'

distance = 743
spam score = 63
title = 'infochimpsorg dataset victimoffender relationship in crimes of violence by characteristics of the statistical abstract 2008 table 0316'

distance = 744
spam score = 61
title = 'infochimpsorg dataset medicare benefits by type of provider 1990 to 2006 statistical abstract 2008 table 0134'

distance = 745
spam score = 65
title = 'infochimpsorg dataset electric power industry capability peak load and capacity margin 1970 to 2006 statistical abstract 2008 table 0913'

distance = 746
spam score = 57
title = 'infochimpsorg dataset department of homeland security total budget authority and personnel by organization 2006 and 2007 statistical abstract 2008 table 0512'

distance = 747
spam score = 84
title = 'infochimpsorg dataset percent of public schools reporting selected types of disciplinary problems occurring at school statistical abstract 2008 table 0236'

distance = 747
spam score = 76
title = 'infochimpsorg dataset average amount of aid received by aided undergraduates 20032004 statistical abstract 2008 table 0281'

distance = 748
spam score = 66
title = 'infochimpsorg dataset state and local financial support for postsecondary education statistical abstract 2008 table 0285'

distance = 749
spam score = 68
title = 'infochimpsorg dataset public employee retirement systemsparticipants and finances 1980 to 2005 statistical abstract 2008 table 0531'

distance = 806
spam score = 59
title = 'infochimpsorg dataset state motor vehicle registrations 1980 to 2005 statistical abstract 2008 table 1064'

distance = 806
spam score = 62
title = 'infochimpsorg dataset solar collector shipments by type enduse and market sector 1975 to 2005 statistical abstract 2008 table 0907'

distance = 806
spam score = 59
title = 'infochimpsorg dataset aircraft accidents 1983 to 2006 statistical abstract 2008 table 1045'

distance = 809
spam score = 79
title = 'infochimpsorg dataset selfdescribed religious identification of adult population 1990 and 2001 statistical abstract 2008 table 0074'

distance = 810
spam score = 62
title = 'infochimpsorg dataset crude oil imports into us by country of origin 1970 to 2006 statistical abstract 2008 table 0901'

distance = 814
spam score = 76
title = 'infochimpsorg dataset displaced workers by selected characteristics 2006 statistical abstract 2008 table 0595'

distance = 820
spam score = 58
title = 'infochimpsorg dataset selected timber products imports and exports 1990 to 2006 statistical abstract 2008 table 0853'

distance = 820
spam score = 77
title = 'infochimpsorg dataset students who are homeschooled by selected characteristics 2003 statistical abstract 2008 table 0228'

distance = 821
spam score = 56
title = 'infochimpsorg dataset automobile insuranceaverage expenditures per insured vehicle by state 1995 to 2004 statistical abstract 2008 table 1196'

distance = 821
spam score = 79
title = 'infochimpsorg dataset federal funding for the superfund brownfields statistical abstract 2008 table 0370'

distance = 1538
spam score = 90
title = 'statistical abstract of the united states'

distance = 1557
spam score = 80
title = 'ncsc workforce info database updates'

distance = 1597
spam score = 85
title = 'httpwwwclaitorscom claitors publishing division gpo books'

distance = 1602
spam score = 53
title = 'undercount mapper'

distance = 1629
spam score = 70
title = 'banco de espantildea boletiacuten estadiacutestico index of tables in chapter 4 table 449'

distance = 1652
spam score = 64
title = 'justin wolfers personal homepage'

distance = 272
spam score = 86
title = ''

distance = 284
spam score = 87
title = ''

distance = 302
spam score = 86
title = ''

distance = 303
spam score = 85
title = ''

distance = 306
spam score = 87
title = ''

distance = 328
spam score = 82
title = ''

distance = 331
spam score = 84
title = ''

distance = 331
spam score = 86
title = ''

distance = 334
spam score = 84
title = ''

distance = 343
spam score = 83
title = ''

distance = 348
spam score = 94
title = ''

distance = 367
spam score = 84
title = ''

distance = 373
spam score = 88
title = ''

distance = 383
spam score = 82
title = ''

distance = 387
spam score = 81
title = ''

distance = 398
spam score = 85
title = ''

distance = 401
spam score = 86
title = ''

distance = 403
spam score = 81
title = ''

distance = 411
spam score = 84
title = ''

distance = 411
spam score = 84
title = ''

distance = 417
spam score = 81
title = ''

distance = 417
spam score = 83
title = ''

distance = 417
spam score = 84
title = ''

distance = 423
spam score = 85
title = ''

distance = 424
spam score = 88
title = ''

distance = 433
spam score = 85
title = ''

distance = 448
spam score = 82
title = ''

distance = 456
spam score = 87
title = ''

distance = 457
spam score = 78
title = ''

distance = 464
spam score = 84
title = ''

distance = 465
spam score = 85
title = ''

distance = 470
spam score = 85
title = ''

distance = 470
spam score = 87
title = ''

distance = 481
spam score = 87
title = ''

distance = 501
spam score = 83
title = ''

distance = 515
spam score = 83
title = ''

distance = 539
spam score = 87
title = ''

distance = 549
spam score = 83
title = ''

distance = 550
spam score = 78
title = ''

distance = 553
spam score = 83
title = ''

distance = 570
spam score = 80
title = ''

distance = 596
spam score = 76
title = ''

distance = 621
spam score = 84
title = ''

distance = 631
spam score = 79
title = ''

distance = 640
spam score = 83
title = ''

distance = 643
spam score = 80
title = ''

distance = 654
spam score = 81
title = ''

distance = 655
spam score = 79
title = ''

distance = 721
spam score = 74
title = ''

distance = 747
spam score = 76
title = ''

distance = 793
spam score = 79
title = ''

distance = 805
spam score = 79
title = ''

distance = 834
spam score = 74
title = ''

distance = 861
spam score = 81
title = ''

distance = 868
spam score = 79
title = ''

distance = 896
spam score = 81
title = ''

distance = 926
spam score = 83
title = ''

distance = 933
spam score = 82
title = ''

distance = 938
spam score = 82
title = ''

distance = 959
spam score = 70
title = ''

distance = 975
spam score = 73
title = ''

distance = 995
spam score = 86
title = ''

distance = 999
spam score = 77
title = ''

distance = 1007
spam score = 74
title = ''

distance = 1007
spam score = 89
title = ''

distance = 1009
spam score = 84
title = ''

distance = 1104
spam score = 83
title = ''

distance = 1197
spam score = 76
title = ''

distance = 1219
spam score = 85
title = ''

distance = 1312
spam score = 84
title = ''

distance = 1358
spam score = 93
title = ''

distance = 179
spam score = 40
title = 'document processing time details for draftietfsmimecades'

distance = 197
spam score = 35
title = 'document processing time details for draftietfisisrfc2966bis'

distance = 200
spam score = 34
title = 'document processing time details for draftietfisisrfc4205bis'

distance = 208
spam score = 37
title = 'document processing time details for draftietfmediactrlrequirements'

distance = 211
spam score = 37
title = 'document processing time details for draftietfipdvbule'

distance = 214
spam score = 41
title = 'document processing time details for draftietfsmimerfc3369bis'

distance = 218
spam score = 38
title = 'document processing time details for draftietftcpmrfc4138bis'

distance = 221
spam score = 38
title = 'document processing time details for draftietfavtrfc3555bispart2'

distance = 225
spam score = 35
title = 'document processing time details for draftietfenumvalidationarch'

distance = 226
spam score = 39
title = 'document processing time details for draftietfrserpooloverview'

distance = 229
spam score = 41
title = 'document processing time details for draftietfisisrfc3847bis'

distance = 243
spam score = 36
title = 'document processing time details for draftietfrohctcp'

distance = 243
spam score = 31
title = 'document processing time details for draftietfatommibrfc2496bis'

distance = 245
spam score = 39
title = 'document processing time details for draftietfopesscenarios'

distance = 245
spam score = 30
title = 'document processing time details for draftietftlsecc'

distance = 246
spam score = 36
title = 'document processing time details for draftietfsmimecertcapa'

distance = 246
spam score = 40
title = 'document processing time details for draftietfpwe3celltransport'

distance = 247
spam score = 35
title = 'document processing time details for draftietfsaslgssapi'

distance = 247
spam score = 33
title = 'document processing time details for draftietfenumimservice'

distance = 248
spam score = 32
title = 'document processing time details for draftcarpenterprotocolextensions'

distance = 371
spam score = 34
title = 'document processing time details for draftietfradextrfc4590bis'

distance = 372
spam score = 38
title = 'document processing time details for draftietfl2vpnl2framework'

distance = 372
spam score = 36
title = 'document processing time details for draftreyespolicycoreextschema'

distance = 372
spam score = 39
title = 'document processing time details for draftietfmipshopfastmipv6'

distance = 372
spam score = 36
title = 'document processing time details for draftietfmplscosfielddef'

distance = 372
spam score = 28
title = 'document processing time details for draftietfipsecikemodpgroups'

distance = 373
spam score = 35
title = 'document processing time details for draftietfmplsmulticast'

distance = 374
spam score = 32
title = 'document processing time details for draftschoenwsnmpether'

distance = 374
spam score = 35
title = 'document processing time details for draftmyersikev2ocsp'

distance = 374
spam score = 42
title = 'document processing time details for draftietfidmrigmpv3'

distance = 401
spam score = 39
title = 'document processing time details for draftzennerrabbit'

distance = 402
spam score = 33
title = 'document processing time details for draftcrispinimapv'

distance = 402
spam score = 33
title = 'document processing time details for draftietfmip6ikev2ipsec'

distance = 402
spam score = 28
title = 'document processing time details for draftietfsmimesymkeydist'

distance = 403
spam score = 36
title = 'document processing time details for draftietfrmtinfofec'

distance = 403
spam score = 34
title = 'document processing time details for draftietfidrrfc2842bis'

distance = 403
spam score = 36
title = 'document processing time details for draftietfrmonmibraqmonpdu'

distance = 404
spam score = 37
title = 'document processing time details for draftherriotapplicationmultiplexed'

distance = 404
spam score = 41
title = 'document processing time details for draftietfpwe3framerelay'

distance = 405
spam score = 30
title = 'document processing time details for draftietfavtrfc4749dtxupdate'

distance = 437
spam score = 39
title = 'document processing time details for draftietfapexpresence'

distance = 437
spam score = 42
title = 'document processing time details for draftietfdhcpktckerbtckt'

distance = 437
spam score = 39
title = 'document processing time details for draftfostermgcpbasicpackages'

distance = 437
spam score = 39
title = 'document processing time details for draftohtamplslabelvalue'

distance = 437
spam score = 44
title = 'document processing time details for draftietfdhcagentsubnetselection'

distance = 438
spam score = 36
title = 'document processing time details for draftietfdhcdualstack'

distance = 438
spam score = 37
title = 'document processing time details for draftietfrohcoverreordering'

distance = 438
spam score = 35
title = 'document processing time details for draftietfpcedste'

distance = 438
spam score = 31
title = 'document processing time details for draftietfenuminfrastructure'

distance = 438
spam score = 35
title = 'document processing time details for draftietfenumedns0'

distance = 468
spam score = 30
title = 'document processing time details for draftietftsvwgdsackuse'

distance = 469
spam score = 36
title = 'document processing time details for draftietfenumunused'

distance = 469
spam score = 35
title = 'document processing time details for drafthollenbeckrfc2832bis'

distance = 469
spam score = 37
title = 'document processing time details for draftjonssonpkcs1v2dot1'

distance = 470
spam score = 38
title = 'document processing time details for draftietfgrowbgpwedgies'

distance = 471
spam score = 30
title = 'document processing time details for drafthoffmanhashattacks'

distance = 471
spam score = 40
title = 'document processing time details for draftirtfmoboptsroenhancements'

distance = 471
spam score = 38
title = 'document processing time details for draftietfsigtransignallingoversctpapplic'

distance = 473
spam score = 36
title = 'document processing time details for draftietfpwe3tdmcontrolprotocolextensi'

distance = 474
spam score = 38
title = 'document processing time details for draftietfgsmp'

distance = 509
spam score = 41
title = 'document processing time details for draftjsengidnadmin'

distance = 510
spam score = 48
title = 'document processing time details for draftietfipv63gpprecommend'

distance = 511
spam score = 37
title = 'document processing time details for drafthaverinenpppexteapsim'

distance = 511
spam score = 45
title = 'document processing time details for draftietfmplsldpcapabilities'

distance = 512
spam score = 42
title = 'document processing time details for draftietfpppextpppoveraal2class'

distance = 512
spam score = 39
title = 'document processing time details for draftmcdonaldianacharsetmib'

distance = 513
spam score = 29
title = 'document processing time details for draftietfmipshopmosdnsdiscovery'

distance = 514
spam score = 34
title = 'document processing time details for draftietfenum3761bis'

distance = 514
spam score = 41
title = 'document processing time details for draftietfgsmpmib'

distance = 515
spam score = 39
title = 'document processing time details for draftiabconsiderations'

distance = 558
spam score = 36
title = 'document processing time details for draftietfsoftwireencapssafi'

distance = 558
spam score = 34
title = 'document processing time details for draftirtfnmrgimdm'

distance = 558
spam score = 31
title = 'document processing time details for draftietfdkimoverview'

distance = 558
spam score = 35
title = 'document processing time details for drafteastlakeprotodocpov'

distance = 559
spam score = 30
title = 'document processing time details for draftietftcpmtcpsofterrors'

distance = 561
spam score = 36
title = 'document processing time details for draftietfsippingccframework'

distance = 562
spam score = 34
title = 'document processing time details for draftietfavtrtpamr'

distance = 562
spam score = 38
title = 'document processing time details for draftietfsoftwiremeshframework'

distance = 563
spam score = 39
title = 'document processing time details for draftiabcongestion'

distance = 563
spam score = 39
title = 'document processing time details for draftietftsvwgadmittedrealtimedscp'

distance = 653
spam score = 31
title = 'document processing time details for draftburkevxml'

distance = 654
spam score = 35
title = 'document processing time details for draftietfsnmpv3vacmv2'

distance = 658
spam score = 41
title = 'document processing time details for draftietfsmimecompression'

distance = 663
spam score = 28
title = 'document processing time details for draftietfwebdavbind'

distance = 665
spam score = 36
title = 'document processing time details for draftjonesdime3gppepscommandcodes'

distance = 670
spam score = 35
title = 'document processing time details for draftietfsnmpv3usmv2rfc2574bis'

distance = 675
spam score = 35
title = 'document processing time details for draftietfippjobprog'

distance = 675
spam score = 35
title = 'document processing time details for draftietfnsisnslpnatfw'

distance = 681
spam score = 30
title = 'document processing time details for draftietfsmimex400transport'

distance = 683
spam score = 35
title = 'document processing time details for draftietftradeiotp2req'

distance = 1323
spam score = 29
title = 'ad statistics for fennerbill'

distance = 1325
spam score = 29
title = 'ad statistics for zininalex'

distance = 1330
spam score = 28
title = 'ad statistics for nartenthomas'

distance = 1345
spam score = 24
title = 'ad statistics for faltstrompatrik'

distance = 1346
spam score = 29
title = 'ad statistics for kessensdavid'

distance = 1355
spam score = 43
title = 'polktim document approval rate'

distance = 1361
spam score = 42
title = 'callonross document approval rate'

distance = 1361
spam score = 42
title = 'housleyruss document approval rate'

distance = 1366
spam score = 41
title = 'hartmansam document approval rate'

distance = 1368
spam score = 43
title = 'westerlundmagnus document approval rate'

distance = 1616
spam score = 20
title = 'filed discusses for callonross'

distance = 1620
spam score = 27
title = 'toshiba data all documents'

distance = 1628
spam score = 82
title = ''

distance = 1633
spam score = 30
title = 'comcast data all documents'

distance = 1650
spam score = 24
title = 'henning schulzrinne data all documents'

distance = 1669
spam score = 37
title = 'matthew bocci data all documents'

distance = 1678
spam score = 30
title = 'hannes tschofenig data all documents'

distance = 323
spam score = 73
title = 'safety msds data for 4chlororesorcinol'

distance = 336
spam score = 64
title = 'safety msds data for os138'

distance = 374
spam score = 68
title = 'safety msds data for 23xylidine'

distance = 379
spam score = 75
title = 'safety msds data for 2356tetrachlorohydroquinone'

distance = 382
spam score = 62
title = 'safety msds data for 3aminophenol'

distance = 382
spam score = 68
title = 'safety msds data for dxylose'

distance = 385
spam score = 75
title = 'safety msds data for os124'

distance = 393
spam score = 68
title = 'safety msds data for 2356tetrafluorophenol'

distance = 395
spam score = 69
title = 'safety msds data for silver i carbonate'

distance = 397
spam score = 67
title = 'safety msds data for terpineol'

distance = 399
spam score = 76
title = 'safety msds data for 2577tetramethyloctanal'

distance = 401
spam score = 68
title = 'safety msds data for meso23butanediol'

distance = 401
spam score = 75
title = 'safety msds data for bauxite'

distance = 412
spam score = 61
title = 'safety msds data for ethyl mercury chloride'

distance = 415
spam score = 80
title = 'safety msds data for antipyrine'

distance = 415
spam score = 55
title = 'safety msds data for xanthen9ol'

distance = 418
spam score = 76
title = 'safety msds data for silver sulfate'

distance = 422
spam score = 69
title = 'safety msds data for nnitrobenzamide'

distance = 425
spam score = 81
title = 'safety msds data for nnitrosonethylaniline'

distance = 425
spam score = 69
title = 'safety msds data for achloralose'

distance = 502
spam score = 77
title = 'safety msds data for indophenol blue'

distance = 502
spam score = 73
title = 'safety msds data for thiocarbanilide'

distance = 503
spam score = 69
title = 'safety msds data for s2methyl51methylethenyl2cyclohexene1one'

distance = 505
spam score = 70
title = 'safety msds data for silver oxide'

distance = 505
spam score = 78
title = 'safety msds data for 4chlorobenzyl alcohol'

distance = 506
spam score = 80
title = 'safety msds data for nbutylphydroxybenzoate'

distance = 509
spam score = 69
title = 'safety msds data for s2butanol'

distance = 509
spam score = 79
title = 'safety msds data for tetrabutyltin'

distance = 513
spam score = 82
title = 'safety msds data for butylamine'

distance = 514
spam score = 54
title = 'safety msds data for 1pentene'

distance = 541
spam score = 75
title = 'safety msds data for tempo'

distance = 542
spam score = 81
title = 'safety msds data for benzophenone'

distance = 542
spam score = 68
title = 'safety msds data for silver sulfide'

distance = 543
spam score = 72
title = 'safety msds data for nicethamid'

distance = 543
spam score = 78
title = 'safety msds data for silver acetate'

distance = 543
spam score = 66
title = 'safety msds data for ammonium nitrate'

distance = 546
spam score = 63
title = 'safety msds data for phloroglucinol dihydrate'

distance = 546
spam score = 74
title = 'safety msds data for nnnntetramethylpphenylenediamine dihydrochloride'

distance = 547
spam score = 62
title = 'safety msds data for lithium'

distance = 548
spam score = 78
title = 'safety msds data for silver chloride'

distance = 571
spam score = 70
title = 'safety msds data for butane'

distance = 571
spam score = 71
title = 'safety msds data for 2chlorophenol'

distance = 571
spam score = 79
title = 'safety msds data for tetraethylammonium nitrate'

distance = 572
spam score = 63
title = 'safety msds data for cobalt oxide'

distance = 574
spam score = 76
title = 'safety msds data for tetrabutylammonium perchlorate'

distance = 574
spam score = 78
title = 'safety msds data for anthrone'

distance = 576
spam score = 66
title = 'safety msds data for acetamide'

distance = 577
spam score = 63
title = 'safety msds data for water'

distance = 578
spam score = 80
title = 'safety msds data for selenium'

distance = 579
spam score = 61
title = 'safety msds data for ethyl methanesulfonate'

distance = 606
spam score = 68
title = 'safety msds data for nnitrosomorpholine'

distance = 608
spam score = 76
title = 'safety msds data for thallium hexafluorophosphate'

distance = 609
spam score = 72
title = 'safety msds data for butyl cyclohexyl phthalate'

distance = 615
spam score = 81
title = 'safety msds data for iodomethane'

distance = 615
spam score = 77
title = 'safety msds data for testosterone'

distance = 615
spam score = 62
title = 'safety msds data for pentane'

distance = 616
spam score = 60
title = 'safety msds data for bucky tubes'

distance = 616
spam score = 71
title = 'safety msds data for butyl anthranilate'

distance = 618
spam score = 79
title = 'safety msds data for tetrabutylammonium bromide'

distance = 623
spam score = 84
title = 'safety msds data for anthracene'

distance = 650
spam score = 80
title = 'safety msds data for antimony pentoxide'

distance = 651
spam score = 73
title = 'safety msds data for 4nitrophenyl disulfide'

distance = 653
spam score = 67
title = 'safety msds data for barium carbonate'

distance = 654
spam score = 66
title = 'safety msds data for cetyltrimethylammonium chloride'

distance = 655
spam score = 82
title = 'safety msds data for nnnntetramethyl14phenylenediamine'

distance = 655
spam score = 71
title = 'safety msds data for karl fischer reagent'

distance = 655
spam score = 61
title = 'safety msds data for cobalt oxide'

distance = 659
spam score = 70
title = 'safety msds data for manganese ii chloride tetrahydrate'

distance = 660
spam score = 81
title = 'safety msds data for 4nitroquinoline noxide'

distance = 663
spam score = 76
title = 'safety msds data for osmic acid'

distance = 699
spam score = 67
title = 'safety msds data for aluminium oxide'

distance = 700
spam score = 69
title = 'safety msds data for 14dioxane'

distance = 701
spam score = 69
title = 'safety msds data for basic fuchsin hydrochloride'

distance = 702
spam score = 71
title = 'safety msds data for 2nitro14phenylenediamine'

distance = 702
spam score = 62
title = 'safety msds data for iodomethane'

distance = 705
spam score = 65
title = 'safety msds data for 9anthracenemethanol'

distance = 705
spam score = 53
title = 'safety msds data for hydrazine sulfate'

distance = 706
spam score = 68
title = 'safety msds data for furan'

distance = 708
spam score = 74
title = 'safety msds data for anthraquinone26disulphonic acid disodium salt'

distance = 710
spam score = 69
title = 'safety msds data for 6methyl2thiouracil'

distance = 769
spam score = 66
title = 'safety msds data for dichloromethane'

distance = 770
spam score = 48
title = 'safety msds data for hydrazine sulfate'

distance = 771
spam score = 78
title = 'safety msds data for 4chlorotoluene'

distance = 774
spam score = 80
title = 'safety msds data for butyric acid'

distance = 778
spam score = 73
title = 'safety msds data for 1butanol'

distance = 780
spam score = 78
title = 'safety msds data for chlorine'

distance = 782
spam score = 80
title = 'safety msds data for phenol'

distance = 782
spam score = 65
title = 'safety msds data for furan'

distance = 787
spam score = 70
title = 'safety msds data for aniline'

distance = 789
spam score = 75
title = 'safety msds data for valerophenone'

distance = 889
spam score = 74
title = 'safety msds data for ethylene oxide'

distance = 896
spam score = 62
title = 'safety msds data for iron ii sulfate heptahydrate'

distance = 904
spam score = 78
title = 'safety msds data for benzene'

distance = 906
spam score = 74
title = 'safety msds data for silvex'

distance = 906
spam score = 62
title = 'safety msds data for lead acetate'

distance = 910
spam score = 78
title = 'safety msds data for benzocaine'

distance = 910
spam score = 72
title = 'safety data for sodium hydroxide'

distance = 920
spam score = 74
title = 'safety msds data for ethylene oxide'

distance = 927
spam score = 67
title = 'safety msds data for deuterium oxide'

distance = 935
spam score = 63
title = 'safety msds data for phenothiazine'

distance = 1660
spam score = 60
title = 'the msds hyperglossary useless msds abbreviations'

distance = 1666
spam score = 64
title = 'the msds hyperglossary useless msds abbreviations'

distance = 1823
spam score = 78
title = 'waterblockbuilding systems waterblockbuilding wraps'

distance = 418
spam score = 41
title = 'amiga game antago'

distance = 437
spam score = 41
title = 'amiga game amiga karate'

distance = 438
spam score = 43
title = 'amiga game defcon 5'

distance = 443
spam score = 42
title = 'amiga game badlands pete'

distance = 446
spam score = 38
title = 'amiga game the ball game'

distance = 451
spam score = 42
title = 'amiga game universe 3'

distance = 454
spam score = 45
title = 'amiga game final mission'

distance = 460
spam score = 46
title = 'amiga game das telekommando'

distance = 461
spam score = 45
title = 'amiga game the manager'

distance = 462
spam score = 38
title = 'amiga game formula one grand prix circuit'

distance = 462
spam score = 37
title = 'amiga game garrison'

distance = 470
spam score = 43
title = 'amiga game paramax'

distance = 474
spam score = 37
title = 'amiga game veteran'

distance = 477
spam score = 40
title = 'amiga game dark spyre'

distance = 477
spam score = 43
title = 'amiga game red lightning'

distance = 478
spam score = 43
title = 'amiga game art of chess'

distance = 479
spam score = 40
title = 'amiga game jimmy connors great courts 2'

distance = 480
spam score = 36
title = 'amiga game airport'

distance = 482
spam score = 41
title = 'amiga game chariots of wrath'

distance = 483
spam score = 40
title = 'amiga game heart of the dragon'

distance = 538
spam score = 47
title = 'amiga game cadaver 2 the last supper'

distance = 538
spam score = 40
title = 'amiga game gravity force'

distance = 538
spam score = 48
title = 'amiga game rainbow warriors'

distance = 540
spam score = 41
title = 'amiga game leonardo'

distance = 540
spam score = 43
title = 'amiga game archon'

distance = 541
spam score = 42
title = 'amiga game the karate kid part 2'

distance = 541
spam score = 37
title = 'amiga game heavy metal'

distance = 543
spam score = 41
title = 'amiga game legend of faerghail'

distance = 544
spam score = 39
title = 'amiga game robin smiths international cricket'

distance = 546
spam score = 42
title = 'amiga game datastorm'

distance = 570
spam score = 37
title = 'amiga game the last action hero'

distance = 571
spam score = 44
title = 'amiga game 9 lives'

distance = 573
spam score = 49
title = 'amiga game a320 airbus usa edition'

distance = 575
spam score = 39
title = 'amiga game into the eagles nest'

distance = 577
spam score = 40
title = 'amiga game aaargh'

distance = 580
spam score = 41
title = 'amiga game noddys big adventure'

distance = 581
spam score = 36
title = 'amiga game eggminator its jokement day'

distance = 583
spam score = 34
title = 'amiga game burning rubber'

distance = 584
spam score = 34
title = 'amiga game technology 2'

distance = 587
spam score = 41
title = 'amiga game a prehistoric tale'

distance = 608
spam score = 43
title = 'amiga game dino wars'

distance = 609
spam score = 41
title = 'amiga game xmen ravages of apocalypse'

distance = 612
spam score = 45
title = 'amiga game snow strike'

distance = 613
spam score = 42
title = 'amiga game the feeble files'

distance = 614
spam score = 42
title = 'amiga game international ice hockey'

distance = 614
spam score = 36
title = 'amiga game ball raider 2'

distance = 614
spam score = 40
title = 'amiga game manix'

distance = 619
spam score = 38
title = 'amiga game a10 tank killer campaigns 2'

distance = 619
spam score = 38
title = 'amiga game 1st division manager'

distance = 619
spam score = 45
title = 'amiga game manhattan dealers aka operation cleanstreet'

distance = 638
spam score = 46
title = 'amiga game leisure suit larry in the land of the lounge lizards'

distance = 639
spam score = 44
title = 'amiga game galdregons domain aka death bringer'

distance = 639
spam score = 40
title = 'amiga game the perfect general scenario disk 1 ww2'

distance = 639
spam score = 36
title = 'amiga game magic johnson basketball'

distance = 640
spam score = 45
title = 'amiga game ishar 2 messengers of doom aga'

distance = 640
spam score = 36
title = 'amiga game jungle strike'

distance = 642
spam score = 44
title = 'amiga game nippon safes inc'

distance = 643
spam score = 42
title = 'amiga game nicky 2 aka nicky boom 2'

distance = 643
spam score = 34
title = 'amiga game fighter duel pro'

distance = 644
spam score = 42
title = 'amiga game global effect'

distance = 661
spam score = 42
title = 'amiga game benefactor cd32'

distance = 661
spam score = 37
title = 'amiga game bloodwych data disk 1'

distance = 664
spam score = 39
title = 'amiga game bug bash'

distance = 665
spam score = 40
title = 'amiga game armourgeddon'

distance = 665
spam score = 38
title = 'amiga game mag cd32'

distance = 665
spam score = 35
title = 'amiga game monster business'

distance = 666
spam score = 47
title = 'amiga game leaderboard tournament disk'

distance = 666
spam score = 42
title = 'amiga game goldrunner 2 scenery disk 1'

distance = 667
spam score = 39
title = 'amiga game cubulus'

distance = 668
spam score = 40
title = 'amiga game dynablaster'

distance = 697
spam score = 30
title = 'amiga game unreal'

distance = 698
spam score = 40
title = 'amiga game action fighter'

distance = 699
spam score = 37
title = 'amiga game ballistix'

distance = 703
spam score = 34
title = 'amiga game ghosts n goblins'

distance = 703
spam score = 31
title = 'amiga game alien 3'

distance = 704
spam score = 37
title = 'amiga game yogis big clean up'

distance = 706
spam score = 33
title = 'amiga game tzer0 aka trauma zero'

distance = 706
spam score = 42
title = 'amiga game quake'

distance = 708
spam score = 38
title = 'amiga game trapped 2'

distance = 713
spam score = 43
title = 'amiga game vaders'

distance = 761
spam score = 42
title = 'amiga game battlehawks 1942'

distance = 761
spam score = 38
title = 'amiga game jet'

distance = 761
spam score = 46
title = 'amiga game england championship special'

distance = 763
spam score = 36
title = 'amiga game embryo'

distance = 763
spam score = 49
title = 'amiga game waterloo'

distance = 766
spam score = 45
title = 'amiga game sensible soccer v11 european champions 9293 season cd32'

distance = 768
spam score = 36
title = 'amiga game 4d sports boxing'

distance = 770
spam score = 41
title = 'amiga game ufo enemy unknown a500'

distance = 772
spam score = 44
title = 'amiga game chronoquest 2 aka explora 2'

distance = 773
spam score = 40
title = 'amiga game breathless'

distance = 830
spam score = 35
title = 'amiga game projectyle'

distance = 831
spam score = 45
title = 'amiga game f15 strike eagle'

distance = 835
spam score = 39
title = 'amiga game gloom deluxe'

distance = 837
spam score = 44
title = 'amiga game ums 2 nations at war'

distance = 854
spam score = 36
title = 'amiga game ghostbusters 2'

distance = 859
spam score = 39
title = 'amiga game a10 tank killer'

distance = 864
spam score = 42
title = 'amiga game omniplay horse racing'

distance = 864
spam score = 39
title = 'amiga game test drive 2 california challenge'

distance = 875
spam score = 45
title = 'amiga game omniplay basketball magic johnsons mvp'

distance = 882
spam score = 40
title = 'amiga game passengers on the wind les passagers du vent reisende im wind'

distance = 1703
spam score = 61
title = 'beauveria bassiana metarhizium anisoplae'

distance = 341
spam score = 85
title = 'cisco ons 15300 series maintain and operate cisco systems'

distance = 343
spam score = 83
title = 'cisco ons 15300 series maintain and operate cisco systems'

distance = 383
spam score = 81
title = 'cisco configuration assistant maintain and operate cisco systems'

distance = 398
spam score = 89
title = 'cisco ons 15400 series maintain and operate cisco systems'

distance = 398
spam score = 89
title = 'cisco ons 15400 series maintain and operate cisco systems'

distance = 409
spam score = 83
title = 'cisco ons 15600 series maintain and operate cisco systems'

distance = 426
spam score = 76
title = 'cisco access registrar maintain and operate cisco systems'

distance = 439
spam score = 76
title = 'ciscoworks assistant maintain and operate cisco systems'

distance = 448
spam score = 82
title = 'cisco transport manager maintain and operate cisco systems'

distance = 448
spam score = 74
title = 'cisco 72007400 series manager maintain and operate cisco systems'

distance = 451
spam score = 82
title = 'cisco unified operations manager maintain and operate cisco systems'

distance = 451
spam score = 74
title = 'cisco security manager maintain and operate cisco systems'

distance = 453
spam score = 73
title = 'cisco security auditor maintain and operate cisco systems'

distance = 458
spam score = 79
title = 'cisco signaling gateway manager maintain and operate cisco systems'

distance = 461
spam score = 75
title = 'cisco transport manager maintain and operate cisco systems'

distance = 462
spam score = 84
title = 'cisco transport manager maintain and operate cisco systems'

distance = 464
spam score = 79
title = 'cisco cable manager maintain and operate cisco systems'

distance = 473
spam score = 81
title = 'cisco netflow collection engine maintain and operate cisco systems'

distance = 476
spam score = 71
title = 'cisco multicast manager maintain and operate cisco systems'

distance = 476
spam score = 81
title = 'cisco ie 3000 series switches product literature cisco systems'

distance = 542
spam score = 82
title = 'cisco 7100 series vpn routers maintain and operate cisco systems'

distance = 543
spam score = 76
title = 'cisco configuration assistant product literature cisco systems'

distance = 543
spam score = 79
title = 'cisco configuration assistant product literature cisco systems'

distance = 544
spam score = 83
title = 'cisco unified media engine maintain and operate cisco systems'

distance = 545
spam score = 88
title = 'cisco 7300 series routers maintain and operate cisco systems'

distance = 545
spam score = 78
title = 'cisco micro webservers maintain and operate cisco systems'

distance = 545
spam score = 77
title = 'cisco internet cdn maintain and operate cisco systems'

distance = 547
spam score = 78
title = 'cisco security monitoring analysis and response system maintain and operate cisco systems'

distance = 547
spam score = 89
title = 'cisco unity maintain and operate cisco systems'

distance = 549
spam score = 79
title = 'cisco ons 15300 series product literature cisco systems'

distance = 570
spam score = 87
title = 'cisco computer telephony integration option maintain and operate cisco systems'

distance = 570
spam score = 81
title = 'ciscoworks campus manager maintain and operate cisco systems'

distance = 571
spam score = 85
title = 'applications for cisco unified application environment maintain and operate cisco systems'

distance = 573
spam score = 67
title = 'cisco mds 9500 series multilayer directors maintain and operate cisco systems'

distance = 575
spam score = 79
title = 'cisco catalyst 6000 series switches product literature cisco systems'

distance = 577
spam score = 76
title = 'cisco vframe data center install and upgrade cisco systems'

distance = 578
spam score = 90
title = 'cisco unified presence maintain and operate cisco systems'

distance = 579
spam score = 89
title = 'cisco unity express maintain and operate cisco systems'

distance = 579
spam score = 88
title = 'cisco 3600 series multiservice platforms install and upgrade cisco systems'

distance = 580
spam score = 85
title = 'cisco as5400 series universal gateways maintain and operate cisco systems'

distance = 599
spam score = 88
title = 'cisco router and security device manager maintain and operate cisco systems'

distance = 601
spam score = 90
title = 'cisco catalyst 6500 series switches maintain and operate cisco systems'

distance = 601
spam score = 78
title = 'cisco router and security device manager product literature cisco systems'

distance = 602
spam score = 69
title = 'cisco secure access control server express product literature cisco systems'

distance = 603
spam score = 83
title = 'cisco ons 15200 series metropolitan dwdm systems configure cisco systems'

distance = 604
spam score = 85
title = 'cisco mds 9500 series multilayer directors maintain and operate cisco systems'

distance = 605
spam score = 76
title = 'cisco secure access control system support cisco systems'

distance = 605
spam score = 87
title = 'cisco security monitoring analysis and response system maintain and operate cisco systems'

distance = 605
spam score = 75
title = 'cisco monitor manager product literature cisco systems'

distance = 607
spam score = 79
title = 'cisco unified workforce optimization maintain and operate cisco systems'

distance = 619
spam score = 78
title = 'cisco blade switches for dell product literature cisco systems'

distance = 619
spam score = 88
title = 'cisco outbound option maintain and operate cisco systems'

distance = 620
spam score = 84
title = 'cisco web collaboration option maintain and operate cisco systems'

distance = 620
spam score = 88
title = 'cisco 3700 series multiservice access routers maintain and operate cisco systems'

distance = 620
spam score = 69
title = 'cisco me 3400e series ethernet access switches product literature cisco systems'

distance = 622
spam score = 89
title = 'cisco 1700 series modular access routers maintain and operate cisco systems'

distance = 623
spam score = 80
title = 'cisco 3700 series multiservice access routers install and upgrade cisco systems'

distance = 623
spam score = 82
title = 'cisco sfs 7000 series infiniband server switches maintain and operate cisco systems'

distance = 623
spam score = 81
title = 'cisco sfs 7000 series infiniband server switches maintain and operate cisco systems'

distance = 623
spam score = 74
title = 'cisco catalyst 6500 virtual switching system 1440 product literature cisco systems'

distance = 640
spam score = 69
title = 'cisco media gateway controller node manager endofsale versions and options cisco systems'

distance = 641
spam score = 73
title = 'cisco iad2400 series integrated access devices models cisco systems'

distance = 642
spam score = 77
title = 'cisco secure access control server express product literature cisco systems'

distance = 643
spam score = 90
title = 'cisco unified ip phones 7900 series maintain and operate cisco systems'

distance = 644
spam score = 87
title = 'cisco catalyst 3750 series integrated wireless lan controllers product literature cisco systems'

distance = 644
spam score = 77
title = 'cisco ubr7200 series universal broadband routers product literature cisco systems'

distance = 645
spam score = 85
title = 'cisco pix 500 series security appliances install and upgrade cisco systems'

distance = 647
spam score = 80
title = 'cisco media gateway controller node manager maintain and operate cisco systems'

distance = 647
spam score = 71
title = 'cisco secure vpn client product literature cisco systems'

distance = 648
spam score = 88
title = 'ciscoworks campus manager maintain and operate cisco systems'

distance = 674
spam score = 88
title = 'cisco unified meetingplace translated documents cisco systems'

distance = 675
spam score = 66
title = 'cisco data center network manager support cisco systems'

distance = 675
spam score = 70
title = 'cisco data center network manager support cisco systems'

distance = 677
spam score = 87
title = 'cisco security monitoring analysis and response system install and upgrade cisco systems'

distance = 678
spam score = 75
title = 'cisco aironet wireless lan client adapters product literature cisco systems'

distance = 681
spam score = 70
title = 'cisco media gateway controller node manager install and upgrade cisco systems'

distance = 683
spam score = 85
title = 'cisco unified ip interactive voice response maintain and operate cisco systems'

distance = 683
spam score = 69
title = 'cisco media gateway controller node manager versions and options cisco systems'

distance = 684
spam score = 72
title = 'cisco 1700 series modular access routers endofsale models cisco systems'

distance = 685
spam score = 75
title = 'cisco micro webservers support cisco systems'

distance = 734
spam score = 76
title = 'cisco mxe 3000 series media experience engines support cisco systems'

distance = 735
spam score = 80
title = 'voice application development technology information cisco systems'

distance = 742
spam score = 82
title = 'cisco aironet wireless lan client adapters product literature cisco systems'

distance = 749
spam score = 77
title = 'cisco secure user registration tool support cisco systems'

distance = 750
spam score = 70
title = 'cisco internet cdn support cisco systems'

distance = 750
spam score = 69
title = 'cisco internet cdn support cisco systems'

distance = 754
spam score = 80
title = 'wireless lan wlan technology information cisco systems'

distance = 755
spam score = 89
title = 'ibm networking technology information cisco systems'

distance = 755
spam score = 84
title = 'ip multicast technology information cisco systems'

distance = 761
spam score = 87
title = 'data compression technology information cisco systems'

distance = 963
spam score = 80
title = 'cisco secure access control server for unix support cisco systems'

distance = 963
spam score = 85
title = 'pointtopoint protocol ppp cisco systems'

distance = 965
spam score = 86
title = 'pointtopoint protocol ppp cisco systems'

distance = 974
spam score = 78
title = 'cisco 4100 series wireless lan controllers enduser guides cisco systems'

distance = 976
spam score = 80
title = 'voice application development cisco systems'

distance = 990
spam score = 79
title = 'cisco broadband access center for broadband aggregation maintain and operate guides cisco systems'

distance = 1032
spam score = 72
title = 'cisco secure access control server for unix maintain and operate technotes cisco systems'

distance = 1043
spam score = 77
title = 'cisco vframe data center maintain and operate guides cisco systems'

distance = 1090
spam score = 82
title = 'cisco web collaboration option enduser guides cisco systems'

distance = 1094
spam score = 84
title = 'cisco secure access control system cisco systems'

distance = 1277
spam score = 81
title = 'cisco ddos multidevice management system products services cisco systems'

distance = 1281
spam score = 67
title = 'cisco small business continuous data protection linksys business products services cisco systems'

distance = 1281
spam score = 64
title = 'cisco digistar ethernet over coax eoc system cisco systems'

distance = 1283
spam score = 64
title = 'cisco digistar ethernet over coax eoc system cisco systems'

distance = 1284
spam score = 80
title = 'cisco ddos multidevice management system products services cisco systems'

distance = 1288
spam score = 58
title = 'cisco digistar ethernet over coax eoc system cisco systems'

distance = 1289
spam score = 83
title = 'fiber distributedcopper distributed data interface fddicddi cisco systems'

distance = 1310
spam score = 60
title = 'cisco small business continuous data protection linksys business products services cisco systems'

distance = 1463
spam score = 78
title = 'carriersensitive routing user guide glossarynbsp cisco carrier sensitive route server software cisco systems'

distance = 415
spam score = 86
title = 'custom report'

distance = 425
spam score = 86
title = 'custom report'

distance = 447
spam score = 82
title = '49904400 millwrights'

distance = 449
spam score = 79
title = 'custom report'

distance = 462
spam score = 79
title = '29106500 pediatricians general'

distance = 463
spam score = 82
title = 'custom report'

distance = 464
spam score = 77
title = 'custom report'

distance = 464
spam score = 78
title = '29106600 psychiatrists'

distance = 464
spam score = 82
title = 'custom report'

distance = 467
spam score = 76
title = '27204201 singers'

distance = 469
spam score = 81
title = 'custom report'

distance = 471
spam score = 78
title = 'custom report'

distance = 472
spam score = 87
title = 'custom report'

distance = 474
spam score = 83
title = 'custom report'

distance = 475
spam score = 82
title = 'custom report'

distance = 476
spam score = 86
title = 'custom report'

distance = 478
spam score = 78
title = '29106700 surgeons'

distance = 479
spam score = 81
title = 'custom report'

distance = 479
spam score = 91
title = 'custom report'

distance = 480
spam score = 84
title = 'custom report'

distance = 523
spam score = 82
title = 'custom report'

distance = 523
spam score = 79
title = 'custom report'

distance = 523
spam score = 79
title = 'custom report'

distance = 524
spam score = 90
title = 'custom report'

distance = 524
spam score = 78
title = 'custom report'

distance = 524
spam score = 86
title = 'custom report'

distance = 524
spam score = 79
title = 'custom report'

distance = 525
spam score = 85
title = 'custom report'

distance = 526
spam score = 89
title = 'custom report'

distance = 526
spam score = 86
title = 'custom report'

distance = 538
spam score = 85
title = 'custom report'

distance = 538
spam score = 91
title = 'custom report'

distance = 539
spam score = 89
title = 'custom report'

distance = 540
spam score = 76
title = 'custom report'

distance = 540
spam score = 81
title = 'custom report'

distance = 540
spam score = 85
title = 'custom report'

distance = 541
spam score = 83
title = 'custom report'

distance = 541
spam score = 85
title = 'custom report'

distance = 541
spam score = 80
title = 'custom report'

distance = 541
spam score = 79
title = 'custom report'

distance = 557
spam score = 78
title = 'custom report'

distance = 558
spam score = 80
title = 'custom report'

distance = 558
spam score = 90
title = 'custom report'

distance = 559
spam score = 80
title = 'custom report'

distance = 559
spam score = 77
title = 'custom report'

distance = 560
spam score = 78
title = '51204100 structural metal fabricators and fitters'

distance = 561
spam score = 87
title = 'custom report'

distance = 561
spam score = 83
title = 'custom report'

distance = 561
spam score = 92
title = 'custom report'

distance = 561
spam score = 75
title = '29106400 obstetricians and gynecologists'

distance = 572
spam score = 87
title = 'custom report'

distance = 573
spam score = 82
title = 'custom report'

distance = 573
spam score = 85
title = 'custom report'

distance = 573
spam score = 83
title = 'custom report'

distance = 573
spam score = 88
title = 'custom report'

distance = 574
spam score = 80
title = 'custom report'

distance = 574
spam score = 88
title = 'custom report'

distance = 575
spam score = 86
title = 'custom report'

distance = 575
spam score = 91
title = 'custom report'

distance = 576
spam score = 86
title = 'custom report'

distance = 591
spam score = 88
title = 'custom report'

distance = 591
spam score = 90
title = 'custom report'

distance = 592
spam score = 90
title = 'custom report'

distance = 594
spam score = 77
title = '47501200 rotary drill operators oil and gas'

distance = 594
spam score = 82
title = 'custom report'

distance = 595
spam score = 80
title = 'custom report'

distance = 595
spam score = 88
title = 'custom report'

distance = 595
spam score = 88
title = 'custom report'

distance = 595
spam score = 87
title = 'custom report'

distance = 596
spam score = 83
title = 'custom report'

distance = 612
spam score = 74
title = '13103101 claims examiners property and casualty insurance'

distance = 614
spam score = 72
title = 'custom report'

distance = 615
spam score = 74
title = '51402100 extruding and drawing machine setters operators and tenders metal and plastic'

distance = 616
spam score = 73
title = 'custom report'

distance = 616
spam score = 88
title = 'custom report'

distance = 618
spam score = 82
title = 'custom report'

distance = 618
spam score = 83
title = 'custom report'

distance = 620
spam score = 81
title = 'custom report'

distance = 621
spam score = 91
title = 'custom report'

distance = 623
spam score = 81
title = 'custom report'

distance = 900
spam score = 78
title = 'indemand occupation'

distance = 902
spam score = 77
title = 'indemand occupation'

distance = 902
spam score = 77
title = 'indemand occupation'

distance = 906
spam score = 77
title = 'indemand occupation'

distance = 906
spam score = 79
title = 'tools amp technology'

distance = 911
spam score = 81
title = 'indemand occupation'

distance = 911
spam score = 80
title = 'indemand occupation'

distance = 911
spam score = 75
title = 'indemand occupation'

distance = 912
spam score = 78
title = 'indemand occupation'

distance = 913
spam score = 71
title = 'indemand occupation'

distance = 1005
spam score = 73
title = 'indemand occupation'

distance = 1009
spam score = 71
title = 'tools amp technology'

distance = 1011
spam score = 78
title = 'tools amp technology'

distance = 1013
spam score = 71
title = 'indemand occupation'

distance = 1018
spam score = 76
title = 'indemand occupation'

distance = 1028
spam score = 69
title = 'indemand occupation'

distance = 1028
spam score = 81
title = 'indemand occupation'

distance = 1044
spam score = 77
title = 'indemand occupation'

distance = 1066
spam score = 73
title = 'indemand occupation'

distance = 1074
spam score = 70
title = 'onet code connector detailed information'

distance = 1415
spam score = 54
title = 'onet code connector detailed information'

distance = 1449
spam score = 66
title = 'onet code connector detailed information'

distance = 1519
spam score = 65
title = 'occubrowse'

distance = 1544
spam score = 85
title = 'onet code connector detailed information'

distance = 1546
spam score = 76
title = 'onet online knowledge site onet is the occupational information network onet online onet knowledge site for workforce development'

distance = 575
spam score = 71
title = ''

distance = 584
spam score = 64
title = ''

distance = 599
spam score = 55
title = ''

distance = 623
spam score = 64
title = ''

distance = 657
spam score = 66
title = ''

distance = 681
spam score = 57
title = ''

distance = 684
spam score = 71
title = ''

distance = 687
spam score = 66
title = ''

distance = 695
spam score = 61
title = ''

distance = 698
spam score = 76
title = ''

distance = 699
spam score = 69
title = ''

distance = 707
spam score = 68
title = ''

distance = 710
spam score = 61
title = ''

distance = 722
spam score = 59
title = ''

distance = 783
spam score = 63
title = ''

distance = 785
spam score = 66
title = ''

distance = 797
spam score = 64
title = ''

distance = 819
spam score = 57
title = ''

distance = 836
spam score = 70
title = ''

distance = 920
spam score = 50
title = ''

distance = 924
spam score = 73
title = ''

distance = 949
spam score = 57
title = ''

distance = 427
spam score = 18
title = ''

distance = 428
spam score = 23
title = ''

distance = 471
spam score = 20
title = ''

distance = 480
spam score = 19
title = ''

distance = 494
spam score = 23
title = ''

distance = 495
spam score = 22
title = ''

distance = 510
spam score = 18
title = ''

distance = 516
spam score = 18
title = ''

distance = 526
spam score = 20
title = ''

distance = 529
spam score = 21
title = ''

distance = 533
spam score = 23
title = ''

distance = 536
spam score = 16
title = ''

distance = 543
spam score = 20
title = ''

distance = 556
spam score = 20
title = ''

distance = 558
spam score = 19
title = ''

distance = 572
spam score = 20
title = ''

distance = 575
spam score = 27
title = ''

distance = 579
spam score = 19
title = ''

distance = 579
spam score = 19
title = ''

distance = 584
spam score = 22
title = ''

distance = 590
spam score = 19
title = ''

distance = 603
spam score = 19
title = ''

distance = 610
spam score = 17
title = ''

distance = 612
spam score = 19
title = ''

distance = 630
spam score = 21
title = ''

distance = 647
spam score = 24
title = ''

distance = 651
spam score = 19
title = ''

distance = 656
spam score = 19
title = ''

distance = 677
spam score = 22
title = ''

distance = 688
spam score = 18
title = ''

distance = 709
spam score = 17
title = ''

distance = 761
spam score = 18
title = ''

distance = 802
spam score = 18
title = ''

distance = 1248
spam score = 33
title = ''

distance = 1374
spam score = 63
title = ''

distance = 1431
spam score = 46
title = ''

distance = 1464
spam score = 27
title = ''

distance = 1472
spam score = 27
title = ''

distance = 537
spam score = 36
title = 'ipcc 4th assessment report 2007 model lasgfgoalsg10 scenario sra1b variable psl'

distance = 541
spam score = 35
title = 'ipcc 4th assessment report 2007 model ukmohadcm3 scenario sra2 variable psl'

distance = 543
spam score = 41
title = 'ipcc 4th assessment report 2007 model consechog scenario sra1b variable psl'

distance = 545
spam score = 40
title = 'ipcc 4th assessment report 2007 model ukmohadcm3 scenario sra1b variable psl'

distance = 548
spam score = 35
title = 'ipcc 4th assessment report 2007 model gfdlcm21 scenario sra1b variable psl'

distance = 550
spam score = 40
title = 'ipcc 4th assessment report 2007 model gfdlcm2 scenario sra2 variable psl'

distance = 553
spam score = 34
title = 'ipcc 4th assessment report 2007 model bccrbcm2 scenario sra1b variable psl'

distance = 554
spam score = 38
title = 'ipcc 4th assessment report 2007 model gfdlcm21 scenario commit variable psl'

distance = 557
spam score = 37
title = 'ipcc 4th assessment report 2007 model ukmohadgem1 scenario sra2 variable psl'

distance = 558
spam score = 35
title = 'ipcc 4th assessment report 2007 model ukmohadcm3 scenario srb1 variable psl'

distance = 558
spam score = 34
title = 'ipcc 4th assessment report 2007 model inmcm3 scenario sra1b variable psl'

distance = 560
spam score = 35
title = 'ipcc 4th assessment report 2007 model gfdlcm21 scenario srb1 variable psl'

distance = 561
spam score = 36
title = 'ipcc 4th assessment report 2007 model cnrmcm3 scenario sra2 variable psl'

distance = 562
spam score = 36
title = 'ipcc 4th assessment report 2007 model inmcm3 scenario sra2 variable psl'

distance = 572
spam score = 39
title = 'ipcc 4th assessment report 2007 model ukmohadgem1 scenario sra2 variable vas'

distance = 573
spam score = 39
title = 'ipcc 4th assessment report 2007 model niesmiroc32med scenario sra1b variable tasmax'

distance = 574
spam score = 38
title = 'ipcc 4th assessment report 2007 model niesmiroc32med scenario sra1b variable psl'

distance = 576
spam score = 34
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario sra1b variable psl'

distance = 577
spam score = 36
title = 'ipcc 4th assessment report 2007 model niesmiroc32med scenario sra2 variable psl'

distance = 578
spam score = 35
title = 'ipcc 4th assessment report 2007 model nasagisseh scenario sra1b variable psl'

distance = 601
spam score = 41
title = 'ipcc 4th assessment report 2007 model ipslcm4 scenario sra2 variable tas'

distance = 601
spam score = 34
title = 'ipcc 4th assessment report 2007 model niesmiroc32med scenario commit variable psl'

distance = 601
spam score = 41
title = 'ipcc 4th assessment report 2007 model mpimecham5 scenario sra1b variable tas'

distance = 602
spam score = 42
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario sra1b variable tasmin'

distance = 602
spam score = 54
title = 'ipcc 4th assessment report 2007 model niesmiroc32hi scenario sra1b variable huss'

distance = 602
spam score = 41
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario sra2 variable tasmax'

distance = 603
spam score = 35
title = 'ipcc 4th assessment report 2007 model nasagisser scenario commit variable psl'

distance = 603
spam score = 33
title = 'ipcc 4th assessment report 2007 model mricgcm232 scenario sra1b variable psl'

distance = 604
spam score = 35
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario srb1 variable psl'

distance = 604
spam score = 41
title = 'ipcc 4th assessment report 2007 model ipslcm4 scenario sra1b variable tas'

distance = 616
spam score = 45
title = 'ipcc 4th assessment report 2007 model nasagisser scenario sra2 variable tas'

distance = 617
spam score = 39
title = 'ipcc 4th assessment report 2007 model bccrbcm2 scenario commit variable tas'

distance = 617
spam score = 40
title = 'ipcc 4th assessment report 2007 model mricgcm232 scenario sra2 variable huss'

distance = 618
spam score = 38
title = 'ipcc 4th assessment report 2007 model cnrmcm3 scenario sra1b variable huss'

distance = 619
spam score = 44
title = 'ipcc 4th assessment report 2007 model nasagisser scenario sra1b variable tas'

distance = 619
spam score = 42
title = 'ipcc 4th assessment report 2007 model mricgcm232 scenario sra2 variable tas'

distance = 620
spam score = 40
title = 'ipcc 4th assessment report 2007 model cnrmcm3 scenario pictl variable vas'

distance = 621
spam score = 58
title = 'ipcc 4th assessment report 2007 model niesmiroc32hi scenario srb1 variable huss'

distance = 622
spam score = 36
title = 'ipcc 4th assessment report 2007 model nasagissaom scenario srb1 variable vas'

distance = 622
spam score = 41
title = 'ipcc 4th assessment report 2007 model gfdlcm21 scenario sra1b variable pr'

distance = 631
spam score = 35
title = 'ipcc 4th assessment report 2007 model ncarpcm scenario 1pto2x variable psl'

distance = 631
spam score = 35
title = 'ipcc 4th assessment report 2007 model ukmohadgem1 scenario 1pto2x variable psl'

distance = 631
spam score = 41
title = 'ipcc 4th assessment report 2007 model inmcm3 scenario pictl variable vas'

distance = 631
spam score = 38
title = 'ipcc 4th assessment report 2007 model nasagissaom scenario srb1 variable huss'

distance = 631
spam score = 41
title = 'ipcc 4th assessment report 2007 model inmcm3 scenario pictl variable tasmax'

distance = 632
spam score = 39
title = 'ipcc 4th assessment report 2007 model ncarpcm scenario sra2 variable rsds'

distance = 633
spam score = 41
title = 'ipcc 4th assessment report 2007 model bccrbcm2 scenario pictl variable tasmax'

distance = 633
spam score = 44
title = 'ipcc 4th assessment report 2007 model inmcm3 scenario pictl variable tasmin'

distance = 634
spam score = 46
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario srb1 variable tas'

distance = 635
spam score = 41
title = 'ipcc 4th assessment report 2007 model nasagisser scenario sra1b variable rsds'

distance = 641
spam score = 42
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario pictl variable tasmax'

distance = 642
spam score = 38
title = 'ipcc 4th assessment report 2007 model cccmacgcm31t63 scenario srb1 variable psl'

distance = 644
spam score = 37
title = 'ipcc 4th assessment report 2007 model ncarccsm3 scenario 1pto2x variable psl'

distance = 645
spam score = 37
title = 'ipcc 4th assessment report 2007 model nasagissaom scenario sra1b variable rsds'

distance = 645
spam score = 39
title = 'ipcc 4th assessment report 2007 model niesmiroc32med scenario 1pto2x variable tasmax'

distance = 646
spam score = 44
title = 'ipcc 4th assessment report 2007 model niesmiroc32hi scenario pictl variable tasmin'

distance = 647
spam score = 43
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario pictl variable tasmin'

distance = 648
spam score = 41
title = 'ipcc 4th assessment report 2007 model cnrmcm3 scenario pictl variable rsds'

distance = 649
spam score = 41
title = 'ipcc 4th assessment report 2007 model cnrmcm3 scenario commit variable pr'

distance = 650
spam score = 36
title = 'ipcc 4th assessment report 2007 model nasagisser scenario 1pto4x variable uas'

distance = 660
spam score = 42
title = 'ipcc 4th assessment report 2007 model ipslcm4 scenario pictl variable huss'

distance = 660
spam score = 41
title = 'ipcc 4th assessment report 2007 model consechog scenario pictl variable rsds'

distance = 661
spam score = 40
title = 'ipcc 4th assessment report 2007 model cccmacgcm31t47 scenario pictl variable uas'

distance = 662
spam score = 42
title = 'ipcc 4th assessment report 2007 model ncarpcm scenario sra2 variable pr'

distance = 663
spam score = 40
title = 'ipcc 4th assessment report 2007 model nasagisser scenario 1pto4x variable huss'

distance = 664
spam score = 42
title = 'ipcc 4th assessment report 2007 model nasagisser scenario 1pto2x variable huss'

distance = 665
spam score = 43
title = 'ipcc 4th assessment report 2007 model bcccm1 scenario srb1 variable tas'

distance = 668
spam score = 39
title = 'ipcc 4th assessment report 2007 model mricgcm232 scenario sra1b variable pr'

distance = 669
spam score = 45
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario sra1b variable pr'

distance = 669
spam score = 54
title = 'ipcc 4th assessment report 2007 model niesmiroc32hi scenario 1pto2x variable tasmax'

distance = 679
spam score = 41
title = 'ipcc 4th assessment report 2007 model nasagisser scenario srb1 variable pr'

distance = 680
spam score = 42
title = 'ipcc 4th assessment report 2007 model ncarpcm scenario sra1b variable pr'

distance = 680
spam score = 41
title = 'ipcc 4th assessment report 2007 model mpimecham5 scenario 1pto2x variable tas'

distance = 680
spam score = 44
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario commit variable pr'

distance = 680
spam score = 42
title = 'ipcc 4th assessment report 2007 model nasagisseh scenario sra1b variable pr'

distance = 682
spam score = 42
title = 'ipcc 4th assessment report 2007 model ipslcm4 scenario pictl variable tas'

distance = 683
spam score = 42
title = 'ipcc 4th assessment report 2007 model niesmiroc32hi scenario pictl variable tas'

distance = 684
spam score = 36
title = 'ipcc 4th assessment report 2007 model gfdlcm21 scenario 20c3m variable psl'

distance = 685
spam score = 42
title = 'ipcc 4th assessment report 2007 model ncarpcm scenario 1pto2x variable tas'

distance = 685
spam score = 38
title = 'ipcc 4th assessment report 2007 model mricgcm232 scenario 1pto2x variable vas'

distance = 712
spam score = 40
title = 'ipcc 4th assessment report 2007 model consechog scenario 20c3m variable vas'

distance = 714
spam score = 46
title = 'ipcc 4th assessment report 2007 model bccrbcm2 scenario 20c3m variable tas'

distance = 716
spam score = 35
title = 'ipcc 4th assessment report 2007 model cccmacgcm31t63 scenario sra1b variable rsds'

distance = 716
spam score = 40
title = 'ipcc 4th assessment report 2007 model cccmacgcm31t63 scenario srb1 variable tas'

distance = 716
spam score = 42
title = 'ipcc 4th assessment report 2007 model mricgcm232 scenario 1pto4x variable tas'

distance = 716
spam score = 42
title = 'ipcc 4th assessment report 2007 model mricgcm232 scenario 1pto2x variable tas'

distance = 717
spam score = 35
title = 'ipcc 4th assessment report 2007 model bccrbcm2 scenario 20c3m variable psl'

distance = 719
spam score = 40
title = 'ipcc 4th assessment report 2007 model niesmiroc32hi scenario 20c3m variable tasmax'

distance = 720
spam score = 47
title = 'ipcc 4th assessment report 2007 model bcccm1 scenario 1pto4x variable pr'

distance = 722
spam score = 44
title = 'ipcc 4th assessment report 2007 model lasgfgoalsg10 scenario 20c3m variable huss'

distance = 757
spam score = 42
title = 'ipcc 4th assessment report 2007 model ncarpcm scenario 20c3m variable tasmax'

distance = 757
spam score = 37
title = 'ipcc 4th assessment report 2007 model inmcm3 scenario 20c3m variable huss'

distance = 759
spam score = 44
title = 'ipcc 4th assessment report 2007 model nasagissaom scenario 20c3m variable tasmin'

distance = 764
spam score = 40
title = 'ipcc 4th assessment report 2007 model cccmacgcm31t47 scenario 20c3m variable rsds'

distance = 765
spam score = 42
title = 'ipcc 4th assessment report 2007 model bccrbcm2 scenario 20c3m variable pr'

distance = 773
spam score = 40
title = 'ipcc 4th assessment report 2007 model inmcm3 scenario 20c3m variable pr'

distance = 776
spam score = 42
title = 'ipcc 4th assessment report 2007 model ncarpcm scenario 20c3m variable tasmin'

distance = 783
spam score = 37
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario 20c3m variable rsds'

distance = 787
spam score = 41
title = 'ipcc 4th assessment report 2007 model csiromk3 scenario 20c3m variable pr'

distance = 790
spam score = 46
title = 'ipcc 4th assessment report 2007 model cccmacgcm31t47 scenario 20c3m variable pr'

distance = 1414
spam score = 29
title = 'ipcc 4th assessment report 2007 scenario 1pto2x'

distance = 1414
spam score = 31
title = 'ipcc 4th assessment report 2007 scenario sra1b'

distance = 1421
spam score = 24
title = 'ipcc 4th assessment report 2007 scenario pictl'

distance = 1421
spam score = 44
title = 'ipcc 4th assessment report 2007 model niesmiroc32med'

distance = 1426
spam score = 40
title = 'ipcc 4th assessment report 2007 model csiromk3'

distance = 1435
spam score = 43
title = 'ipcc 4th assessment report 2007 model mricgcm232'

distance = 1444
spam score = 38
title = 'ipcc 4th assessment report 2007 model mpimecham5'

distance = 1450
spam score = 40
title = 'ipcc 4th assessment report 2007 model lasgfgoalsg10'

distance = 1648
spam score = 76
title = ''

distance = 172
spam score = 75
title = ''

distance = 172
spam score = 72
title = ''

distance = 172
spam score = 73
title = ''

distance = 178
spam score = 70
title = ''

distance = 181
spam score = 71
title = ''

distance = 182
spam score = 74
title = ''

distance = 198
spam score = 75
title = ''

distance = 215
spam score = 68
title = ''

distance = 228
spam score = 72
title = ''

distance = 243
spam score = 72
title = ''

distance = 244
spam score = 69
title = ''

distance = 262
spam score = 69
title = ''

distance = 265
spam score = 72
title = ''

distance = 265
spam score = 70
title = ''

distance = 287
spam score = 70
title = ''

distance = 292
spam score = 71
title = ''

distance = 299
spam score = 71
title = ''

distance = 299
spam score = 68
title = ''

distance = 333
spam score = 72
title = ''

distance = 362
spam score = 67
title = ''

distance = 377
spam score = 76
title = ''

distance = 378
spam score = 73
title = ''

distance = 439
spam score = 67
title = ''

distance = 503
spam score = 65
title = ''

distance = 537
spam score = 66
title = ''

distance = 550
spam score = 70
title = ''

distance = 602
spam score = 68
title = ''

distance = 1077
spam score = 78
title = ''

distance = 1093
spam score = 74
title = ''

distance = 1112
spam score = 89
title = ''

distance = 1172
spam score = 87
title = ''

distance = 1182
spam score = 77
title = ''

distance = 1187
spam score = 89
title = ''

distance = 1215
spam score = 90
title = ''

distance = 1322
spam score = 76
title = ''

distance = 1333
spam score = 85
title = ''

distance = 1347
spam score = 68
title = ''

distance = 1350
spam score = 71
title = ''

distance = 1605
spam score = 84
title = ''

distance = 431
spam score = 47
title = 'tjoo2 tulsa 6s tabular'

distance = 442
spam score = 49
title = 'tjoo2 tulsa 6s tabular'

distance = 453
spam score = 51
title = 'tjoo2 tulsa 6s tabular'

distance = 460
spam score = 50
title = 'tjoo2 tulsa 6s tabular'

distance = 463
spam score = 55
title = 'tjoo2 tulsa 6s tabular'

distance = 466
spam score = 55
title = 'tjoo2 tulsa 6s tabular'

distance = 466
spam score = 54
title = 'tjoo2 tulsa 6s tabular'

distance = 467
spam score = 47
title = 'tjoo2 tulsa 6s tabular'

distance = 478
spam score = 50
title = 'heyo2 heyburn lake tabular'

distance = 480
spam score = 49
title = 'heyo2 heyburn lake tabular'

distance = 481
spam score = 50
title = 'tjoo2 tulsa 6s tabular'

distance = 481
spam score = 55
title = 'tjoo2 tulsa 6s tabular'

distance = 489
spam score = 50
title = 'tjoo2 tulsa 6s graphics'

distance = 490
spam score = 50
title = 'tjoo2 tulsa 6s tabular'

distance = 491
spam score = 50
title = 'heyo2 heyburn lake tabular'

distance = 491
spam score = 53
title = 'tjoo2 tulsa 6s tabular'

distance = 492
spam score = 54
title = 'heyo2 heyburn lake tabular'

distance = 496
spam score = 50
title = 'tjoo2 tulsa 6s graphics'

distance = 497
spam score = 49
title = 'tjoo2 tulsa 6s tabular'

distance = 507
spam score = 50
title = 'heyo2 heyburn lake tabular'

distance = 654
spam score = 49
title = 'mgwo2 mcgee creek wildlife refuge tabular'

distance = 654
spam score = 48
title = 'pero2 perry precip gage graphics'

distance = 655
spam score = 50
title = 'cyvk1 verdigris river coyville ks tabular'

distance = 655
spam score = 47
title = 'blko2 chikashia river blackwell ok tabular'

distance = 655
spam score = 55
title = 'mgwo2 mcgee creek wildlife refuge tabular'

distance = 655
spam score = 55
title = 'pero2 perry precip gage tabular'

distance = 655
spam score = 51
title = 'brlk1 neosho river burlington ks tabular'

distance = 655
spam score = 43
title = 'brio2 bridgeport 4e graphics'

distance = 656
spam score = 46
title = 'bpst2 bateman pump station tabular'

distance = 656
spam score = 51
title = 'ictk1 arkansas r at wichita ks tabular'

distance = 684
spam score = 49
title = 'lvno2 poteau river at loving ok tabular'

distance = 685
spam score = 52
title = 'rlso2 arkansas river ralston ok tabular'

distance = 685
spam score = 52
title = 'hlto2 hallet precip gage tabular'

distance = 685
spam score = 54
title = 'tono2 salt fork arkansas r tonkawa ok tabular'

distance = 685
spam score = 48
title = 'dexk1 dexter precip gage tabular'

distance = 685
spam score = 51
title = 'pero2 perry precip gage tabular'

distance = 685
spam score = 52
title = 'clvo2 canadian river calvin okla tabular'

distance = 686
spam score = 46
title = 'blko2 chikashia river blackwell ok graphics'

distance = 686
spam score = 51
title = 'hglo2 hugo lake tabular'

distance = 686
spam score = 51
title = 'wifk1 floodway at arkansas r at wichita ks tabular'

distance = 707
spam score = 49
title = 'zenk1 rattlesnake creek zenith tabular'

distance = 707
spam score = 48
title = 'camk1 grouse creek nr cameron ks tabular'

distance = 707
spam score = 44
title = 'pano2 poteau river at panama graphics'

distance = 707
spam score = 50
title = 'gtro2 cimmarron rguthrie ok tabular'

distance = 707
spam score = 55
title = 'wrwo2 deep fork r warwick ok tabular'

distance = 707
spam score = 52
title = 'anto2 kiamichi river antlers okla tabular'

distance = 707
spam score = 52
title = 'blko2 chikashia river blackwell ok graphics'

distance = 707
spam score = 48
title = 'ripo2 cimarron river near ripley ok graphics'

distance = 708
spam score = 49
title = 'cnlo2 canton lake tabular'

distance = 708
spam score = 43
title = 'cssk1 cassoday precip gage tabular'

distance = 728
spam score = 66
title = 'cngk1 council grove lake tabular'

distance = 728
spam score = 44
title = 'cask1 ninnescah river ab cheney reservoir tabular'

distance = 728
spam score = 53
title = 'lsdo2 stanley draper lake near okc graphics'

distance = 728
spam score = 53
title = 'atsn5 pecos river near artesia nm tabular'

distance = 728
spam score = 52
title = 'nlro2 little river blw lk thunderbird nr norman ok tabular'

distance = 728
spam score = 49
title = 'htdk1 little arkansas river at hwy 50 nr halstead ks tabular'

distance = 728
spam score = 45
title = 'wrwo2 deep fork r warwick ok tabular'

distance = 728
spam score = 45
title = 'nrmo2 lake thunderbird graphics'

distance = 728
spam score = 50
title = 'ekco2 lake creek nr eakly ok 2se nr binger 11w tabular'

distance = 728
spam score = 59
title = 'fwco2 wolf creek nr ft supply 9s tabular'

distance = 751
spam score = 43
title = 'htck1 cow creek near hutchinson ks tabular'

distance = 751
spam score = 49
title = 'syrk1 arkansas r at syracuse ks tabular'

distance = 751
spam score = 51
title = 'fwco2 wolf creek nr ft supply 9s graphics'

distance = 751
spam score = 57
title = 'chek1 n fk ninnescah river at cheney dam ks tabular'

distance = 751
spam score = 55
title = 'frmk1 farmers ditch nr deerfield ks graphics'

distance = 751
spam score = 52
title = 'wdgo2 n canadian riv woodward ok tabular'

distance = 751
spam score = 51
title = 'keyo2 keystone lake tabular'

distance = 751
spam score = 53
title = 'fsaa4 arkansas river at ft smith tabular'

distance = 751
spam score = 49
title = 'mrit2 lake meredith tabular'

distance = 751
spam score = 47
title = 'fslo2 fort supply lake graphics'

distance = 776
spam score = 43
title = 'mlbk1 marion lake graphics'

distance = 776
spam score = 52
title = 'drbk1 arkansas river derby ks tabular'

distance = 776
spam score = 49
title = 'alto2 altus lake ok tabular'

distance = 776
spam score = 48
title = 'camk1 grouse creek nr cameron ks graphics'

distance = 777
spam score = 43
title = 'cook1 arkansas river nr coolidge ks graphics'

distance = 777
spam score = 50
title = 'bgso2 deep fork river beggs okla tabular'

distance = 777
spam score = 46
title = 'arck1 arkansas riv ark city ks tabular'

distance = 777
spam score = 56
title = 'srco2 rock creek nr sulphur 2sw graphics'

distance = 777
spam score = 47
title = 'sklo2 skiatook lake tabular'

distance = 777
spam score = 44
title = 'keyo2 keystone lake graphics'

distance = 805
spam score = 49
title = 'bcat2 lake amon g carter nr bowie tabular'

distance = 805
spam score = 50
title = 'gsvt2 red river gainesville tx graphics'

distance = 805
spam score = 51
title = 'hsko2 arkansas river haskell ok tabular'

distance = 805
spam score = 41
title = 'cask1 ninnescah river ab cheney reservoir graphics'

distance = 805
spam score = 50
title = 'almk1 little arkansas river at alta mills ks tabular'

distance = 806
spam score = 52
title = 'wdgo2 n canadian riv woodward ok graphics'

distance = 806
spam score = 52
title = 'trlk1 toronto lake tabular'

distance = 806
spam score = 45
title = 'gtbk1 arkansas river at great bend graphics'

distance = 806
spam score = 47
title = 'bkdo2 broken bow lake tabular'

distance = 806
spam score = 48
title = 'batn5 bat draw raws at carlsbad caverns tabular'

distance = 849
spam score = 49
title = 'almk1 little arkansas river at alta mills ks graphics'

distance = 849
spam score = 47
title = 'cowk1 cowskin creek at 119th n wichita ks graphics'

distance = 849
spam score = 53
title = 'kawo2 kaw lake tabular'

distance = 849
spam score = 43
title = 'keyo2 keystone lake graphics'

distance = 850
spam score = 60
title = 'dsnt2 lake texoma denison dam tabular'

distance = 850
spam score = 47
title = 'clgk1 frontier ditch nr coolidge ks tabular'

distance = 850
spam score = 50
title = 'gsvt2 red river gainesville tx tabular'

distance = 850
spam score = 46
title = 'ctso2 bird creek at catoosa tabular'

distance = 850
spam score = 57
title = 'cdco2 dog creek south of claremore ok graphics'

distance = 851
spam score = 47
title = 'vbua4 arkansas river van buren ar graphics'

distance = 1782
spam score = 63
title = 'balistidae fishes of national park of american samoa'

distance = 1789
spam score = 54
title = 'beeftalk source and ageverified replacements are hard to find'

distance = 1794
spam score = 39
title = 'alt hoechst bahnhof railroad station 1870'

distance = 1796
spam score = 37
title = 'alt hoechst bahnhof railroad station 1870'

distance = 1808
spam score = 44
title = 'press release pib aizawlmizoram'

distance = 285
spam score = 31
title = ''

distance = 316
spam score = 36
title = ''

distance = 321
spam score = 36
title = ''

distance = 329
spam score = 25
title = ''

distance = 330
spam score = 36
title = ''

distance = 330
spam score = 33
title = ''

distance = 342
spam score = 33
title = ''

distance = 347
spam score = 33
title = ''

distance = 347
spam score = 39
title = ''

distance = 348
spam score = 28
title = ''

distance = 353
spam score = 28
title = ''

distance = 380
spam score = 33
title = ''

distance = 382
spam score = 30
title = ''

distance = 387
spam score = 30
title = ''

distance = 396
spam score = 32
title = ''

distance = 396
spam score = 30
title = ''

distance = 403
spam score = 32
title = ''

distance = 424
spam score = 23
title = ''

distance = 479
spam score = 32
title = ''

distance = 490
spam score = 34
title = ''

distance = 510
spam score = 35
title = ''

distance = 536
spam score = 33
title = ''

distance = 551
spam score = 34
title = ''

distance = 662
spam score = 35
title = ''

distance = 674
spam score = 34
title = ''

distance = 839
spam score = 32
title = ''

distance = 946
spam score = 37
title = ''

distance = 946
spam score = 40
title = ''

distance = 1039
spam score = 30
title = ''

distance = 1066
spam score = 72
title = ''

distance = 1264
spam score = 34
title = ''

distance = 1289
spam score = 41
title = ''

distance = 1325
spam score = 22
title = ''

distance = 1325
spam score = 27
title = ''

distance = 1393
spam score = 31
title = ''

distance = 1551
spam score = 82
title = ''

distance = 453
spam score = 52
title = 'nucleardb cross references for hnf4axenla'

distance = 489
spam score = 64
title = 'nucleardb cross references for gcrparol'

distance = 489
spam score = 59
title = 'nucleardb cross references for gcrsagoe'

distance = 493
spam score = 60
title = 'nucleardb cross references for pparcanfa'

distance = 496
spam score = 61
title = 'nucleardb cross references for vdrchick'

distance = 504
spam score = 64
title = 'nucleardb cross references for gcroncmy'

distance = 504
spam score = 59
title = 'nucleardb cross references for nhr1oncvo'

distance = 507
spam score = 67
title = 'nucleardb cross references for nhr11caeel'

distance = 507
spam score = 59
title = 'nucleardb cross references for ppasxenla'

distance = 510
spam score = 53
title = 'nucleardb cross references for vdrxenla'

distance = 510
spam score = 58
title = 'nucleardb cross references for pparcavpo'

distance = 511
spam score = 61
title = 'nucleardb cross references for cot2chick'

distance = 513
spam score = 60
title = 'nucleardb cross references for mcrxenla'

distance = 518
spam score = 60
title = 'nucleardb cross references for gcraotna'

distance = 518
spam score = 59
title = 'nucleardb cross references for pparxenla'

distance = 521
spam score = 65
title = 'nucleardb cross references for gcrcavpo'

distance = 522
spam score = 61
title = 'nucleardb cross references for vdrbovin'

distance = 525
spam score = 65
title = 'nucleardb cross references for cnr14caeel'

distance = 526
spam score = 57
title = 'nucleardb cross references for thbcaimo'

distance = 528
spam score = 59
title = 'nucleardb cross references for hr38bommo'

distance = 533
spam score = 62
title = 'nucleardb cross references for thbranca'

distance = 537
spam score = 59
title = 'nucleardb cross references for andreulfc'

distance = 537
spam score = 57
title = 'nucleardb cross references for thbbxenla'

distance = 547
spam score = 72
title = 'nucleardb cross references for andrrabit'

distance = 550
spam score = 60
title = 'nucleardb cross references for ppatrabit'

distance = 552
spam score = 59
title = 'nucleardb cross references for andrpantr'

distance = 553
spam score = 60
title = 'nucleardb cross references for gcrsaibb'

distance = 560
spam score = 58
title = 'nucleardb cross references for rxrgxenla'

distance = 560
spam score = 64
title = 'nucleardb cross references for ear2mouse'

distance = 567
spam score = 58
title = 'nucleardb cross references for rxraxenla'

distance = 571
spam score = 69
title = 'nucleardb cross references for nhr44caeel'

distance = 573
spam score = 63
title = 'nucleardb cross references for rxrarat'

distance = 577
spam score = 64
title = 'nucleardb cross references for gcrsaisc'

distance = 578
spam score = 65
title = 'nucleardb cross references for e75manse'

distance = 578
spam score = 52
title = 'nucleardb cross references for ppatxenla'

distance = 583
spam score = 58
title = 'nucleardb cross references for e75cdrome'

distance = 584
spam score = 56
title = 'nucleardb cross references for prgrcanfa'

distance = 585
spam score = 57
title = 'nucleardb cross references for thb2rat'

distance = 587
spam score = 57
title = 'nucleardb cross references for pxrrat'

distance = 593
spam score = 55
title = 'nucleardb cross references for err2rat'

distance = 601
spam score = 60
title = 'nucleardb cross references for e75bdrome'

distance = 601
spam score = 59
title = 'nucleardb cross references for esrb1carau'

distance = 609
spam score = 62
title = 'nucleardb cross references for cot1bovin'

distance = 610
spam score = 59
title = 'nucleardb cross references for thachick'

distance = 610
spam score = 60
title = 'nucleardb cross references for cot2bovin'

distance = 615
spam score = 57
title = 'nucleardb cross references for nr6a1mouse'

distance = 619
spam score = 61
title = 'nucleardb cross references for andrmacmu'

distance = 624
spam score = 67
title = 'nucleardb cross references for nhr54caeel'

distance = 627
spam score = 64
title = 'nucleardb cross references for vdrmouse'

distance = 636
spam score = 63
title = 'nucleardb cross references for q8igg2drome'

distance = 644
spam score = 64
title = 'nucleardb cross references for esr2chick'

distance = 647
spam score = 68
title = 'nucleardb cross references for nhr48caeel'

distance = 653
spam score = 64
title = 'nucleardb cross references for esr1oryla'

distance = 653
spam score = 64
title = 'nucleardb cross references for andrcrocr'

distance = 660
spam score = 64
title = 'nucleardb cross references for thb1rat'

distance = 680
spam score = 56
title = 'nucleardb cross references for rorbhuman'

distance = 686
spam score = 59
title = 'nucleardb cross references for q5qpb7human'

distance = 688
spam score = 57
title = 'nucleardb cross references for nr5a2mouse'

distance = 691
spam score = 68
title = 'nucleardb cross references for nhr28caeel'

distance = 692
spam score = 60
title = 'nucleardb cross references for q9n2h4rabit'

distance = 725
spam score = 59
title = 'nucleardb cross references for rorbmouse'

distance = 728
spam score = 63
title = 'nucleardb cross references for ecrhelvi'

distance = 730
spam score = 62
title = 'nucleardb cross references for q8bw69mouse'

distance = 738
spam score = 56
title = 'nucleardb cross references for q9vp28drome'

distance = 739
spam score = 70
title = 'nucleardb cross references for nhr34caeel'

distance = 750
spam score = 59
title = 'nucleardb cross references for ppatbovin'

distance = 762
spam score = 51
title = 'nucleardb cross references for rxrghuman'

distance = 778
spam score = 57
title = 'nucleardb cross references for q8sxa4drome'

distance = 783
spam score = 59
title = 'nucleardb cross references for q9i878chick'

distance = 787
spam score = 51
title = 'nucleardb cross references for nr4a2mouse'

distance = 807
spam score = 65
title = 'nucleardb cross references for tlldrome'

distance = 892
spam score = 77
title = 'nucleardb cross references for andrrat'

distance = 910
spam score = 55
title = 'nucleardb cross references for mcrmouse'

distance = 983
spam score = 53
title = 'gpcripdb cross references for q86fx8caere'

distance = 990
spam score = 56
title = 'gpcripdb cross references for q86fx6caere'

distance = 991
spam score = 64
title = 'priondb cross references for priochick'

distance = 996
spam score = 57
title = 'priondb cross references for q5u0k3human'

distance = 997
spam score = 59
title = 'priondb cross references for q6jm13melud'

distance = 1004
spam score = 56
title = 'gpcripdb cross references for q86fx9caere'

distance = 1010
spam score = 54
title = 'gpcripdb cross references for q5r9n4ponpy'

distance = 1036
spam score = 54
title = 'priondb cross references for q5uji1synca'

distance = 1050
spam score = 54
title = 'gpcripdb cross references for q7q6e0anoga'

distance = 1055
spam score = 59
title = 'kchanneldb cross references for q5tkj4orysa'

distance = 1063
spam score = 56
title = 'gpcripdb cross references for q7q5c3anoga'

distance = 1065
spam score = 58
title = 'gpcripdb cross references for gpa4caeel'

distance = 1077
spam score = 54
title = 'gpcripdb cross references for q6c684yarli'

distance = 1081
spam score = 54
title = 'gpcripdb cross references for q5rcq6ponpy'

distance = 1086
spam score = 51
title = 'kchanneldb cross references for q5pne8salpa'

distance = 1090
spam score = 56
title = 'gpcripdb cross references for q5eey4rat'

distance = 1104
spam score = 57
title = 'gpcripdb cross references for q5kry3lyosh'

distance = 1133
spam score = 58
title = 'gpcripdb cross references for q5jwe2human'

distance = 1135
spam score = 58
title = 'gpcripdb cross references for q5jwe1human'

distance = 1141
spam score = 54
title = 'gpcripdb cross references for q5jwe0human'

distance = 1144
spam score = 58
title = 'priondb cross references for q8tfb8yeast'

distance = 1147
spam score = 56
title = 'gpcripdb cross references for q5jwe3human'

distance = 1149
spam score = 55
title = 'gpcripdb cross references for q5jwe4human'

distance = 1149
spam score = 53
title = 'kchanneldb cross references for q24052drome'

distance = 1154
spam score = 55
title = 'gpcripdb cross references for q5jwc3human'

distance = 1164
spam score = 58
title = 'gpcripdb cross references for q5jwc5human'

distance = 1182
spam score = 58
title = 'gpcripdb cross references for q5jwe9human'

distance = 1194
spam score = 59
title = 'kchanneldb cross references for q9w2x0drome'

distance = 0
spam score = 68
title = ''

distance = 972
spam score = 80
title = ''

distance = 974
spam score = 79
title = ''

distance = 625
spam score = 75
title = 'geowhen database middle paleocene'

distance = 627
spam score = 71
title = 'geowhen database chatauquan'

distance = 645
spam score = 71
title = 'geowhen database senecan'

distance = 653
spam score = 65
title = 'geowhen database kiaitan'

distance = 657
spam score = 71
title = 'geowhen database carboniferous'

distance = 659
spam score = 73
title = 'geowhen database mangapirian'

distance = 663
spam score = 76
title = 'geowhen database rognacian'

distance = 665
spam score = 70
title = 'geowhen database early mississippian'

distance = 665
spam score = 72
title = 'geowhen database maozhangian'

distance = 669
spam score = 74
title = 'geowhen database toyonian'

distance = 670
spam score = 75
title = 'geowhen database tournaisian'

distance = 675
spam score = 73
title = 'geowhen database ibexian'

distance = 678
spam score = 72
title = 'geowhen database aptian'

distance = 681
spam score = 72
title = 'geowhen database silesian'

distance = 681
spam score = 73
title = 'geowhen database longwangmioan'

distance = 682
spam score = 68
title = 'geowhen database bulitian'

distance = 683
spam score = 70
title = 'geowhen database dinantian'

distance = 683
spam score = 65
title = 'geowhen database yujianian'

distance = 684
spam score = 72
title = 'geowhen database cretaceous'

distance = 685
spam score = 73
title = 'geowhen database medinan'

distance = 720
spam score = 70
title = 'geowhen database mapingian'

distance = 721
spam score = 73
title = 'geowhen database ludfordian'

distance = 724
spam score = 74
title = 'geowhen database paleoarchean'

distance = 725
spam score = 68
title = 'geowhen database payntonian'

distance = 725
spam score = 70
title = 'geowhen database coahulian'

distance = 725
spam score = 74
title = 'geowhen database aratauran'

distance = 729
spam score = 73
title = 'geowhen database priabonian'

distance = 729
spam score = 72
title = 'geowhen database makabewan'

distance = 729
spam score = 66
title = 'geowhen database late pleistocene'

distance = 731
spam score = 76
title = 'geowhen database kochian'

distance = 737
spam score = 82
title = 'geowhen database atdabanian'

distance = 738
spam score = 76
title = 'geowhen database senonian'

distance = 741
spam score = 74
title = 'geowhen database llandovery'

distance = 741
spam score = 68
title = 'geowhen database changhsingian'

distance = 742
spam score = 74
title = 'geowhen database ordian'

distance = 743
spam score = 67
title = 'geowhen database fennian'

distance = 743
spam score = 74
title = 'geowhen database gyliakian'

distance = 743
spam score = 74
title = 'geowhen database hettangian'

distance = 743
spam score = 75
title = 'geowhen database keiloran'

distance = 744
spam score = 71
title = 'geowhen database boomerangian'

distance = 756
spam score = 68
title = 'geowhen database myachkovskian'

distance = 756
spam score = 69
title = 'geowhen database mesoarchean'

distance = 756
spam score = 74
title = 'geowhen database statherian'

distance = 756
spam score = 69
title = 'geowhen database telfordian'

distance = 756
spam score = 78
title = 'geowhen database early silurian'

distance = 759
spam score = 66
title = 'geowhen database ulatisian'

distance = 760
spam score = 73
title = 'geowhen database amgan'

distance = 761
spam score = 69
title = 'geowhen database mortesnes'

distance = 762
spam score = 71
title = 'geowhen database johannian'

distance = 763
spam score = 70
title = 'geowhen database undillian'

distance = 776
spam score = 73
title = 'geowhen database neogene'

distance = 776
spam score = 67
title = 'geowhen database white rockian'

distance = 776
spam score = 67
title = 'geowhen database otaian'

distance = 777
spam score = 76
title = 'geowhen database tonian'

distance = 777
spam score = 65
title = 'geowhen database refugian'

distance = 777
spam score = 76
title = 'geowhen database induan'

distance = 778
spam score = 74
title = 'geowhen database aksayan'

distance = 778
spam score = 64
title = 'geowhen database haranoyan'

distance = 781
spam score = 78
title = 'geowhen database paleogene'

distance = 781
spam score = 72
title = 'geowhen database ordovician v'

distance = 791
spam score = 72
title = 'geowhen database late triassic'

distance = 793
spam score = 71
title = 'geowhen database capitanian'

distance = 794
spam score = 82
title = 'geowhen database paleoproterozoic'

distance = 794
spam score = 70
title = 'geowhen database neoarchean'

distance = 795
spam score = 74
title = 'geowhen database ochoan'

distance = 796
spam score = 73
title = 'geowhen database pennsylvanian'

distance = 796
spam score = 76
title = 'geowhen database paibian'

distance = 797
spam score = 64
title = 'geowhen database mangaorapan'

distance = 797
spam score = 72
title = 'geowhen database rhyacian'

distance = 799
spam score = 76
title = 'geowhen database nullaginian'

distance = 808
spam score = 69
title = 'geowhen database suchian'

distance = 810
spam score = 70
title = 'geowhen database sunwaptan'

distance = 811
spam score = 73
title = 'geowhen database proterozoic'

distance = 812
spam score = 71
title = 'geowhen database wheelerian'

distance = 812
spam score = 77
title = 'geowhen database ashgill'

distance = 813
spam score = 72
title = 'geowhen database gzhelian'

distance = 813
spam score = 73
title = 'geowhen database cincinnatian'

distance = 815
spam score = 80
title = 'geowhen database ectasian'

distance = 816
spam score = 71
title = 'geowhen database castlecliffian'

distance = 817
spam score = 68
title = 'geowhen database oxfordian'

distance = 831
spam score = 79
title = 'geowhen database archean'

distance = 833
spam score = 64
title = 'geowhen database bathonian'

distance = 834
spam score = 76
title = 'geowhen database vaalian'

distance = 834
spam score = 72
title = 'geowhen database late pennsylvanian'

distance = 835
spam score = 69
title = 'geowhen database relizian'

distance = 840
spam score = 86
title = 'geowhen database frasnian'

distance = 843
spam score = 65
title = 'geowhen database werrikooian'

distance = 844
spam score = 75
title = 'geowhen database wordian'

distance = 848
spam score = 78
title = 'geowhen database neoproterozoic'

distance = 851
spam score = 71
title = 'geowhen database luisian'

distance = 874
spam score = 72
title = 'geowhen database mayvillian'

distance = 875
spam score = 72
title = 'geowhen database longfordian'

distance = 876
spam score = 72
title = 'geowhen database namibian'

distance = 878
spam score = 83
title = 'geowhen database quaternary'

distance = 881
spam score = 71
title = 'geowhen database yurmatian'

distance = 887
spam score = 78
title = 'geowhen database luliangian'

distance = 894
spam score = 70
title = 'geowhen database ordovician vi'

distance = 896
spam score = 73
title = 'geowhen database mokolian'

distance = 897
spam score = 78
title = 'geowhen database festiniogian'

distance = 901
spam score = 75
title = 'geowhen database nemakitdaldynian'

distance = 1215
spam score = 94
title = 'geowhen database introduction'

distance = 1215
spam score = 94
title = 'geowhen database introduction'

distance = 1217
spam score = 82
title = 'geowhen database australia geologic nomenclature'

distance = 255
spam score = 89
title = ''

distance = 256
spam score = 88
title = ''

distance = 262
spam score = 86
title = ''

distance = 264
spam score = 81
title = ''

distance = 274
spam score = 91
title = ''

distance = 280
spam score = 90
title = ''

distance = 282
spam score = 79
title = ''

distance = 285
spam score = 84
title = ''

distance = 285
spam score = 83
title = ''

distance = 288
spam score = 80
title = ''

distance = 297
spam score = 86
title = ''

distance = 301
spam score = 82
title = ''

distance = 306
spam score = 83
title = ''

distance = 307
spam score = 85
title = ''

distance = 307
spam score = 83
title = ''

distance = 310
spam score = 85
title = ''

distance = 315
spam score = 83
title = ''

distance = 319
spam score = 74
title = ''

distance = 327
spam score = 81
title = ''

distance = 329
spam score = 75
title = ''

distance = 331
spam score = 88
title = ''

distance = 342
spam score = 82
title = ''

distance = 348
spam score = 78
title = ''

distance = 355
spam score = 82
title = ''

distance = 358
spam score = 81
title = ''

distance = 374
spam score = 68
title = ''

distance = 377
spam score = 76
title = ''

distance = 392
spam score = 83
title = ''

distance = 392
spam score = 86
title = ''

distance = 397
spam score = 82
title = ''

distance = 409
spam score = 76
title = ''

distance = 447
spam score = 86
title = ''

distance = 464
spam score = 77
title = ''

distance = 473
spam score = 83
title = ''

distance = 476
spam score = 77
title = ''

distance = 481
spam score = 82
title = ''

distance = 482
spam score = 80
title = ''

distance = 507
spam score = 85
title = ''

distance = 521
spam score = 76
title = ''

distance = 538
spam score = 87
title = ''

distance = 549
spam score = 76
title = ''

distance = 602
spam score = 79
title = ''

distance = 603
spam score = 72
title = ''

distance = 625
spam score = 84
title = ''

distance = 633
spam score = 78
title = ''

distance = 635
spam score = 84
title = ''

distance = 636
spam score = 81
title = ''

distance = 661
spam score = 78
title = ''

distance = 670
spam score = 84
title = ''

distance = 691
spam score = 85
title = ''

distance = 731
spam score = 82
title = ''

distance = 737
spam score = 82
title = ''

distance = 738
spam score = 83
title = ''

distance = 738
spam score = 76
title = ''

distance = 738
spam score = 87
title = ''

distance = 944
spam score = 63
title = ''

distance = 946
spam score = 77
title = ''

distance = 993
spam score = 69
title = ''

distance = 997
spam score = 79
title = ''

distance = 1041
spam score = 60
title = ''

distance = 1450
spam score = 54
title = ''

distance = 1451
spam score = 69
title = ''

distance = 1479
spam score = 73
title = ''

distance = 1482
spam score = 75
title = ''

distance = 1499
spam score = 75
title = ''

distance = 1501
spam score = 73
title = ''

distance = 1520
spam score = 68
title = ''

distance = 1609
spam score = 68
title = ''

distance = 1609
spam score = 69
title = ''

distance = 1723
spam score = 68
title = ''

distance = 1724
spam score = 54
title = ''

distance = 1887
spam score = 52
title = ''

distance = 532
spam score = 72
title = 'martial arts striking gear hand targets proforce thunder reaction shield'

distance = 568
spam score = 62
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce gladiator punch black'

distance = 587
spam score = 63
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce thunder leather focus glove'

distance = 595
spam score = 74
title = 'martial arts striking gear hand targets proforce lightning hand target'

distance = 608
spam score = 69
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce gladiator youth boxing gloves'

distance = 609
spam score = 63
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce thunder thigh guard'

distance = 611
spam score = 68
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce thunder vinyl mma gloves'

distance = 611
spam score = 72
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce thunder leather mma gloves blueblack'

distance = 621
spam score = 68
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce gladiator focus mit'

distance = 622
spam score = 65
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce knee guard black'

distance = 623
spam score = 61
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce thunder deluxe abdomen shield'

distance = 626
spam score = 57
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce fist protector black'

distance = 627
spam score = 61
title = 'martial arts headguards proforce thunder full headguard w shield yellow'

distance = 629
spam score = 62
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce wrist wrap gloves'

distance = 632
spam score = 61
title = 'martial arts striking gear hand targets proforce lightning double hand paddle red'

distance = 633
spam score = 67
title = 'martial arts makiwara breakable boards proforce plastic rebreakable brick'

distance = 634
spam score = 70
title = 'martial arts sparring gloves wkf karate gloves red'

distance = 634
spam score = 56
title = 'martial arts striking gear hand targets proforce thunder vinyl body shield'

distance = 637
spam score = 77
title = 'martial arts striking gear hand targets proforce lightning double hand paddle black'

distance = 641
spam score = 67
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce thunder vinyl focus glove'

distance = 701
spam score = 62
title = 'martial arts headguards proforce thunder full headguard w shield black'

distance = 701
spam score = 62
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment adidas vinyl instep protector blue'

distance = 701
spam score = 55
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce thunder curved vinyl focus mitt'

distance = 702
spam score = 61
title = 'martial arts headguards proforce thunder full headguard w shield red'

distance = 703
spam score = 56
title = 'martial arts striking gear hand targets proforce muay thai focus pad'

distance = 703
spam score = 60
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment everlast rocky balboa youth boxing kit'

distance = 706
spam score = 63
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce thunder leather boxing gloves'

distance = 707
spam score = 65
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce airprene glove wraps black'

distance = 708
spam score = 52
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce leather bag gloves'

distance = 710
spam score = 74
title = 'martial arts striking gear hand targets proforce lightning hand paddle blue'

distance = 728
spam score = 72
title = 'martial arts striking gear hand targets proforce thunder leather body shield'

distance = 736
spam score = 63
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce leatherette boxing gloves wred palm'

distance = 737
spam score = 65
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce airprene glove wraps pink'

distance = 741
spam score = 78
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment everlast leather striking gloves'

distance = 742
spam score = 70
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment everlast pro grappling gloves'

distance = 745
spam score = 60
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment wkf leg protector winstep guard red'

distance = 745
spam score = 65
title = 'martial arts striking gear hand targets proforce strongleg training target'

distance = 747
spam score = 71
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce original leather boxing gloves'

distance = 747
spam score = 69
title = 'martial arts striking gear hand targets proforce arm shield'

distance = 748
spam score = 74
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce knee guard black'

distance = 763
spam score = 64
title = 'martial arts supporters cups proforce thunder tpr supporter cup'

distance = 764
spam score = 60
title = 'martial arts striking gear hand targets proforce ultra arm shield'

distance = 764
spam score = 78
title = 'martial arts makiwara breakable boards wooden breakable boards 1 thick'

distance = 764
spam score = 65
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce thunder pink aerobic gloves'

distance = 765
spam score = 82
title = 'martial arts striking gear hand targets proforce square hand target red'

distance = 765
spam score = 56
title = 'martial arts striking gear hand targets proforce vinyl shock bag'

distance = 767
spam score = 60
title = 'martial arts sparring gloves adidas wkf karate mitt red'

distance = 767
spam score = 58
title = 'martial arts sparring gloves adidas wkf karate mitt w thumb slot blue'

distance = 767
spam score = 54
title = 'martial arts striking gear hand targets proforce foam shield red'

distance = 769
spam score = 68
title = 'martial arts makiwara breakable boards proforce rebreakable boards'

distance = 790
spam score = 68
title = 'martial arts headguards thunder double layered headguard plain black'

distance = 791
spam score = 65
title = 'martial arts sparring gloves thunder double layered punch plain yellow'

distance = 791
spam score = 66
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment adidas wkf leg protector winstep guard blue'

distance = 794
spam score = 62
title = 'martial arts makiwara breakable boards square makiwara striking bag'

distance = 797
spam score = 62
title = 'martial arts striking gear hand targets proforce double end striking ball vinyl'

distance = 798
spam score = 57
title = 'martial arts headguards proforce thunder full headguard w shield blue'

distance = 798
spam score = 59
title = 'martial arts sparring gloves nkf karate gloves blue'

distance = 801
spam score = 57
title = 'martial arts headguards proforce headguard wface cage black'

distance = 803
spam score = 63
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment adidas double hand paddle blackred'

distance = 804
spam score = 69
title = 'martial arts sparring kicks proforce gladiator kicks black'

distance = 822
spam score = 69
title = 'martial arts sparring gloves tokaido wkf karate gloves blue'

distance = 822
spam score = 65
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment adidas wkf leg protector winstep guard red'

distance = 823
spam score = 56
title = 'martial arts headguards proforce thunder leather mma head guard blue'

distance = 826
spam score = 56
title = 'martial arts headguards everlast headgear red durahide'

distance = 827
spam score = 62
title = 'martial arts protective gear for women proforce female tuck under guard'

distance = 829
spam score = 78
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce double sided battle stick'

distance = 829
spam score = 74
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment adidas polyspan instep guard red'

distance = 830
spam score = 76
title = 'martial arts mouthguards shock doctor pro mouthguard'

distance = 830
spam score = 67
title = 'martial arts mouthguards shock doctor braces mouthguard'

distance = 832
spam score = 66
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment adidas polyspan instep guard blue'

distance = 861
spam score = 71
title = 'martial arts headguards proforce velocity headguard white'

distance = 862
spam score = 62
title = 'martial arts headguards lightning helmet with faceguard redblack'

distance = 862
spam score = 63
title = 'martial arts mouthguards shock doctor braces mouthguard'

distance = 863
spam score = 68
title = 'martial arts headguards proforce thunder leather mma head guard blue'

distance = 863
spam score = 64
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce combination cloth shininstep guard black'

distance = 866
spam score = 76
title = 'martial arts headguards macho warrior headguard blue'

distance = 867
spam score = 68
title = 'martial arts striking gear hand targets kime bag'

distance = 869
spam score = 77
title = 'martial arts striking gear hand targets proforce strongarm ii training target'

distance = 869
spam score = 67
title = 'martial arts sparring kicks proforce lightning kicks red'

distance = 870
spam score = 64
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment everlast everflex pro style hand wraps'

distance = 887
spam score = 73
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce combination cloth shininstep guard white'

distance = 887
spam score = 64
title = 'martial arts chestrib guards proforce velocity chest guard black'

distance = 889
spam score = 64
title = 'martial arts sparring kicks proforce lightning kicks red'

distance = 889
spam score = 66
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment brute quad iii ear guard black'

distance = 894
spam score = 71
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment proforce combination cloth shininstep guard white'

distance = 898
spam score = 68
title = 'martial arts headguards proforce velocity headguard pink'

distance = 898
spam score = 67
title = 'martial arts mouthguards shock doctor mouthguard case'

distance = 901
spam score = 62
title = 'martial arts headguards proforce thunder padded combat head guard w face cage'

distance = 903
spam score = 68
title = 'martial arts sparring kicks thunder double layered kick plain white'

distance = 905
spam score = 66
title = 'martial arts striking gear hand targets triple target team training system'

distance = 938
spam score = 74
title = 'martial arts headguards proforce lightning sparring head guard headgear red'

distance = 939
spam score = 66
title = 'martial arts sparring kicks proforce thunder double layer sparring boots kicks black'

distance = 941
spam score = 65
title = 'martial arts sparring kicks macho warrior kick blue'

distance = 943
spam score = 68
title = 'martial arts training equipment usa junior speed jumprope'

distance = 946
spam score = 54
title = 'martial arts sparring gloves proforce lightning sparring gloves punches blue'

distance = 962
spam score = 62
title = 'martial arts headguards proforce thunder double layer sparring head gear head guard headgear pink'

distance = 965
spam score = 58
title = 'martial arts sparring gloves proforce thunder double layer sparring gloves punches blue'

distance = 966
spam score = 68
title = 'martial arts headguards proforce lightning sparring head guard headgear white'

distance = 966
spam score = 72
title = 'martial arts sparring gloves proforce velocity long punches red'

distance = 971
spam score = 63
title = 'martial arts mouthguards shock doctor power double mouthguard'

distance = 1292
spam score = 71
title = 'awmacomthe leading distributor of martial arts supplies boxing gear amp exercise equipment book encyclopedia of okinawan weapons'

distance = 448
spam score = 62
title = ''

distance = 458
spam score = 50
title = ''

distance = 469
spam score = 59
title = ''

distance = 471
spam score = 60
title = ''

distance = 480
spam score = 54
title = ''

distance = 481
spam score = 61
title = ''

distance = 495
spam score = 55
title = ''

distance = 497
spam score = 63
title = ''

distance = 505
spam score = 60
title = ''

distance = 507
spam score = 53
title = ''

distance = 511
spam score = 52
title = ''

distance = 522
spam score = 46
title = ''

distance = 523
spam score = 58
title = ''

distance = 529
spam score = 59
title = ''

distance = 529
spam score = 60
title = ''

distance = 535
spam score = 53
title = ''

distance = 543
spam score = 55
title = ''

distance = 544
spam score = 64
title = ''

distance = 556
spam score = 55
title = ''

distance = 561
spam score = 55
title = ''

distance = 594
spam score = 57
title = ''

distance = 608
spam score = 57
title = ''

distance = 677
spam score = 79
title = ''

distance = 687
spam score = 56
title = ''

distance = 689
spam score = 84
title = ''

distance = 695
spam score = 52
title = ''

distance = 712
spam score = 47
title = ''

distance = 715
spam score = 51
title = ''

distance = 716
spam score = 80
title = ''

distance = 721
spam score = 54
title = ''

distance = 732
spam score = 52
title = ''

distance = 732
spam score = 52
title = ''

distance = 748
spam score = 89
title = ''

distance = 763
spam score = 58
title = ''

distance = 763
spam score = 53
title = ''

distance = 800
spam score = 80
title = ''

distance = 810
spam score = 82
title = ''

distance = 813
spam score = 56
title = ''

distance = 822
spam score = 75
title = ''

distance = 887
spam score = 46
title = ''

distance = 887
spam score = 59
title = ''

distance = 899
spam score = 65
title = ''

distance = 1647
spam score = 88
title = ''

distance = 1650
spam score = 90
title = ''

distance = 1662
spam score = 85
title = ''

distance = 1664
spam score = 85
title = ''

distance = 1678
spam score = 88
title = ''

distance = 463
spam score = 15
title = 'mspatchadll file info'

distance = 490
spam score = 14
title = 'download dll mfcd30dll'

distance = 491
spam score = 14
title = 'fribididll errors more dll files'

distance = 508
spam score = 22
title = 'listenvdll information and download'

distance = 511
spam score = 21
title = 'dll files dscvrdll'

distance = 512
spam score = 24
title = 'other dll files dcstddll'

distance = 516
spam score = 18
title = 'dll file download and information for ati3d1agdll'

distance = 517
spam score = 19
title = 'looking for cnbpgr05dll file'

distance = 519
spam score = 23
title = 'contentdll download file'

distance = 520
spam score = 19
title = 'dll file oixssodll'

distance = 520
spam score = 21
title = 'dll file information dccutilcdll'

distance = 522
spam score = 15
title = 'dll file information and download imgutildll'

distance = 522
spam score = 21
title = 'looking for enhfiltdll file'

distance = 522
spam score = 20
title = 'jobexecdll errors more dll files'

distance = 527
spam score = 21
title = 'more info keymgrdll'

distance = 529
spam score = 21
title = 'ictest32dll download'

distance = 531
spam score = 16
title = 'more dll files information mmxptdll'

distance = 533
spam score = 14
title = 'awdcxc32dll file'

distance = 534
spam score = 24
title = 'more dll files information authzdll'

distance = 535
spam score = 14
title = 'other dll files iismapdll'

distance = 544
spam score = 19
title = 'msimg32dll downloads'

distance = 548
spam score = 20
title = 'iedkcs32dll file information'

distance = 549
spam score = 23
title = 'msdaprstdll more information'

distance = 549
spam score = 18
title = 'inresgerdll files download'

distance = 550
spam score = 19
title = 'download the csccdvcdll'

distance = 557
spam score = 23
title = 'msdatl2dll file info and download'

distance = 557
spam score = 18
title = 'download authfiltdll file'

distance = 560
spam score = 21
title = 'instappndll file download'

distance = 563
spam score = 15
title = 'download fsusddll'

distance = 563
spam score = 17
title = 'hpgt33dll information'

distance = 567
spam score = 20
title = 'csa2cdll files download'

distance = 568
spam score = 22
title = 'icsrwdll downloads'

distance = 584
spam score = 20
title = 'more info itircl52dll'

distance = 585
spam score = 21
title = 'msadrh15dll download'

distance = 589
spam score = 21
title = 'download information other files kerberosdll'

distance = 589
spam score = 16
title = 'msdfmapdll file info and download'

distance = 590
spam score = 18
title = 'nntpadsiisexdll file info and download'

distance = 590
spam score = 16
title = 'hpv820aldll download file information'

distance = 592
spam score = 17
title = 'get file information ndsauthdll file'

distance = 594
spam score = 13
title = 'dgconfigdll more information'

distance = 612
spam score = 16
title = 'dll file information and download ltfil11ndll'

distance = 613
spam score = 14
title = 'msrdc32ocx file dll files and ocx files'

distance = 616
spam score = 23
title = 'acev2dll errors more dll files'

distance = 618
spam score = 13
title = 'get the dspr3260dll file'

distance = 631
spam score = 15
title = 'lttwn90ndll file download'

distance = 633
spam score = 18
title = 'neroerrdll details'

distance = 655
spam score = 14
title = 'ir50lcsdll downloads'

distance = 665
spam score = 20
title = 'msdaprsrdll downloads'

distance = 690
spam score = 18
title = 'inreskordll file database'

distance = 693
spam score = 14
title = 'dll file download and information for esucmddll'

distance = 725
spam score = 20
title = 'download dll ipix32dtdll'

distance = 751
spam score = 17
title = 'ltimg11ndll file dll files and ocx files'

distance = 755
spam score = 13
title = 'dll file information cq90srdrdll'

distance = 756
spam score = 18
title = 'ltwrp10ndll file download'

distance = 760
spam score = 17
title = 'dll file information and download lxaguidll'

distance = 764
spam score = 21
title = 'laresdedll file dll files and ocx files'

distance = 790
spam score = 15
title = 'dswaveddll information dll download'

distance = 796
spam score = 18
title = 'download file information dinputdll'

distance = 797
spam score = 24
title = 'diskmgrdll info dll details'

distance = 801
spam score = 18
title = 'dfsshlexdll errors find information'

distance = 813
spam score = 23
title = 'download information other files dbres09dll'

distance = 814
spam score = 19
title = 'download dll hccutilsdll'

distance = 815
spam score = 19
title = 'instrdp5dll download file information'

distance = 815
spam score = 17
title = 'iernoncedll errors more dll files'

distance = 817
spam score = 18
title = 'more dll files iislog51dll'

distance = 818
spam score = 21
title = 'acgenraldll download file info'

distance = 822
spam score = 17
title = 'mmcshextdll download files'

distance = 823
spam score = 15
title = 'dsquerydll errors more dll files'

distance = 825
spam score = 20
title = 'download the cmouseccdll'

distance = 828
spam score = 20
title = 'mfc70enudll information and download'

distance = 838
spam score = 22
title = 'other dll files msdaippdll'

distance = 838
spam score = 17
title = 'httpapidll file download and information'

distance = 840
spam score = 13
title = 'debugexdll dll file'

distance = 847
spam score = 20
title = 'download kbdgkldll'

distance = 850
spam score = 21
title = 'dll file information download dynaplaydll'

distance = 852
spam score = 21
title = 'file errors outsidexocx'

distance = 853
spam score = 16
title = 'get file information adptifdll file'

distance = 854
spam score = 19
title = 'mciole32dll errors get more info'

distance = 860
spam score = 19
title = 'dll files dtdr3260dll'

distance = 866
spam score = 16
title = 'objfedexdll database of dll files'

distance = 887
spam score = 16
title = 'cdpl3210dll information dll download'

distance = 888
spam score = 21
title = 'kbdrudll information and download'

distance = 889
spam score = 18
title = 'mss32dll errors find information'

distance = 889
spam score = 17
title = 'cdda3260dll dll file'

distance = 894
spam score = 19
title = 'download files dec2uuedll'

distance = 895
spam score = 17
title = 'ati2edxxdll file dll files and ocx files'

distance = 895
spam score = 19
title = 'dll file information mhtipvbx'

distance = 896
spam score = 18
title = 'more info kbdinoridll'

distance = 901
spam score = 23
title = 'msdatl3dll file'

distance = 907
spam score = 17
title = 'connsvcrdll download file information'

distance = 915
spam score = 22
title = 'more info dbdcrt32dll'

distance = 916
spam score = 18
title = 'file errors lffax70ndll'

distance = 925
spam score = 16
title = 'ojidll errors find information'

distance = 926
spam score = 21
title = 'gdplangdll dll file'

distance = 929
spam score = 17
title = 'leditdll file'

distance = 933
spam score = 19
title = 'crdesigneruidll details'

distance = 948
spam score = 24
title = 'atiddcdll more information'

distance = 955
spam score = 20
title = 'download datasdll'

distance = 960
spam score = 14
title = 'iatilcsdll'

distance = 966
spam score = 19
title = 'lucadll files download'

distance = 1547
spam score = 7
title = 'nvcsedll information what is nvcsedll'

distance = 1551
spam score = 8
title = 'nvcschedexe information what is nvcschedexe'

distance = 1556
spam score = 9
title = 'spr32x35ocx information what is spr32x35ocx file'

distance = 1560
spam score = 8
title = 'cmd32exe information what is cmd32exe'

distance = 1626
spam score = 10
title = 'ccenterexe information what is ccenterexe'

distance = 1648
spam score = 7
title = 'vsnapvssexe information what is vsnapvssexe file'

distance = 1654
spam score = 7
title = 'nsctopexe information what is nsctopexe'

distance = 1666
spam score = 86
title = 'tippingpoint dvlabs mindshare importing multiple modules into a single idb'

distance = 1850
spam score = 14
title = 'quelques trojans chevaux de troie vecteurs de spywares'

distance = 748
spam score = 69
title = ''

distance = 748
spam score = 69
title = ''

distance = 868
spam score = 94
title = ''

distance = 891
spam score = 95
title = ''

distance = 893
spam score = 79
title = ''

distance = 603
spam score = 62
title = ''

distance = 606
spam score = 51
title = ''

distance = 608
spam score = 57
title = ''

distance = 608
spam score = 57
title = ''

distance = 610
spam score = 70
title = ''

distance = 613
spam score = 68
title = ''

distance = 615
spam score = 59
title = ''

distance = 616
spam score = 59
title = ''

distance = 618
spam score = 55
title = ''

distance = 618
spam score = 52
title = ''

distance = 619
spam score = 57
title = ''

distance = 619
spam score = 59
title = ''

distance = 622
spam score = 74
title = ''

distance = 625
spam score = 61
title = ''

distance = 629
spam score = 52
title = ''

distance = 629
spam score = 55
title = ''

distance = 629
spam score = 56
title = ''

distance = 629
spam score = 78
title = ''

distance = 633
spam score = 59
title = ''

distance = 633
spam score = 58
title = ''

distance = 634
spam score = 56
title = ''

distance = 634
spam score = 56
title = ''

distance = 635
spam score = 70
title = ''

distance = 639
spam score = 54
title = ''

distance = 640
spam score = 58
title = ''

distance = 642
spam score = 62
title = ''

distance = 643
spam score = 52
title = ''

distance = 643
spam score = 50
title = ''

distance = 645
spam score = 56
title = ''

distance = 651
spam score = 74
title = ''

distance = 654
spam score = 67
title = ''

distance = 655
spam score = 55
title = ''

distance = 655
spam score = 54
title = ''

distance = 656
spam score = 64
title = ''

distance = 663
spam score = 61
title = ''

distance = 680
spam score = 60
title = ''

distance = 706
spam score = 56
title = ''

distance = 722
spam score = 57
title = ''

distance = 723
spam score = 64
title = ''

distance = 725
spam score = 60
title = ''

distance = 727
spam score = 69
title = ''

distance = 727
spam score = 58
title = ''

distance = 730
spam score = 55
title = ''

distance = 730
spam score = 58
title = ''

distance = 730
spam score = 55
title = ''

distance = 730
spam score = 72
title = ''

distance = 730
spam score = 76
title = ''

distance = 732
spam score = 58
title = ''

distance = 732
spam score = 56
title = ''

distance = 733
spam score = 57
title = ''

distance = 735
spam score = 69
title = ''

distance = 736
spam score = 56
title = ''

distance = 736
spam score = 75
title = ''

distance = 737
spam score = 57
title = ''

distance = 737
spam score = 57
title = ''

distance = 737
spam score = 54
title = ''

distance = 737
spam score = 74
title = ''

distance = 739
spam score = 74
title = ''

distance = 741
spam score = 78
title = ''

distance = 741
spam score = 54
title = ''

distance = 742
spam score = 57
title = ''

distance = 742
spam score = 53
title = ''

distance = 743
spam score = 56
title = ''

distance = 743
spam score = 57
title = ''

distance = 743
spam score = 56
title = ''

distance = 743
spam score = 49
title = ''

distance = 744
spam score = 73
title = ''

distance = 757
spam score = 61
title = ''

distance = 759
spam score = 62
title = ''

distance = 763
spam score = 72
title = ''

distance = 763
spam score = 54
title = ''

distance = 771
spam score = 76
title = ''

distance = 772
spam score = 62
title = ''

distance = 773
spam score = 30
title = ''

distance = 775
spam score = 31
title = ''

distance = 776
spam score = 74
title = ''

distance = 1176
spam score = 44
title = ''

distance = 1542
spam score = 82
title = ''

distance = 1627
spam score = 44
title = ''

distance = 1633
spam score = 30
title = ''

distance = 1634
spam score = 37
title = ''

distance = 1634
spam score = 39
title = ''

distance = 1638
spam score = 36
title = ''

distance = 1639
spam score = 60
title = ''

distance = 1740
spam score = 8
title = ''

distance = 209
spam score = 91
title = ''

distance = 333
spam score = 93
title = ''

distance = 355
spam score = 92
title = ''

distance = 382
spam score = 94
title = ''

distance = 382
spam score = 91
title = ''

distance = 386
spam score = 93
title = ''

distance = 432
spam score = 93
title = ''

distance = 434
spam score = 93
title = ''

distance = 440
spam score = 95
title = ''

distance = 441
spam score = 92
title = ''

distance = 447
spam score = 93
title = ''

distance = 455
spam score = 94
title = ''

distance = 470
spam score = 94
title = ''

distance = 482
spam score = 92
title = ''

distance = 499
spam score = 94
title = ''

distance = 508
spam score = 92
title = ''

distance = 519
spam score = 93
title = ''

distance = 524
spam score = 91
title = ''

distance = 554
spam score = 94
title = ''

distance = 557
spam score = 91
title = ''

distance = 568
spam score = 94
title = ''

distance = 589
spam score = 91
title = ''

distance = 611
spam score = 94
title = ''

distance = 638
spam score = 93
title = ''

distance = 640
spam score = 91
title = ''

distance = 642
spam score = 94
title = ''

distance = 643
spam score = 87
title = ''

distance = 689
spam score = 93
title = ''

distance = 691
spam score = 94
title = ''

distance = 699
spam score = 91
title = ''

distance = 701
spam score = 96
title = ''

distance = 704
spam score = 94
title = ''

distance = 708
spam score = 93
title = ''

distance = 717
spam score = 95
title = ''

distance = 728
spam score = 91
title = ''

distance = 757
spam score = 92
title = ''

distance = 759
spam score = 90
title = ''

distance = 760
spam score = 93
title = ''

distance = 784
spam score = 86
title = ''

distance = 791
spam score = 89
title = ''

distance = 817
spam score = 94
title = ''

distance = 821
spam score = 91
title = ''

distance = 834
spam score = 92
title = ''

distance = 837
spam score = 94
title = ''

distance = 913
spam score = 91
title = ''

distance = 931
spam score = 90
title = ''

distance = 941
spam score = 94
title = ''

distance = 972
spam score = 93
title = ''

distance = 1019
spam score = 93
title = ''

distance = 1072
spam score = 93
title = ''

distance = 1080
spam score = 93
title = ''

distance = 1099
spam score = 92
title = ''

distance = 1108
spam score = 90
title = ''

distance = 1147
spam score = 89
title = ''

distance = 1176
spam score = 91
title = ''

distance = 1198
spam score = 91
title = ''

distance = 1237
spam score = 93
title = ''

distance = 1266
spam score = 88
title = ''

distance = 1382
spam score = 94
title = ''

distance = 1408
spam score = 89
title = ''

distance = 1499
spam score = 90
title = ''

distance = 1669
spam score = 97
title = ''

distance = 1701
spam score = 90
title = ''

distance = 273
spam score = 75
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 287
spam score = 72
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 294
spam score = 72
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 345
spam score = 75
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 357
spam score = 72
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 359
spam score = 73
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 361
spam score = 70
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 371
spam score = 81
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 376
spam score = 77
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 388
spam score = 79
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 396
spam score = 73
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 403
spam score = 76
title = 'futabareg 8u radio system frequently asked questions faq'

distance = 410
spam score = 74
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 420
spam score = 75
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 445
spam score = 71
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 446
spam score = 79
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 462
spam score = 78
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 472
spam score = 76
title = 'futabareg 7u7u super radio system frequently asked questions faq'

distance = 473
spam score = 75
title = 'futabareg 7u7u super radio system frequently asked questions faq'

distance = 475
spam score = 69
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 475
spam score = 80
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 476
spam score = 73
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 479
spam score = 75
title = 'futabareg 8u radio system frequently asked questions faq'

distance = 484
spam score = 73
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 487
spam score = 72
title = 'futabareg 8u radio system frequently asked questions faq'

distance = 489
spam score = 75
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 492
spam score = 81
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 505
spam score = 72
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 509
spam score = 76
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 514
spam score = 76
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 518
spam score = 76
title = 'futabareg 7u7u super radio system frequently asked questions faq'

distance = 532
spam score = 75
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 550
spam score = 72
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 561
spam score = 75
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 562
spam score = 72
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 564
spam score = 78
title = 'futabareg 8u9c9z radio system frequently asked questions faq'

distance = 564
spam score = 76
title = 'futabareg 8u radio system frequently asked questions faq'

distance = 574
spam score = 73
title = 'futabareg 6x6x super radio system frequently asked questions faq'

distance = 589
spam score = 73
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 591
spam score = 80
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 608
spam score = 80
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 611
spam score = 74
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 619
spam score = 75
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 626
spam score = 78
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 645
spam score = 70
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 650
spam score = 71
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 650
spam score = 75
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 663
spam score = 79
title = 'futabareg 8u radio system frequently asked questions faq'

distance = 672
spam score = 82
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 672
spam score = 79
title = 'futabareg 6exa super radio system frequently asked questions faq'

distance = 672
spam score = 78
title = 'futabareg 8u9c9z radio system frequently asked questions faq'

distance = 676
spam score = 78
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 678
spam score = 73
title = 'futabareg 12fg radio system frequently asked questions faq'

distance = 678
spam score = 74
title = 'futabareg 8u radio system frequently asked questions faq'

distance = 682
spam score = 76
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 694
spam score = 73
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 706
spam score = 86
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 711
spam score = 74
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 721
spam score = 78
title = 'futabareg 6x6x super radio system frequently asked questions faq'

distance = 728
spam score = 79
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 737
spam score = 77
title = 'futabareg 6x6x super radio system frequently asked questions faq'

distance = 765
spam score = 70
title = 'futabareg radio systems'

distance = 768
spam score = 76
title = 'futabareg 6x6x super radio system frequently asked questions faq'

distance = 770
spam score = 67
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 781
spam score = 75
title = 'futabareg 6vh super radio system frequently asked questions faq'

distance = 784
spam score = 69
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 796
spam score = 76
title = 'futabareg am conversion module for 3pk'

distance = 806
spam score = 73
title = 'futabareg 6x6x super radio system frequently asked questions faq'

distance = 815
spam score = 79
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 819
spam score = 71
title = 'futabareg 7c radio system frequently asked questions faq'

distance = 821
spam score = 64
title = 'futabareg 6da radio system frequently asked questions faq'

distance = 836
spam score = 74
title = 'futabareg 6da radio system frequently asked questions faq'

distance = 841
spam score = 73
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 842
spam score = 70
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 843
spam score = 75
title = 'futabareg 9c radio system frequently asked questions faq'

distance = 856
spam score = 73
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 890
spam score = 55
title = 'futabareg 4yf radio system frequently asked questions faq'

distance = 895
spam score = 57
title = 'futabareg 4yf radio system frequently asked questions faq'

distance = 895
spam score = 69
title = 'futabareg 4yf radio system frequently asked questions faq'

distance = 914
spam score = 76
title = 'futabareg 6x super radio system frequently asked questions faq'

distance = 920
spam score = 70
title = 'futabareg 6x6x super radio system frequently asked questions faq'

distance = 923
spam score = 79
title = 'futabareg 12fg radio system frequently asked questions faq'

distance = 945
spam score = 81
title = 'futabareg 6x6x super radio system frequently asked questions faq'

distance = 968
spam score = 81
title = 'futabareg 6vh skysport radio discontinued'

distance = 984
spam score = 80
title = 'futabareg 2fr single stick am radio discontinued'

distance = 987
spam score = 79
title = 'futabareg 12z radio system frequently asked questions faq'

distance = 1056
spam score = 76
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 1093
spam score = 75
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 1095
spam score = 67
title = 'futabareg trainer cords'

distance = 1102
spam score = 77
title = 'futabareg 9z radio system frequently asked questions faq'

distance = 1112
spam score = 64
title = 'futabareg parts listings switches'

distance = 1122
spam score = 77
title = 'futabareg parts listings switches'

distance = 1123
spam score = 66
title = 'futabareg 7uhf7uhp manual notes'

distance = 1124
spam score = 82
title = 'futabareg 7uhf7uhp manual notes'

distance = 1125
spam score = 74
title = 'futabareg 8u amp 9z radio system frequently asked questions faq'

distance = 1133
spam score = 57
title = 'buy a futaba fasst8482 radio system and get a second receiver free'

distance = 1196
spam score = 89
title = 'futabareg 4exa fm radio'

distance = 1201
spam score = 82
title = 'futabareg 4exa fm radio'

distance = 1222
spam score = 81
title = 'futabareg 8u radio system frequently asked questions faq'

distance = 1303
spam score = 70
title = 'futabareg 9zaps parts listing discontinued'

distance = 1339
spam score = 71
title = 'futabareg 14mz radio system frequently asked questions faq'

distance = 1382
spam score = 64
title = 'futabareg 9zhps parts listing discontinued'

distance = 1490
spam score = 58
title = 'futaba 10c 24ghz fasst faq'

distance = 1515
spam score = 37
title = 'futaba 3vcs 3channel 24ghz system'

distance = 1530
spam score = 48
title = 'futaba 3pk 3channel 24ghz radio system'

distance = 1627
spam score = 68
title = 'futabareg 9chp parts listing discontinued'

distance = 1730
spam score = 91
title = 'internet concepts'

distance = 1752
spam score = 32
title = '24ghz asf system auto selected frequency archive minizracercom forums'

distance = 1785
spam score = 82
title = 'internet concepts'

distance = 503
spam score = 72
title = ''

distance = 535
spam score = 62
title = ''

distance = 570
spam score = 75
title = ''

distance = 577
spam score = 69
title = ''

distance = 615
spam score = 69
title = ''

distance = 618
spam score = 65
title = ''

distance = 627
spam score = 63
title = ''

distance = 630
spam score = 66
title = ''

distance = 646
spam score = 71
title = ''

distance = 650
spam score = 62
title = ''

distance = 650
spam score = 74
title = ''

distance = 650
spam score = 60
title = ''

distance = 672
spam score = 64
title = ''

distance = 675
spam score = 66
title = ''

distance = 676
spam score = 58
title = ''

distance = 677
spam score = 55
title = ''

distance = 679
spam score = 68
title = ''

distance = 690
spam score = 63
title = ''

distance = 692
spam score = 62
title = ''

distance = 695
spam score = 60
title = ''

distance = 703
spam score = 61
title = ''

distance = 704
spam score = 67
title = ''

distance = 706
spam score = 62
title = ''

distance = 712
spam score = 76
title = ''

distance = 722
spam score = 62
title = ''

distance = 733
spam score = 58
title = ''

distance = 735
spam score = 62
title = ''

distance = 735
spam score = 65
title = ''

distance = 741
spam score = 64
title = ''

distance = 745
spam score = 62
title = ''

distance = 746
spam score = 55
title = ''

distance = 754
spam score = 47
title = ''

distance = 757
spam score = 62
title = ''

distance = 759
spam score = 57
title = ''

distance = 764
spam score = 61
title = ''

distance = 774
spam score = 62
title = ''

distance = 784
spam score = 53
title = ''

distance = 788
spam score = 69
title = ''

distance = 794
spam score = 63
title = ''

distance = 794
spam score = 55
title = ''

distance = 797
spam score = 68
title = ''

distance = 800
spam score = 60
title = ''

distance = 803
spam score = 59
title = ''

distance = 805
spam score = 46
title = ''

distance = 806
spam score = 59
title = ''

distance = 810
spam score = 73
title = ''

distance = 818
spam score = 74
title = ''

distance = 820
spam score = 72
title = ''

distance = 822
spam score = 53
title = ''

distance = 826
spam score = 54
title = ''

distance = 827
spam score = 56
title = ''

distance = 839
spam score = 58
title = ''

distance = 845
spam score = 57
title = ''

distance = 854
spam score = 76
title = ''

distance = 854
spam score = 56
title = ''

distance = 874
spam score = 71
title = ''

distance = 875
spam score = 64
title = ''

distance = 883
spam score = 58
title = ''

distance = 903
spam score = 52
title = ''

distance = 918
spam score = 60
title = ''

distance = 919
spam score = 57
title = ''

distance = 929
spam score = 58
title = ''

distance = 936
spam score = 53
title = ''

distance = 940
spam score = 59
title = ''

distance = 945
spam score = 59
title = ''

distance = 950
spam score = 54
title = ''

distance = 951
spam score = 58
title = ''

distance = 971
spam score = 58
title = ''

distance = 973
spam score = 57
title = ''

distance = 981
spam score = 51
title = ''

distance = 983
spam score = 55
title = ''

distance = 984
spam score = 58
title = ''

distance = 1005
spam score = 57
title = ''

distance = 1005
spam score = 52
title = ''

distance = 1008
spam score = 56
title = ''

distance = 1010
spam score = 57
title = ''

distance = 1012
spam score = 56
title = ''

distance = 1048
spam score = 51
title = ''

distance = 1049
spam score = 58
title = ''

distance = 1051
spam score = 45
title = ''

distance = 1059
spam score = 56
title = ''

distance = 1066
spam score = 45
title = ''

distance = 1067
spam score = 57
title = ''

distance = 1084
spam score = 52
title = ''

distance = 1087
spam score = 58
title = ''

distance = 1091
spam score = 56
title = ''

distance = 1100
spam score = 58
title = ''

distance = 1112
spam score = 56
title = ''

distance = 1129
spam score = 52
title = ''

distance = 1132
spam score = 50
title = ''

distance = 1621
spam score = 77
title = ''

distance = 1642
spam score = 82
title = ''

distance = 704
spam score = 41
title = ''

distance = 763
spam score = 54
title = ''

distance = 778
spam score = 59
title = ''

distance = 860
spam score = 58
title = ''

distance = 937
spam score = 32
title = ''

distance = 949
spam score = 58
title = ''

distance = 951
spam score = 29
title = ''

distance = 1035
spam score = 57
title = ''

distance = 468
spam score = 60
title = ''

distance = 569
spam score = 86
title = ''

distance = 579
spam score = 78
title = ''

distance = 603
spam score = 83
title = ''

distance = 698
spam score = 77
title = ''

distance = 734
spam score = 77
title = ''

distance = 793
spam score = 83
title = ''

distance = 856
spam score = 73
title = ''

distance = 870
spam score = 84
title = ''

distance = 880
spam score = 71
title = ''

distance = 934
spam score = 82
title = ''

distance = 999
spam score = 80
title = ''

distance = 1004
spam score = 80
title = ''

distance = 1134
spam score = 84
title = ''

distance = 1208
spam score = 79
title = ''

distance = 1285
spam score = 82
title = ''

distance = 11
spam score = 78
title = ''

distance = 11
spam score = 80
title = ''

distance = 11
spam score = 78
title = ''

distance = 11
spam score = 79
title = ''

distance = 11
spam score = 79
title = ''

distance = 11
spam score = 79
title = ''

distance = 11
spam score = 77
title = ''

distance = 11
spam score = 77
title = ''

distance = 11
spam score = 78
title = ''

distance = 11
spam score = 78
title = ''

distance = 11
spam score = 78
title = ''

distance = 11
spam score = 78
title = ''

distance = 11
spam score = 77
title = ''

distance = 11
spam score = 79
title = ''

distance = 11
spam score = 79
title = ''

distance = 11
spam score = 79
title = ''

distance = 11
spam score = 79
title = ''

distance = 11
spam score = 79
title = ''

distance = 11
spam score = 80
title = ''

distance = 11
spam score = 79
title = ''

distance = 33
spam score = 78
title = ''

distance = 39
spam score = 81
title = ''

distance = 40
spam score = 78
title = ''

distance = 40
spam score = 77
title = ''

distance = 42
spam score = 75
title = ''

distance = 42
spam score = 80
title = ''

distance = 43
spam score = 74
title = ''

distance = 44
spam score = 76
title = ''

distance = 44
spam score = 79
title = ''

distance = 50
spam score = 79
title = ''

distance = 64
spam score = 77
title = ''

distance = 64
spam score = 76
title = ''

distance = 64
spam score = 77
title = ''

distance = 64
spam score = 77
title = ''

distance = 65
spam score = 76
title = ''

distance = 67
spam score = 83
title = ''

distance = 75
spam score = 77
title = ''

distance = 75
spam score = 82
title = ''

distance = 77
spam score = 76
title = ''

distance = 78
spam score = 84
title = ''

distance = 462
spam score = 83
title = 'pr qa trg byeye references'

distance = 514
spam score = 94
title = 'bbrcreatebuildarea'

distance = 517
spam score = 92
title = 'qa issues'

distance = 556
spam score = 86
title = 'configuration database examples'

distance = 570
spam score = 93
title = 'monte carlo production page'

distance = 570
spam score = 92
title = 'next gui meeting'

distance = 573
spam score = 85
title = ''

distance = 577
spam score = 85
title = 'gnumakefiles and gmake'

distance = 585
spam score = 80
title = 'monte carlo production page'

distance = 597
spam score = 88
title = 'ral workshop photo dscn3494'

distance = 782
spam score = 94
title = 'faq answerpage'

distance = 787
spam score = 88
title = 'babar operation pr summary'

distance = 795
spam score = 96
title = 'data distribution'

distance = 800
spam score = 94
title = 'faq answerpage'

distance = 803
spam score = 90
title = 'data distribution'

distance = 803
spam score = 92
title = 'babargrid sites'

distance = 804
spam score = 94
title = 'babar widearea network monitoring page'

distance = 814
spam score = 86
title = 'babar computing access'

distance = 836
spam score = 92
title = 'how to get started using in2p3 computing resources'

distance = 838
spam score = 76
title = 'sp6 kiloevents per week'

distance = 946
spam score = 84
title = 'promptreco qa byeye references temporary'

distance = 950
spam score = 95
title = 'team'

distance = 956
spam score = 94
title = 'faq answerpage'

distance = 956
spam score = 94
title = 'bookeeping home page'

distance = 968
spam score = 87
title = ''

distance = 976
spam score = 90
title = 'faq answerpage'

distance = 977
spam score = 95
title = 'faq answerpage'

distance = 987
spam score = 95
title = 'bibliography'

distance = 992
spam score = 88
title = 'bookeeping home page'

distance = 994
spam score = 88
title = 'detector controls status and severity flags'

distance = 1099
spam score = 90
title = 'gui contacts page'

distance = 1112
spam score = 93
title = 'babar online farm page'

distance = 1115
spam score = 94
title = 'communications tools'

distance = 1115
spam score = 89
title = 'qadfinder appmodule'

distance = 1132
spam score = 93
title = 'qasim home page'

distance = 1150
spam score = 91
title = ''

distance = 1150
spam score = 83
title = 'kanclassi'

distance = 1151
spam score = 88
title = 'qarhopi appmodule'

distance = 1166
spam score = 95
title = 'registering with the babar grid'

distance = 1175
spam score = 92
title = 'babar slac unix account info'

distance = 1289
spam score = 94
title = 'data import and bookkeeping at remote sites'

distance = 1306
spam score = 93
title = 'putting your changes back into the main repository'

distance = 1307
spam score = 95
title = 'faq answerpage'

distance = 1312
spam score = 90
title = 'alias trees'

distance = 1321
spam score = 95
title = 'kanga home page'

distance = 1327
spam score = 96
title = 'kanga home page'

distance = 1328
spam score = 92
title = 'kanga home page'

distance = 1338
spam score = 67
title = 'r22e skimmed datasets v10 release'

distance = 1338
spam score = 90
title = 'simulation data'

distance = 1350
spam score = 91
title = 'introduction'

distance = 1428
spam score = 80
title = 'r18c reskimmed datasets'

distance = 1440
spam score = 84
title = 'r24a3 skimmed datasets v01 release'

distance = 1462
spam score = 81
title = 'r24a3 skimmed datasets v02 release'

distance = 1467
spam score = 97
title = 'pepiib a b a r database'

distance = 1475
spam score = 98
title = 'babar online databases'

distance = 1478
spam score = 84
title = 'ifrabs3dcompk'

distance = 1480
spam score = 98
title = 'babar online databases'

distance = 1484
spam score = 84
title = 'babar simulation in computing'

distance = 1485
spam score = 86
title = 'babar simulation in computing'

distance = 1493
spam score = 82
title = 'r18c skimmed datasets v07 release'

distance = 21
spam score = 66
title = ''

distance = 24
spam score = 67
title = ''

distance = 1539
spam score = 58
title = ''

distance = 368
spam score = 91
title = 'climate statistics for australian locations'

distance = 380
spam score = 90
title = 'climate statistics for australian locations'

distance = 382
spam score = 89
title = 'climate statistics for australian locations'

distance = 382
spam score = 92
title = 'climate statistics for australian locations'

distance = 383
spam score = 92
title = 'climate statistics for australian locations'

distance = 383
spam score = 91
title = 'climate statistics for australian locations'

distance = 384
spam score = 94
title = 'climate statistics for australian locations'

distance = 385
spam score = 90
title = 'climate statistics for australian locations'

distance = 385
spam score = 92
title = 'climate statistics for australian locations'

distance = 385
spam score = 94
title = 'climate statistics for australian locations'

distance = 388
spam score = 90
title = 'climate statistics for australian locations'

distance = 388
spam score = 91
title = 'climate statistics for australian locations'

distance = 389
spam score = 90
title = 'climate statistics for australian locations'

distance = 390
spam score = 91
title = 'climate statistics for australian locations'

distance = 390
spam score = 89
title = 'climate statistics for australian locations'

distance = 391
spam score = 92
title = 'climate statistics for australian locations'

distance = 391
spam score = 94
title = 'climate statistics for australian locations'

distance = 391
spam score = 92
title = 'climate statistics for australian locations'

distance = 392
spam score = 93
title = 'climate statistics for australian locations'

distance = 393
spam score = 88
title = 'climate statistics for australian locations'

distance = 420
spam score = 94
title = 'climate statistics for australian locations'

distance = 420
spam score = 93
title = 'climate statistics for australian locations'

distance = 420
spam score = 88
title = 'climate statistics for australian locations'

distance = 421
spam score = 90
title = 'climate statistics for australian locations'

distance = 421
spam score = 91
title = 'climate statistics for australian locations'

distance = 421
spam score = 91
title = 'climate statistics for australian locations'

distance = 422
spam score = 90
title = 'climate statistics for australian locations'

distance = 422
spam score = 93
title = 'climate statistics for australian locations'

distance = 422
spam score = 91
title = 'climate statistics for australian locations'

distance = 422
spam score = 92
title = 'climate statistics for australian locations'

distance = 431
spam score = 90
title = 'climate statistics for australian locations'

distance = 431
spam score = 94
title = 'climate statistics for australian locations'

distance = 431
spam score = 91
title = 'climate statistics for australian locations'

distance = 432
spam score = 90
title = 'climate statistics for australian locations'

distance = 432
spam score = 92
title = 'climate statistics for australian locations'

distance = 432
spam score = 93
title = 'climate statistics for australian locations'

distance = 432
spam score = 93
title = 'climate statistics for australian locations'

distance = 432
spam score = 95
title = 'climate statistics for australian locations'

distance = 432
spam score = 94
title = 'climate statistics for australian locations'

distance = 432
spam score = 91
title = 'climate statistics for australian locations'

distance = 445
spam score = 89
title = 'climate statistics for australian locations'

distance = 445
spam score = 95
title = 'climate statistics for australian locations'

distance = 445
spam score = 92
title = 'climate statistics for australian locations'

distance = 445
spam score = 92
title = 'climate statistics for australian locations'

distance = 445
spam score = 89
title = 'climate statistics for australian locations'

distance = 445
spam score = 89
title = 'climate statistics for australian locations'

distance = 446
spam score = 91
title = 'climate statistics for australian locations'

distance = 446
spam score = 93
title = 'climate statistics for australian locations'

distance = 446
spam score = 92
title = 'climate statistics for australian locations'

distance = 446
spam score = 93
title = 'climate statistics for australian locations'

distance = 528
spam score = 86
title = 'bureau of meteorology site location map'

distance = 528
spam score = 85
title = 'bureau of meteorology site location map'

distance = 528
spam score = 85
title = 'bureau of meteorology site location map'

distance = 528
spam score = 84
title = 'bureau of meteorology site location map'

distance = 529
spam score = 86
title = 'bureau of meteorology site location map'

distance = 529
spam score = 86
title = 'bureau of meteorology site location map'

distance = 529
spam score = 84
title = 'bureau of meteorology site location map'

distance = 530
spam score = 85
title = 'bureau of meteorology site location map'

distance = 530
spam score = 84
title = 'bureau of meteorology site location map'

distance = 530
spam score = 85
title = 'bureau of meteorology site location map'

distance = 549
spam score = 85
title = 'bureau of meteorology site location map'

distance = 549
spam score = 86
title = 'bureau of meteorology site location map'

distance = 550
spam score = 85
title = 'bureau of meteorology site location map'

distance = 550
spam score = 87
title = 'bureau of meteorology site location map'

distance = 550
spam score = 90
title = 'bureau of meteorology site location map'

distance = 552
spam score = 84
title = 'bureau of meteorology site location map'

distance = 552
spam score = 86
title = 'bureau of meteorology site location map'

distance = 556
spam score = 86
title = 'bureau of meteorology site location map'

distance = 559
spam score = 84
title = 'bureau of meteorology site location map'

distance = 566
spam score = 91
title = 'bureau of meteorology site location map'

distance = 1185
spam score = 70
title = 'hamilton island qld daily weather observations'

distance = 1186
spam score = 86
title = 'cbom mount isa area climate and history'

distance = 1187
spam score = 64
title = 'ceduna sa daily weather observations'

distance = 1187
spam score = 65
title = 'bickley wa daily weather observations'

distance = 1188
spam score = 67
title = 'coen qld daily weather observations'

distance = 1189
spam score = 87
title = 'cbom ceduna area climate and history'

distance = 1189
spam score = 70
title = 'strathalbyn sa daily weather observations'

distance = 1190
spam score = 72
title = 'mawson ant daily weather observations'

distance = 1190
spam score = 73
title = 'bowen qld daily weather observations'

distance = 1192
spam score = 69
title = 'cooktown qld daily weather observations'

distance = 1280
spam score = 98
title = 'bom northern territory flood warning centre'

distance = 1281
spam score = 56
title = 'bendigo vic daily weather observations'

distance = 1284
spam score = 97
title = 'storm confirmation overview'

distance = 1285
spam score = 65
title = 'ouse tas daily weather observations'

distance = 1286
spam score = 58
title = 'richmond airport qld daily weather observations'

distance = 1287
spam score = 69
title = 'cabramurra nsw daily weather observations'

distance = 1288
spam score = 78
title = 'bendigo vic daily weather observations'

distance = 1288
spam score = 91
title = 'bom oceanographic services'

distance = 1288
spam score = 61
title = 'strathgordon tas daily weather observations'

distance = 1288
spam score = 67
title = 'goulburn nsw daily weather observations'

distance = 1400
spam score = 51
title = 'gold coast qld january 2009 daily weather observations'

distance = 1402
spam score = 51
title = 'renmark sa november 2008 daily weather observations'

distance = 1402
spam score = 83
title = 'radar image sequence of severe thunderstorms that affected melbourne overnight 23 december 2003'

distance = 1403
spam score = 98
title = 'ifd requests'

distance = 1403
spam score = 93
title = 'ifd requests'

distance = 1403
spam score = 91
title = 'bomws5'

distance = 1403
spam score = 60
title = 'renmark sa february 2008 daily weather observations'

distance = 1403
spam score = 42
title = 'bendigo vic january 2009 daily weather observations'

distance = 1404
spam score = 45
title = 'wangaratta vic january 2009 daily weather observations'

distance = 1404
spam score = 75
title = 'radar image sequence of severe thunderstorms that affected melbourne overnight 23 december 2003'

distance = 1739
spam score = 74
title = 'crumridleychester volunteer water monitors data for ridley creek rocky run r320'

distance = 839
spam score = 84
title = ''

distance = 839
spam score = 84
title = ''

distance = 839
spam score = 84
title = ''

distance = 839
spam score = 84
title = ''

distance = 839
spam score = 84
title = ''

distance = 839
spam score = 84
title = ''

distance = 839
spam score = 84
title = ''

distance = 843
spam score = 84
title = ''

distance = 843
spam score = 84
title = ''

distance = 843
spam score = 88
title = ''

distance = 843
spam score = 87
title = ''

distance = 843
spam score = 87
title = ''

distance = 843
spam score = 88
title = ''

distance = 843
spam score = 85
title = ''

distance = 843
spam score = 87
title = ''

distance = 843
spam score = 85
title = ''

distance = 843
spam score = 85
title = ''

distance = 843
spam score = 85
title = ''

distance = 843
spam score = 84
title = ''

distance = 846
spam score = 86
title = ''

distance = 846
spam score = 88
title = ''

distance = 846
spam score = 88
title = ''

distance = 846
spam score = 81
title = ''

distance = 846
spam score = 86
title = ''

distance = 846
spam score = 85
title = ''

distance = 846
spam score = 85
title = ''

distance = 846
spam score = 86
title = ''

distance = 846
spam score = 85
title = ''

distance = 846
spam score = 85
title = ''

distance = 846
spam score = 85
title = ''

distance = 846
spam score = 86
title = ''

distance = 848
spam score = 84
title = ''

distance = 851
spam score = 88
title = ''

distance = 851
spam score = 87
title = ''

distance = 851
spam score = 88
title = ''

distance = 851
spam score = 88
title = ''

distance = 851
spam score = 88
title = ''

distance = 851
spam score = 87
title = ''

distance = 851
spam score = 88
title = ''

distance = 851
spam score = 88
title = ''

distance = 851
spam score = 84
title = ''

distance = 851
spam score = 88
title = ''

distance = 851
spam score = 84
title = ''

distance = 851
spam score = 87
title = ''

distance = 851
spam score = 88
title = ''

distance = 851
spam score = 88
title = ''

distance = 851
spam score = 87
title = ''

distance = 851
spam score = 87
title = ''

distance = 851
spam score = 87
title = ''

distance = 851
spam score = 87
title = ''

distance = 851
spam score = 86
title = ''

distance = 851
spam score = 88
title = ''

distance = 923
spam score = 63
title = ''

distance = 924
spam score = 51
title = ''

distance = 1439
spam score = 62
title = ''

distance = 1836
spam score = 23
title = ''

distance = 548
spam score = 64
title = 'st louis fed series gs30 30year treasury constant maturity rate'

distance = 562
spam score = 50
title = 'st louis fed series gs10 10year treasury constant maturity rate'

distance = 563
spam score = 46
title = 'st louis fed series rsbkcrns reserve bank credit'

distance = 563
spam score = 36
title = 'st louis fed series gs7 7year treasury constant maturity rate'

distance = 564
spam score = 40
title = 'st louis fed series wtp10j11 10year 312 treasury inflationindexed note due 1152011'

distance = 564
spam score = 36
title = 'st louis fed series wtp10j12 10year 338 treasury inflationindexed note due 1152012'

distance = 564
spam score = 45
title = 'st louis fed series wtp10l13 10year 178 treasury inflationindexed note due 7152013'

distance = 565
spam score = 61
title = 'st louis fed series dgs30 30year treasury constant maturity rate'

distance = 567
spam score = 45
title = 'st louis fed series wtp10j18 10year 158 treasury inflationindexed note due 1152018'

distance = 568
spam score = 48
title = 'st louis fed series gs3 3year treasury constant maturity rate'

distance = 569
spam score = 36
title = 'st louis fed series wtp10l12 10year 3 treasury inflationindexed note due 7152012'

distance = 570
spam score = 36
title = 'st louis fed series tb1yr 1year treasury bill secondary market rate'

distance = 570
spam score = 49
title = 'st louis fed series wtp5a10 5year treasury inflationindexed note due 4152010'

distance = 570
spam score = 48
title = 'st louis fed series wtp10j14 10year 2 treasury inflationindexed note due 1152014'

distance = 570
spam score = 36
title = 'st louis fed series wtp10j15 10year 158 treasury inflationindexed note due 1152015'

distance = 571
spam score = 29
title = 'st louis fed series wtp10l14 10year 2 treasury inflationindexed note due 7152014'

distance = 571
spam score = 39
title = 'st louis fed series wtp10j17 10year 238 treasury inflationindexed note due 1152017'

distance = 572
spam score = 43
title = 'st louis fed series wtp5a11 5year treasury inflationindexed note due 4152011'

distance = 572
spam score = 30
title = 'st louis fed series tp10l15 10year 178 treasury inflationindexed note due 7152015'

distance = 573
spam score = 32
title = 'st louis fed series wtp10l18 10year 138 treasury inflationindexed note due 7152018'

distance = 622
spam score = 58
title = 'st louis fed series wgs20yr 20year treasury constant maturity rate'

distance = 622
spam score = 58
title = 'st louis fed series wgs3yr 3year treasury constant maturity rate'

distance = 630
spam score = 42
title = 'st louis fed series invest total investments at all commercial banks'

distance = 633
spam score = 41
title = 'st louis fed series tp3ha32 3012year 338 treasury inflationindexed bond due 4152032'

distance = 636
spam score = 29
title = 'st louis fed series tp10l17 10year 258 treasury inflationindexed note due 7152017'

distance = 638
spam score = 37
title = 'st louis fed series indpro industrial production index'

distance = 638
spam score = 36
title = 'st louis fed series indpro industrial production index'

distance = 638
spam score = 36
title = 'st louis fed series indpro industrial production index'

distance = 640
spam score = 58
title = 'st louis fed series indpro industrial production index'

distance = 640
spam score = 55
title = 'st louis fed series indpro industrial production index'

distance = 667
spam score = 51
title = 'st louis fed series wcd1m 1month certificate of deposit secondary market rate'

distance = 668
spam score = 36
title = 'st louis fed series wgs1mo 1month treasury constant maturity rate'

distance = 668
spam score = 50
title = 'st louis fed series wcd6m 6month certificate of deposit secondary market rate'

distance = 668
spam score = 38
title = 'st louis fed series dtp10j17 10year 238 treasury inflationindexed note due 1152017'

distance = 668
spam score = 42
title = 'st louis fed series dtp10l14 10year 2 treasury inflationindexed note due 7152014'

distance = 669
spam score = 39
title = 'st louis fed series loans total loans and leases at commercial banks'

distance = 669
spam score = 53
title = 'st louis fed series wm2ns m2 money stock'

distance = 670
spam score = 50
title = 'st louis fed series dtp10j10 10year 414 inflationindexed note due 1152010'

distance = 670
spam score = 44
title = 'st louis fed series wm2ns m2 money stock'

distance = 671
spam score = 30
title = 'st louis fed series tp10j09 10year 378 treasury inflationindexed note due 1152009 discontinued series'

distance = 679
spam score = 45
title = 'st louis fed series dtp10j16 10year 2 treasury inflationindexed note due 1152016'

distance = 679
spam score = 57
title = 'st louis fed series dcd1m 1month certificate of deposit secondary market rate'

distance = 680
spam score = 30
title = 'st louis fed series m1 m1 money stock'

distance = 680
spam score = 41
title = 'st louis fed series dcpf2m 2month aa financial commercial paper rate'

distance = 681
spam score = 42
title = 'st louis fed series dcpf1m 1month aa financial commercial paper rate'

distance = 681
spam score = 42
title = 'st louis fed series fii5 5year treasury inflationindexed security constant maturity'

distance = 683
spam score = 45
title = 'st louis fed series dtp5a10 5year treasury inflationindexed note due 4152010'

distance = 683
spam score = 31
title = 'st louis fed series imfsl institutional money funds'

distance = 684
spam score = 39
title = 'st louis fed series fii20 20year treasury inflationindexed security constant maturity'

distance = 685
spam score = 28
title = 'st louis fed series mzm mzm money stock'

distance = 708
spam score = 28
title = 'st louis fed series dtp10j18 10year 158 treasury inflationindexed note due 1152018'

distance = 708
spam score = 59
title = 'st louis fed series dfii5 5year treasury inflationindexed security constant maturity'

distance = 711
spam score = 49
title = 'st louis fed series dcpn3m 3month aa nonfinancial commercial paper rate'

distance = 712
spam score = 44
title = 'st louis fed series tcu capacity utilization total industry'

distance = 712
spam score = 48
title = 'st louis fed series tcu capacity utilization total industry'

distance = 715
spam score = 48
title = 'st louis fed series dfii20 20year treasury inflationindexed security constant maturity'

distance = 715
spam score = 39
title = 'st louis fed series wfii10 10year treasury inflationindexed security constant maturity'

distance = 716
spam score = 53
title = 'st louis fed series tcu capacity utilization total industry'

distance = 718
spam score = 51
title = 'st louis fed series exjpus japan us foreign exchange rate'

distance = 720
spam score = 33
title = 'st louis fed series wpcredit primary credit rate'

distance = 765
spam score = 44
title = 'st louis fed series adjressl st louis adjusted reserves'

distance = 765
spam score = 52
title = 'st louis fed series base st louis adjusted monetary base'

distance = 768
spam score = 35
title = 'st louis fed series adjres st louis adjusted reserves'

distance = 768
spam score = 35
title = 'st louis fed series adjres st louis adjusted reserves'

distance = 775
spam score = 54
title = 'st louis fed series wcd3m 3month certificate of deposit secondary market rate'

distance = 786
spam score = 53
title = 'st louis fed series wcpn1m 1month aa nonfinancial commercial paper rate'

distance = 792
spam score = 39
title = 'st louis fed series psavert personal saving rate'

distance = 794
spam score = 34
title = 'st louis fed series savings total savings deposits at all depository institutions'

distance = 799
spam score = 36
title = 'st louis fed series psavert personal saving rate'

distance = 806
spam score = 52
title = 'st louis fed series ambsl st louis adjusted monetary base'

distance = 850
spam score = 31
title = 'st louis fed series nonbortaf nonborrowed reserves of depository institutions plus term auction credit'

distance = 853
spam score = 34
title = 'st louis fed series wmaiden3 net portfolio holdings of maiden lane iii llc'

distance = 864
spam score = 31
title = 'st louis fed series bopsimp imports of services balance of payments basis'

distance = 864
spam score = 33
title = 'st louis fed series wtermfac securities lent to dealers term facility'

distance = 867
spam score = 34
title = 'st louis fed series fgrecpt federal government current receipts'

distance = 869
spam score = 37
title = 'st louis fed series wm3ns m3 money stock discontinued series'

distance = 874
spam score = 33
title = 'st louis fed series wm3ns m3 money stock discontinued series'

distance = 877
spam score = 34
title = 'st louis fed series wm3ns m3 money stock discontinued series'

distance = 878
spam score = 25
title = 'st louis fed series fdhbpi federal debt held by private investors discontinued series'

distance = 880
spam score = 33
title = 'st louis fed series wm3ns m3 money stock discontinued series'

distance = 1037
spam score = 35
title = 'st louis fed interest rates treasury inflationindexed securities download data'

distance = 1067
spam score = 32
title = 'st louis fed series manemp employees on nonfarm payrolls manufacturing'

distance = 1077
spam score = 69
title = 'st louis fed research division help'

distance = 1078
spam score = 77
title = 'st louis fed research division help'

distance = 1088
spam score = 82
title = 'alfred archival federal reserve economic data'

distance = 1092
spam score = 54
title = 'st louis fed wp 1999014a effects of federal reserve services on the efficiency of the system for collecting checks in the united states 191530'

distance = 1137
spam score = 41
title = 'st louis fed exchange rates daily rates download data'

distance = 1143
spam score = 54
title = 'st louis fed economic research register user account step 1 of 3'

distance = 1146
spam score = 74
title = 'st louis fed economic research register user account step 1 of 3'

distance = 1151
spam score = 74
title = 'st louis fed economic research register user account step 1 of 3'

distance = 1316
spam score = 48
title = 'st louis fed wp 2008043a the stability of macroeconomic systems with bayesian learners'

distance = 1320
spam score = 24
title = 'christopher j neely monetary policy and the federal reserve system'

distance = 1325
spam score = 39
title = 'st louis fed wp 2005012a home bias and high turnover in an overlapping generations model with learning'

distance = 1341
spam score = 44
title = 'st louis fed wp 2007028a do donors care about declining trade revenues from liberalization an analysis of aid allocation'

distance = 1355
spam score = 41
title = 'st louis fed wp 1996010c to chain or not to chain tradeweighted exchange rate indexes'

distance = 1355
spam score = 53
title = 'st louis fed wp 1991005b which banks choose deposit insurance evidence of adverse selection and moral hazard in a voluntary insurance'

distance = 1360
spam score = 50
title = 'liber8 ies database monthly retail price index by category'

distance = 1362
spam score = 35
title = 'st louis fed wp 2004032b the importance of nonlinearity in reproducing business cycle features'

distance = 1363
spam score = 40
title = 'st louis fed wp 2004032b the importance of nonlinearity in reproducing business cycle features'

distance = 1365
spam score = 40
title = 'federal reserve bank bulletin boards'

distance = 1566
spam score = 61
title = 'liber8 ies database national system of costs survey and indexes of construction'

distance = 1626
spam score = 64
title = 'regional economist past issues 2004 st louis fed'

distance = 1628
spam score = 55
title = 'regional economist past issues 2004 st louis fed'

distance = 1631
spam score = 72
title = 'retail investor org financial and economic historical data series for canada and us'

distance = 1648
spam score = 50
title = 'regional economist past issues 2005 st louis fed'

distance = 1660
spam score = 65
title = 'regional economist past issues 2005 st louis fed'

distance = 1758
spam score = 20
title = 'netvouz fred bookmarks'

distance = 892
spam score = 72
title = ''

distance = 587
spam score = 35
title = 'going assistance used machine offer'

distance = 628
spam score = 37
title = 'regeneration container used machine offer'

distance = 631
spam score = 38
title = 'tightener somatec used machine offer'

distance = 635
spam score = 33
title = 'tischumreifungsmaschine used machine offer'

distance = 662
spam score = 33
title = 'used machine offer'

distance = 671
spam score = 41
title = 'wood gripper used machine offer'

distance = 674
spam score = 43
title = 'fendt cutter bar used machine offer'

distance = 677
spam score = 43
title = 'screen printing machine serimat used machine offer'

distance = 682
spam score = 38
title = 'saugpolierer polyvac sl 1600 used machine offer'

distance = 684
spam score = 37
title = 'splinter crusher lanner s 65 g used machine offer'

distance = 686
spam score = 35
title = 'mobilabsaugung used machine offer'

distance = 688
spam score = 36
title = 'hard rock test used machine offer'

distance = 695
spam score = 40
title = 'a disk buffing machine powrflite p1600 used machine offer'

distance = 703
spam score = 39
title = 'drill test used machine offer'

distance = 706
spam score = 36
title = 'hydraulic unit used machine offer'

distance = 711
spam score = 38
title = 'hydraulic unit 663811so used machine offer'

distance = 714
spam score = 41
title = 'paver demag df 45 c used machine offer'

distance = 714
spam score = 41
title = 'yard used machine offer'

distance = 715
spam score = 41
title = 'infusion pump b braun used machine offer'

distance = 716
spam score = 43
title = 'dozer caterpillar d 6 m lgp used machine offer'

distance = 784
spam score = 32
title = 'nummerierwerk paul leibinger used machine offer'

distance = 788
spam score = 40
title = 'test ad saw mill furniture used machine offer'

distance = 790
spam score = 39
title = 'refrigerator for beer cold box used machine offer'

distance = 790
spam score = 38
title = 'desinfektionsmitteldosierger ecolab dg1 1024 used machine offer'

distance = 791
spam score = 40
title = 'role train used machine offer'

distance = 793
spam score = 36
title = 'heidelberg a4 punching crucible used machine offer'

distance = 794
spam score = 31
title = 'plotter hp designjet 450c used machine offer'

distance = 795
spam score = 41
title = 'dozer caterpillar d 6 r lgp used machine offer'

distance = 795
spam score = 36
title = 'heidelberg a4 punching crucible used machine offer'

distance = 796
spam score = 37
title = 'system container alho used machine offer'

distance = 825
spam score = 39
title = 'spelsberg ap 7 used machine offer'

distance = 827
spam score = 41
title = 'lamellofraeselamellonutfraesmaschine used machine offer'

distance = 829
spam score = 41
title = 'in addition air conditioning system autoclima rio 10 used machine offer'

distance = 829
spam score = 32
title = 'concrete bomb format f 275 used machine offer'

distance = 830
spam score = 38
title = 'tape library tape library robot band infinistore l8 used machine offer'

distance = 832
spam score = 45
title = 'switchgear cabinet striebelampjohn kg 38w used machine offer'

distance = 832
spam score = 37
title = 'crane potain igo 32 new machine offer'

distance = 833
spam score = 41
title = 'bundles machine mueller amp engels bms 620 used machine offer'

distance = 835
spam score = 31
title = 'cross with separating and kegelrollengang used machine offer'

distance = 835
spam score = 41
title = '3d messarm faro platinum used machine offer'

distance = 855
spam score = 27
title = 'robot cells label printer topex top 3054 used machine offer'

distance = 855
spam score = 36
title = 'schockfroster foster bc 50 used machine offer'

distance = 856
spam score = 33
title = 'spare fuel plant used machine offer'

distance = 856
spam score = 41
title = 'aluminum shifting race new machine offer'

distance = 860
spam score = 32
title = 'chicken crates with stacker plasson used machine offer'

distance = 860
spam score = 39
title = '2 component mixer testroe tm k2h3000 hl used machine offer'

distance = 861
spam score = 35
title = 'baukompressor kaeser m 24 used machine offer'

distance = 861
spam score = 26
title = 'misting system rauch hd 80 new machine offer'

distance = 862
spam score = 37
title = 'core drill core diamond drill hilti used machine offer'

distance = 862
spam score = 38
title = '2 stckputzmaschinen pft g4 used machine offer'

distance = 876
spam score = 38
title = 'podium bridge machines bridge transition treppengest used machine offer'

distance = 877
spam score = 36
title = 'labeling krones topmatic k071575 used machine offer'

distance = 877
spam score = 39
title = 'kranhubwerk demag 2to demag used machine offer'

distance = 878
spam score = 31
title = 'computercontrolled engraving machine eigenbau new machine offer'

distance = 879
spam score = 33
title = 'water jet cutting machine used machine offer'

distance = 880
spam score = 37
title = 'pump grundfos cp 3040 used machine offer'

distance = 882
spam score = 37
title = 'demag sc20 ds demag sc20ds2 used machine offer'

distance = 882
spam score = 43
title = 'street pavers demag df 45 c used machine offer'

distance = 883
spam score = 38
title = 'pw meckenbeuren used machine offer'

distance = 884
spam score = 33
title = 'bestuecker universal gsm1 used machine offer'

distance = 908
spam score = 41
title = '2 stk used asphalfertiger demag df100c used machine offer'

distance = 909
spam score = 36
title = 'industrial sewing machines pfaff quick digital used machine offer'

distance = 910
spam score = 38
title = 'sentence crane untendreher construction crane comansa ht24 used machine offer'

distance = 910
spam score = 42
title = 'deepfreeze used machine offer'

distance = 911
spam score = 31
title = 'kawasaki gas turbine system ka 1334 dg ka 1334 dg used machine offer'

distance = 911
spam score = 40
title = 'sawing gap machine bgu ssm 250 z new machine offer'

distance = 915
spam score = 44
title = 'schwenk mill khd humboldt palla vmkt new machine offer'

distance = 916
spam score = 44
title = 'controls plates spare parts etc siemens indramat ipc 6es used machine offer'

distance = 916
spam score = 31
title = 'air hammer beche l5 used machine offer'

distance = 916
spam score = 33
title = 'funierzusammensetzmaschine kuper fwj 900 used machine offer'

distance = 947
spam score = 38
title = 'accumulation conveyor buhrs affeldt avn tt 564 new machine offer'

distance = 947
spam score = 30
title = 'hook container plank bed with load onboard wall unbekannt used machine offer'

distance = 949
spam score = 45
title = 'electric motor 45 hp 2960 rpm b3 b5 siemens erlangen new machine offer'

distance = 950
spam score = 44
title = 'plotters hewlett packard hpgl2 language used machine offer'

distance = 951
spam score = 44
title = 'milling machine unbekannt used machine offer'

distance = 952
spam score = 32
title = 'kuka robots kuka vk 120 n 26b used machine offer'

distance = 953
spam score = 33
title = 'trailingkabel hp designjet 500800 din a0 new machine offer'

distance = 954
spam score = 39
title = 'mobile engine compressor mannesmann demag sc 30 ds 1 used machine offer'

distance = 955
spam score = 34
title = 'elbow offset heidelberg sm 102vp used machine offer'

distance = 956
spam score = 31
title = 'vakuumtrockner isve es 2 used machine offer'

distance = 985
spam score = 33
title = 'vzv jungheinrich ejc 125 used machine offer'

distance = 995
spam score = 41
title = 'electronics parts bosch labod used machine offer'

distance = 995
spam score = 33
title = 'sawing gap automat hakki pilke 1x37 new machine offer'

distance = 995
spam score = 28
title = 'vzv kommissionierer jungheinrich ejp 10 used machine offer'

distance = 995
spam score = 35
title = 'respirator siemens ventilator 710 used machine offer'

distance = 995
spam score = 37
title = 'multifunktionscutter cutter humantec mfc270300cv used machine offer'

distance = 996
spam score = 39
title = 'stator d63 deutscher hersteller und rotor new machine offer'

distance = 996
spam score = 37
title = 'prozessorgestet charger for trucks gfs economic charger bae lader 80volt 120 a new machine offer'

distance = 996
spam score = 40
title = 'document shredders infeed with volume eba praezision ta 4500 f used machine offer'

distance = 997
spam score = 37
title = 'drainage spoon hydraulic atlas 12041604 used machine offer'

distance = 1040
spam score = 36
title = 'dry piovan s 33 used machine offer'

distance = 1041
spam score = 43
title = 'electric forklift truck hyster xl25 used machine offer'

distance = 1053
spam score = 35
title = 'stretch rewinding stand with hufeisenfoermigem rotation plate s 140 tpplus used machine offer'

distance = 1054
spam score = 44
title = 'powder coating plant firma meeh used machine offer'

distance = 1059
spam score = 37
title = 'aggregate dwm copeland used machine offer'

distance = 1060
spam score = 38
title = 'to direct current motor gear motor siemens alpha 1ft50641ac714aho pkf 600mf41800460 used machine offer'

distance = 1062
spam score = 39
title = 'gravel braeuer diverse kieswerk used machine offer'

distance = 1066
spam score = 35
title = 'mobile betoncrusher holmatro icr new machine offer'

distance = 1067
spam score = 37
title = 'exhaust venti oelde gmbh used machine offer'

distance = 1069
spam score = 36
title = 'weinmann entsilberungsanlage weinmann silvex 01 fx und bx used machine offer'

distance = 1670
spam score = 38
title = 'medical technology gt breathing systems used'

distance = 1674
spam score = 69
title = 'thyssenkrupp foumlrdertechnik jaw crushers'

distance = 670
spam score = 16
title = 'msrd2x40dll dll files info download'

distance = 680
spam score = 23
title = 'more about msvidctldll file'

distance = 709
spam score = 22
title = 'ptsetupdll errors get more information'

distance = 711
spam score = 29
title = 'info dll cg18030dll'

distance = 721
spam score = 13
title = 'mapi32dll dll files'

distance = 725
spam score = 23
title = 'system files information mtxlegihdll'

distance = 728
spam score = 14
title = 'msrd3x40dll dll files'

distance = 729
spam score = 23
title = 'more dll files secsspidll'

distance = 729
spam score = 25
title = 'dll file information download dll librariesblnmgrpsdll'

distance = 731
spam score = 25
title = 'd3drampfdll dlls info and details'

distance = 732
spam score = 27
title = 'pidgendll errors file listing'

distance = 739
spam score = 16
title = 'dll info dtcutildll'

distance = 740
spam score = 22
title = 'brief information h323mspdll'

distance = 745
spam score = 15
title = 'rpcmqsvrdll errors files'

distance = 746
spam score = 20
title = 'more about polstoredll file'

distance = 747
spam score = 16
title = 'more dlls rasmxsdll'

distance = 747
spam score = 18
title = 'msjt3032dll errors what is this file'

distance = 748
spam score = 12
title = 'dvoutputdll file errors details'

distance = 748
spam score = 19
title = 'mozmapi32dll file error info'

distance = 748
spam score = 20
title = 'more about rpcltspxdll file'

distance = 824
spam score = 26
title = 'acxtrnaldll db of dll files'

distance = 824
spam score = 23
title = 'upnpuidll dll file explained'

distance = 824
spam score = 19
title = 'objb3201dll errors what is this file'

distance = 825
spam score = 29
title = 'samsrvdll libs'

distance = 825
spam score = 24
title = 'show file details for the msdeuidll file'

distance = 825
spam score = 22
title = 'lgpusbdll more details'

distance = 825
spam score = 21
title = 'halwyse7dll archived dll info'

distance = 825
spam score = 25
title = 'iecutildll errors what is this file'

distance = 825
spam score = 26
title = 'ipv6mondll errors get more information'

distance = 826
spam score = 17
title = 'encapidll more details'

distance = 849
spam score = 19
title = 'dll file listed rdpsnddll'

distance = 850
spam score = 12
title = 'ienpstubdll files info'

distance = 850
spam score = 24
title = 'dll file information for ntlanui2dll'

distance = 850
spam score = 16
title = 'tsecdll dll files'

distance = 850
spam score = 17
title = 'hwdlldll dlls info and details'

distance = 850
spam score = 28
title = 'jetdll dlls info and details'

distance = 850
spam score = 17
title = 'amdncdetdll errors files'

distance = 850
spam score = 12
title = 'system files information smtpsvcdll'

distance = 850
spam score = 26
title = 'ibm5204dll archived dll info'

distance = 850
spam score = 24
title = 'enveloprdll dlls info and details'

distance = 867
spam score = 20
title = 'confmspdll dynamic link libraries'

distance = 867
spam score = 18
title = 'various files digivcapdll'

distance = 867
spam score = 33
title = 'more dll files info shlwapidll'

distance = 867
spam score = 15
title = 'msonsextdll errors detailed information'

distance = 867
spam score = 25
title = 'msexch35dll file error info'

distance = 867
spam score = 31
title = 'cp3245mtdll errors and info'

distance = 868
spam score = 18
title = 'dll info threed32ocx'

distance = 868
spam score = 24
title = 'other file listings smtpntfsdrvdll'

distance = 868
spam score = 27
title = 'wzcnfdll file db'

distance = 868
spam score = 21
title = 'neroerrdll dll files'

distance = 889
spam score = 20
title = 'show file details for the canon330dll file'

distance = 889
spam score = 25
title = 'cpaneldll errors files'

distance = 889
spam score = 21
title = 'other file listings tdcocx'

distance = 889
spam score = 15
title = 'dll files db inetab32dll file'

distance = 889
spam score = 23
title = 'cmdialogvbx errors get more information'

distance = 890
spam score = 26
title = 'qryctrldll dlls'

distance = 890
spam score = 24
title = 'dll file download dll library information logmgrdll'

distance = 890
spam score = 29
title = 'more about awlft332dll file'

distance = 890
spam score = 18
title = 'jetimagedll dlls'

distance = 891
spam score = 19
title = 'cmutildll db of dll files'

distance = 909
spam score = 22
title = 'gapia32dll file download info'

distance = 909
spam score = 16
title = 'dll file download dll library information iisrtldll'

distance = 909
spam score = 25
title = 'dll file info download pvljpg20dll'

distance = 909
spam score = 27
title = 'atipdlxxdll file errors details'

distance = 909
spam score = 24
title = 'more dlls lgusbcmddll'

distance = 909
spam score = 25
title = 'more dll and ocx files winsmibdll'

distance = 909
spam score = 16
title = 'imjp81kdll libs'

distance = 909
spam score = 32
title = 'dll file listed rsadmindll'

distance = 910
spam score = 19
title = 'gptextdll'

distance = 910
spam score = 31
title = 'dll file information for dc95dll'

distance = 931
spam score = 21
title = 'oissq400dll file information download'

distance = 931
spam score = 18
title = 'wmiaprpldll errors file listing'

distance = 932
spam score = 31
title = 'morphores0dll file db'

distance = 932
spam score = 23
title = 'various files rasraddll'

distance = 932
spam score = 28
title = 'info dll lexp2p32dll'

distance = 932
spam score = 27
title = 'more dlls ipcdlldll'

distance = 932
spam score = 19
title = 'dll file download dll library information outlctldll'

distance = 932
spam score = 20
title = 'xprtfltrdll files'

distance = 933
spam score = 25
title = 'more dll files rsfsapsdll'

distance = 933
spam score = 25
title = 'dll file download dll library information iisextdll'

distance = 962
spam score = 27
title = 'other file listings lradardll'

distance = 962
spam score = 22
title = 'dll file info download hlp95endll'

distance = 963
spam score = 18
title = 'kpsys32dll file error info'

distance = 963
spam score = 28
title = 'i2cthk32dll file download details'

distance = 965
spam score = 23
title = 'lwebcamrdll dlls'

distance = 965
spam score = 34
title = 'mpegdecoderdll libs'

distance = 965
spam score = 23
title = 'acroiehelperocx file errors details'

distance = 966
spam score = 18
title = 'dll info gxntcpldll'

distance = 966
spam score = 22
title = 'cim32netdll download info for dll files'

distance = 966
spam score = 17
title = 'dll info asycpictdll'

distance = 1009
spam score = 22
title = 'frwddll library information'

distance = 1010
spam score = 30
title = 'more dll and ocx files pvxplore8ocx'

distance = 1010
spam score = 23
title = 'show file details for the gauge32ocx file'

distance = 1012
spam score = 17
title = 'msadcerdll dynamic library'

distance = 1012
spam score = 24
title = 'certmapocx file errors details'

distance = 1014
spam score = 21
title = 'procnicsdll dynamic library'

distance = 1014
spam score = 13
title = 'forgi8endll dll file explained'

distance = 1015
spam score = 29
title = 'lffpx7dll dll file explained'

distance = 1015
spam score = 26
title = 'dll files db msioff9ocx file'

distance = 1016
spam score = 14
title = 'more dll and ocx files vsnetutilsdll'

distance = 1503
spam score = 30
title = 'ssqrsdll prevx'

distance = 1519
spam score = 37
title = 'ssqpmdll prevx'

distance = 1643
spam score = 14
title = 'ksuser ksuserdll dll'

distance = 1644
spam score = 14
title = 'ksuser ksuserdll dll'

distance = 1663
spam score = 48
title = 'dnn module definition generator for dotnetnuke'

distance = 1681
spam score = 23
title = 'complete list of lsp dll files'

distance = 589
spam score = 80
title = ''

distance = 635
spam score = 57
title = ''

distance = 636
spam score = 80
title = ''

distance = 665
spam score = 82
title = ''

distance = 693
spam score = 96
title = ''

distance = 706
spam score = 86
title = ''

distance = 740
spam score = 96
title = ''

distance = 746
spam score = 87
title = ''

distance = 749
spam score = 94
title = ''

distance = 836
spam score = 95
title = ''

distance = 901
spam score = 81
title = ''

distance = 944
spam score = 79
title = ''

distance = 967
spam score = 94
title = ''

distance = 982
spam score = 95
title = ''

distance = 1010
spam score = 64
title = ''

distance = 1045
spam score = 87
title = ''

distance = 1064
spam score = 87
title = ''

distance = 1269
spam score = 76
title = ''

distance = 1486
spam score = 54
title = ''

distance = 494
spam score = 94
title = ''

distance = 494
spam score = 93
title = ''

distance = 519
spam score = 92
title = ''

distance = 536
spam score = 93
title = ''

distance = 541
spam score = 94
title = ''

distance = 543
spam score = 89
title = ''

distance = 559
spam score = 92
title = ''

distance = 561
spam score = 93
title = ''

distance = 588
spam score = 96
title = ''

distance = 591
spam score = 93
title = ''

distance = 610
spam score = 93
title = ''

distance = 610
spam score = 92
title = ''

distance = 616
spam score = 92
title = ''

distance = 619
spam score = 90
title = ''

distance = 670
spam score = 92
title = ''

distance = 670
spam score = 95
title = ''

distance = 715
spam score = 93
title = ''

distance = 732
spam score = 95
title = ''

distance = 779
spam score = 85
title = ''

distance = 782
spam score = 85
title = ''

distance = 790
spam score = 80
title = ''

distance = 790
spam score = 82
title = ''

distance = 798
spam score = 81
title = ''

distance = 809
spam score = 85
title = ''

distance = 810
spam score = 82
title = ''

distance = 842
spam score = 83
title = ''

distance = 854
spam score = 84
title = ''

distance = 855
spam score = 80
title = ''

distance = 878
spam score = 86
title = ''

distance = 952
spam score = 89
title = ''

distance = 953
spam score = 93
title = ''

distance = 1035
spam score = 90
title = ''

distance = 1038
spam score = 88
title = ''

distance = 1259
spam score = 75
title = ''

distance = 1343
spam score = 93
title = ''

distance = 1348
spam score = 94
title = ''

distance = 1412
spam score = 58
title = ''

distance = 1507
spam score = 62
title = ''

distance = 1600
spam score = 64
title = ''

distance = 1834
spam score = 13
title = ''

distance = 509
spam score = 38
title = 'ohapl78273'

distance = 594
spam score = 45
title = 'hapl48353'

distance = 597
spam score = 41
title = 'chengsolstcomm109439'

distance = 600
spam score = 39
title = 'bernardiniapl702990'

distance = 608
spam score = 41
title = 'loseejap462204'

distance = 611
spam score = 37
title = 'kaoapl511809'

distance = 617
spam score = 44
title = 'ilegemsjap433797'

distance = 618
spam score = 45
title = 'mynbaevaiopconf155365'

distance = 622
spam score = 40
title = 'pankovercarev34336'

distance = 625
spam score = 44
title = 'morkocmser33135'

distance = 625
spam score = 43
title = 'gaskillapl481449'

distance = 633
spam score = 42
title = 'kimjcg19437'

distance = 638
spam score = 39
title = 'yonenagajap803244'

distance = 645
spam score = 40
title = 'jinjcp951834'

distance = 647
spam score = 44
title = 'leeapl793248'

distance = 648
spam score = 39
title = 'abernathymser14203'

distance = 653
spam score = 40
title = 'yamanejcg1868'

distance = 654
spam score = 37
title = 'prywerjcg165335'

distance = 656
spam score = 45
title = 'sakaiapl76442'

distance = 657
spam score = 42
title = 'meijeringphilipsrr5333'

distance = 711
spam score = 43
title = 'fujitaphilmaga55203'

distance = 712
spam score = 49
title = 'ambracherjphysd312653'

distance = 712
spam score = 45
title = 'mulaphysstatsola176385'

distance = 712
spam score = 39
title = 'salvadorapl673322'

distance = 715
spam score = 46
title = 'reeberphysstatsola26253'

distance = 715
spam score = 45
title = 'buyanovaapl691255'

distance = 716
spam score = 48
title = 'koschnickunpublished1'

distance = 717
spam score = 42
title = 'yamashitajap50896'

distance = 718
spam score = 42
title = 'jayapalanapl731188'

distance = 719
spam score = 39
title = 'nakamuraapl73832'

distance = 747
spam score = 39
title = 'kobayashiapl713569'

distance = 750
spam score = 46
title = 'lijem241711'

distance = 753
spam score = 39
title = 'kuroiwaapl732630'

distance = 753
spam score = 45
title = 'doolittlejvstb161300'

distance = 755
spam score = 48
title = 'koronaprb65235312'

distance = 756
spam score = 49
title = 'osamurasolstcomm11617'

distance = 756
spam score = 38
title = 'stringfellowjpcs33665'

distance = 758
spam score = 41
title = 'takeuchijcg115634'

distance = 759
spam score = 38
title = 'kungapl662958'

distance = 760
spam score = 42
title = 'nakamuramrb2337'

distance = 779
spam score = 39
title = 'polyakovjap806349'

distance = 782
spam score = 39
title = 'kukharskiisolstcomm131761'

distance = 783
spam score = 44
title = 'haffouzapl792390'

distance = 783
spam score = 43
title = 'shanjap793691'

distance = 783
spam score = 44
title = 'gotzapl69242'

distance = 784
spam score = 34
title = 'livingstoneapl652771'

distance = 785
spam score = 45
title = 'qianapl672284'

distance = 786
spam score = 44
title = 'fiorekaphyspola92742'

distance = 787
spam score = 40
title = 'paskovaphysscrt7967'

distance = 789
spam score = 39
title = 'gaskilljem241525'

distance = 813
spam score = 41
title = 'shenapl72344'

distance = 816
spam score = 47
title = 'hjalmarsonprl44810'

distance = 817
spam score = 42
title = 'zollnerphysstatsolb208r3'

distance = 817
spam score = 44
title = 'keatingpr149674'

distance = 819
spam score = 43
title = 'cartwrightjap737767'

distance = 820
spam score = 37
title = 'waldropapl682879'

distance = 820
spam score = 43
title = 'lundinmsf2641125'

distance = 824
spam score = 40
title = 'trachtmanjphch9915028'

distance = 827
spam score = 43
title = 'ponceapl6857'

distance = 829
spam score = 42
title = 'baurapl652211'

distance = 852
spam score = 43
title = 'wujap803228'

distance = 861
spam score = 40
title = 'skrommemseb50117'

distance = 863
spam score = 51
title = 'arltjasa37384'

distance = 863
spam score = 43
title = 'schowalterapl76985'

distance = 864
spam score = 43
title = 'rebanemrssp468179'

distance = 868
spam score = 41
title = 'bastardprb261974'

distance = 868
spam score = 44
title = 'rouvieremrssp395393'

distance = 868
spam score = 43
title = 'jadwisienczakapl763376'

distance = 873
spam score = 38
title = 'stecklapl692264'

distance = 875
spam score = 47
title = 'bergmaniopconf142931'

distance = 908
spam score = 36
title = 'francoeurapl721857'

distance = 911
spam score = 38
title = 'barkerpr1321474'

distance = 912
spam score = 45
title = 'schlessermrssp693i941'

distance = 913
spam score = 43
title = 'elwelljcg6645'

distance = 917
spam score = 45
title = 'kuballjjap39710'

distance = 921
spam score = 41
title = 'mosinbook1970therm'

distance = 923
spam score = 44
title = 'hiramatsujjap321528'

distance = 925
spam score = 38
title = 'nakamurajvsta13705'

distance = 926
spam score = 33
title = 'khanapl602917'

distance = 930
spam score = 41
title = 'segaljcg21168'

distance = 977
spam score = 41
title = 'mohammadpieee831306'

distance = 978
spam score = 41
title = 'kleinmanprl481425'

distance = 992
spam score = 49
title = 'venneguesjcg187167'

distance = 992
spam score = 39
title = 'schubertprb534265'

distance = 993
spam score = 37
title = 'tanakaapl6637'

distance = 1001
spam score = 42
title = 'eddyjap73448'

distance = 1004
spam score = 38
title = 'gibsonapl571203'

distance = 1019
spam score = 45
title = 'michlerprb471671'

distance = 1021
spam score = 46
title = 'vassilevskiiopconf1421027'

distance = 1030
spam score = 34
title = 'matsuokajem21157'

distance = 1168
spam score = 43
title = 'hammondjvsta13136'

distance = 1174
spam score = 41
title = 'chichibujap792784'

distance = 1187
spam score = 41
title = 'gordienkorjpc51530'

distance = 1191
spam score = 44
title = 'chichibuapl712346'

distance = 1208
spam score = 42
title = 'shikanaijap81417'

distance = 1230
spam score = 36
title = 'yangapl731086'

distance = 1257
spam score = 48
title = 'iwayajjap37l316'

distance = 1259
spam score = 41
title = 'kimprb501502'

distance = 1261
spam score = 38
title = 'wujjap35l1648'

distance = 1265
spam score = 39
title = 'nidojjap34l1513'

distance = 1596
spam score = 55
title = 'mijnsr vol 4s1 art g77 jung han et al'

distance = 1618
spam score = 51
title = 'environmental reference materials concentrations'

distance = 1655
spam score = 66
title = 'mijnsr vol 5s1 art w1154 joachim wagner et al'

distance = 1667
spam score = 43
title = 'figures for mijnsr volume 1 article 2'

distance = 1672
spam score = 47
title = 'mijnsr vol 2 art 32 j allegravegre et al'

distance = 1687
spam score = 70
title = 'mijnsr vol 1 art 30 j a majewski et al'

distance = 1714
spam score = 72
title = 'mijnsr vol 3 art 21 j a majewski and p vogl'

distance = 844
spam score = 40
title = ''

distance = 844
spam score = 43
title = ''

distance = 865
spam score = 32
title = ''

distance = 865
spam score = 37
title = ''

distance = 865
spam score = 37
title = ''

distance = 865
spam score = 36
title = ''

distance = 865
spam score = 36
title = ''

distance = 865
spam score = 36
title = ''

distance = 865
spam score = 32
title = ''

distance = 865
spam score = 32
title = ''

distance = 865
spam score = 32
title = ''

distance = 865
spam score = 32
title = ''

distance = 865
spam score = 32
title = ''

distance = 865
spam score = 32
title = ''

distance = 865
spam score = 33
title = ''

distance = 865
spam score = 32
title = ''

distance = 865
spam score = 32
title = ''

distance = 865
spam score = 30
title = ''

distance = 865
spam score = 30
title = ''

distance = 865
spam score = 30
title = ''

distance = 865
spam score = 30
title = ''

distance = 865
spam score = 37
title = ''

distance = 865
spam score = 37
title = ''

distance = 865
spam score = 37
title = ''

distance = 865
spam score = 34
title = ''

distance = 865
spam score = 33
title = ''

distance = 865
spam score = 34
title = ''

distance = 865
spam score = 34
title = ''

distance = 865
spam score = 33
title = ''

distance = 865
spam score = 34
title = ''

distance = 885
spam score = 33
title = ''

distance = 885
spam score = 30
title = ''

distance = 885
spam score = 30
title = ''

distance = 885
spam score = 30
title = ''

distance = 885
spam score = 30
title = ''

distance = 885
spam score = 30
title = ''

distance = 885
spam score = 33
title = ''

distance = 885
spam score = 38
title = ''

distance = 885
spam score = 30
title = ''

distance = 885
spam score = 33
title = ''

distance = 889
spam score = 31
title = ''

distance = 889
spam score = 32
title = ''

distance = 895
spam score = 33
title = ''

distance = 895
spam score = 29
title = ''

distance = 895
spam score = 29
title = ''

distance = 895
spam score = 32
title = ''

distance = 895
spam score = 29
title = ''

distance = 895
spam score = 29
title = ''

distance = 895
spam score = 33
title = ''

distance = 895
spam score = 32
title = ''

distance = 895
spam score = 29
title = ''

distance = 895
spam score = 28
title = ''

distance = 895
spam score = 29
title = ''

distance = 897
spam score = 36
title = ''

distance = 897
spam score = 34
title = ''

distance = 897
spam score = 30
title = ''

distance = 897
spam score = 30
title = ''

distance = 897
spam score = 38
title = ''

distance = 897
spam score = 35
title = ''

distance = 897
spam score = 35
title = ''

distance = 897
spam score = 35
title = ''

distance = 897
spam score = 33
title = ''

distance = 897
spam score = 34
title = ''

distance = 897
spam score = 30
title = ''

distance = 897
spam score = 30
title = ''

distance = 897
spam score = 30
title = ''

distance = 897
spam score = 30
title = ''

distance = 897
spam score = 30
title = ''

distance = 897
spam score = 30
title = ''

distance = 953
spam score = 70
title = ''

distance = 955
spam score = 51
title = ''

distance = 1247
spam score = 62
title = ''

distance = 1256
spam score = 41
title = ''

distance = 1725
spam score = 32
title = ''

distance = 1773
spam score = 71
title = ''

distance = 619
spam score = 34
title = ''

distance = 620
spam score = 33
title = ''

distance = 636
spam score = 32
title = ''

distance = 637
spam score = 31
title = ''

distance = 640
spam score = 32
title = ''

distance = 644
spam score = 30
title = ''

distance = 644
spam score = 32
title = ''

distance = 645
spam score = 31
title = ''

distance = 649
spam score = 33
title = ''

distance = 652
spam score = 23
title = ''

distance = 678
spam score = 27
title = ''

distance = 691
spam score = 33
title = ''

distance = 694
spam score = 25
title = ''

distance = 737
spam score = 31
title = ''

distance = 742
spam score = 36
title = ''

distance = 744
spam score = 30
title = ''

distance = 747
spam score = 32
title = ''

distance = 748
spam score = 30
title = ''

distance = 750
spam score = 30
title = ''

distance = 756
spam score = 32
title = ''

distance = 760
spam score = 32
title = ''

distance = 760
spam score = 32
title = ''

distance = 767
spam score = 27
title = ''

distance = 768
spam score = 36
title = ''

distance = 770
spam score = 35
title = ''

distance = 771
spam score = 24
title = ''

distance = 772
spam score = 31
title = ''

distance = 799
spam score = 19
title = ''

distance = 809
spam score = 30
title = ''

distance = 815
spam score = 24
title = ''

distance = 818
spam score = 27
title = ''

distance = 823
spam score = 32
title = ''

distance = 824
spam score = 21
title = ''

distance = 831
spam score = 32
title = ''

distance = 844
spam score = 35
title = ''

distance = 844
spam score = 30
title = ''

distance = 849
spam score = 29
title = ''

distance = 849
spam score = 29
title = ''

distance = 850
spam score = 38
title = ''

distance = 851
spam score = 30
title = ''

distance = 856
spam score = 27
title = ''

distance = 857
spam score = 28
title = ''

distance = 857
spam score = 28
title = ''

distance = 862
spam score = 32
title = ''

distance = 874
spam score = 30
title = ''

distance = 882
spam score = 24
title = ''

distance = 897
spam score = 29
title = ''

distance = 901
spam score = 37
title = ''

distance = 904
spam score = 26
title = ''

distance = 916
spam score = 30
title = ''

distance = 919
spam score = 23
title = ''

distance = 968
spam score = 20
title = ''

distance = 983
spam score = 26
title = ''

distance = 984
spam score = 26
title = ''

distance = 991
spam score = 25
title = ''

distance = 993
spam score = 24
title = ''

distance = 1000
spam score = 34
title = ''

distance = 1105
spam score = 19
title = ''

distance = 1114
spam score = 22
title = ''

distance = 1587
spam score = 40
title = ''

distance = 1648
spam score = 67
title = ''

distance = 1689
spam score = 82
title = ''

distance = 1692
spam score = 49
title = ''

distance = 1694
spam score = 43
title = ''

distance = 1695
spam score = 39
title = ''

distance = 19
spam score = 79
title = ''

distance = 27
spam score = 88
title = ''

distance = 897
spam score = 70
title = ''

distance = 1630
spam score = 49
title = ''

distance = 106
spam score = 15
title = ''

distance = 107
spam score = 14
title = ''

distance = 111
spam score = 16
title = ''

distance = 111
spam score = 16
title = ''

distance = 131
spam score = 15
title = ''

distance = 195
spam score = 15
title = ''

distance = 216
spam score = 12
title = ''

distance = 1437
spam score = 41
title = ''

distance = 1444
spam score = 53
title = ''

distance = 1608
spam score = 73
title = ''

distance = 1640
spam score = 71
title = ''

distance = 122
spam score = 71
title = 'epa ttn naaqs ozone areas msa bangor me'

distance = 126
spam score = 70
title = 'epa ttn naaqs ozone areas msa bloomington in'

distance = 135
spam score = 70
title = 'epa ttn naaqs ozone areas msa corvallis or'

distance = 142
spam score = 69
title = 'epa ttn naaqs ozone areas msa columbus oh'

distance = 153
spam score = 71
title = 'epa ttn naaqs ozone areas msa atlanta ga'

distance = 154
spam score = 69
title = 'epa ttn naaqs ozone areas msa bellingham wa'

distance = 158
spam score = 70
title = 'epa ttn naaqs ozone areas msa billings mt'

distance = 165
spam score = 72
title = 'epa ttn naaqs ozone areas msa albany ga'

distance = 171
spam score = 71
title = 'epa ttn naaqs ozone areas msa elmira ny'

distance = 171
spam score = 72
title = 'epa ttn naaqs ozone areas msa asheville nc'

distance = 174
spam score = 71
title = 'epa ttn naaqs ozone areas msa decatur al msa'

distance = 177
spam score = 72
title = 'epa ttn naaqs ozone areas msa columbia sc'

distance = 177
spam score = 71
title = 'epa ttn naaqs ozone areas msa colorado springs co'

distance = 177
spam score = 71
title = 'epa ttn naaqs ozone areas msa anniston al'

distance = 180
spam score = 70
title = 'epa ttn naaqs ozone areas msa alexandria la'

distance = 183
spam score = 72
title = 'epa ttn naaqs ozone areas msa cheyenne wy'

distance = 184
spam score = 74
title = 'epa ttn naaqs ozone areas msa abilene tx'

distance = 184
spam score = 68
title = 'epa ttn naaqs ozone areas msa columbia mo'

distance = 187
spam score = 68
title = 'epa ttn naaqs ozone areas msa erie pa'

distance = 190
spam score = 71
title = 'epa ttn naaqs ozone areas msa danville va'

distance = 191
spam score = 69
title = 'epa ttn naaqs ozone areas msa binghamton ny'

distance = 198
spam score = 69
title = 'epa ttn naaqs ozone areas msa daytonspringfield oh'

distance = 199
spam score = 70
title = 'epa ttn naaqs ozone areas msa dothan al'

distance = 199
spam score = 74
title = 'epa ttn naaqs ozone areas msa elkhartgoshen in'

distance = 200
spam score = 71
title = 'epa ttn naaqs ozone areas msa birmingham al'

distance = 201
spam score = 69
title = 'epa ttn naaqs ozone areas msa charleston wv'

distance = 204
spam score = 72
title = 'epa ttn naaqs ozone areas msa athens ga'

distance = 205
spam score = 72
title = 'epa ttn naaqs ozone areas msa chicoparadise ca'

distance = 206
spam score = 71
title = 'epa ttn naaqs ozone areas msa barnstableyarmouth ma'

distance = 214
spam score = 73
title = 'epa ttn naaqs ozone areas msa baton rouge la'

distance = 219
spam score = 70
title = 'epa ttn naaqs ozone areas msa enid ok'

distance = 221
spam score = 70
title = 'epa ttn naaqs ozone areas msa bloomingtonnormal il'

distance = 226
spam score = 70
title = 'epa ttn naaqs ozone areas msa cedar rapids ia'

distance = 229
spam score = 70
title = 'epa ttn naaqs ozone areas msa el paso tx'

distance = 230
spam score = 73
title = 'epa ttn naaqs ozone areas msa des moines ia'

distance = 233
spam score = 69
title = 'epa ttn naaqs ozone areas msa auburnopelika al'

distance = 242
spam score = 71
title = 'epa ttn naaqs ozone areas msa champaignurbana il'

distance = 249
spam score = 72
title = 'epa ttn naaqs ozone areas msa charlestonnorth charleston sc'

distance = 259
spam score = 69
title = 'epa ttn naaqs ozone areas msa albanyschenectadytroy ny'

distance = 261
spam score = 71
title = 'epa ttn naaqs ozone areas msa buffaloniagara falls ny'

distance = 262
spam score = 68
title = 'epa ttn naaqs ozone areas msa cumberland mdwv'

distance = 268
spam score = 73
title = 'epa ttn naaqs ozone areas msa bryancollege station tx'

distance = 270
spam score = 69
title = 'epa ttn naaqs ozone areas msa daytona beach fl'

distance = 281
spam score = 69
title = 'epa ttn naaqs ozone areas msa duluthsuperior mnwi'

distance = 282
spam score = 70
title = 'epa ttn naaqs ozone areas msa dallasfort worth tx'

distance = 290
spam score = 70
title = 'epa ttn naaqs ozone areas msa appletonoshkoshneenah wi'

distance = 294
spam score = 70
title = 'epa ttn naaqs ozone areas msa austinsan marcos tx'

distance = 300
spam score = 69
title = 'epa ttn naaqs ozone areas msa bostonworcesterlawrence manhme'

distance = 306
spam score = 72
title = 'epa ttn naaqs ozone areas msa clarksvillehopkinsville tnky'

distance = 326
spam score = 71
title = 'epa ttn naaqs ozone areas msa brownsvilleharlingensan benito tx'

distance = 329
spam score = 70
title = 'epa ttn naaqs ozone areas msa fargomoorhead ndmn'

distance = 334
spam score = 70
title = 'epa ttn naaqs ozone areas msa allentownbethlehemeaston pa'

distance = 337
spam score = 68
title = 'epa ttn naaqs ozone areas msa chicagogarykenosha ilinwi'

distance = 350
spam score = 70
title = 'epa ttn naaqs ozone areas msa davenportmolinerock island iail'

distance = 917
spam score = 71
title = 'epa ttn naaqs ozone areas site map'

distance = 1048
spam score = 51
title = 'epa ttn naaqs washington stateplant index page net96 by map id'

distance = 1119
spam score = 44
title = 'epa ttn naaqs texas stateplant index page net96 by voc emissions'

distance = 1120
spam score = 47
title = 'epa ttn naaqs florida stateplant index page net96 by voc emissions'

distance = 1124
spam score = 36
title = 'epa ttn naaqs arkansas stateplant index page net96 by voc emissions'

distance = 1132
spam score = 44
title = 'epa ttn naaqs oregon stateplant index page net96 by voc emissions'

distance = 1132
spam score = 42
title = 'epa ttn naaqs maryland stateplant index page net96 by voc emissions'

distance = 1132
spam score = 55
title = 'epa ttn naaqs connecticut stateplant index page net96 by voc emissions'

distance = 1134
spam score = 47
title = 'epa ttn naaqs louisiana stateplant index page net96 by nox emissions'

distance = 1137
spam score = 44
title = 'epa ttn naaqs michigan stateplant index page net96 by nox emissions'

distance = 1139
spam score = 39
title = 'epa ttn naaqs california stateplant index page net96 by nox emissions'

distance = 1139
spam score = 46
title = 'epa ttn naaqs florida stateplant index page net96 by nox emissions'

distance = 1140
spam score = 46
title = 'epa ttn naaqs massachusetts stateplant index page net96 by voc emissions'

distance = 1142
spam score = 42
title = 'epa ttn naaqs wyoming stateplant index page net96 by voc emissions'

distance = 1143
spam score = 51
title = 'epa ttn naaqs oregon stateplant index page net96 by nox emissions'

distance = 1146
spam score = 43
title = 'epa ttn naaqs virginia stateplant index page net96 by voc emissions'

distance = 1151
spam score = 42
title = 'epa ttn naaqs ozone areas stateplant net96 west virginia'

distance = 1158
spam score = 31
title = 'epa ttn naaqs oklahoma stateplant index page net96 by voc emissions'

distance = 1163
spam score = 46
title = 'epa ttn naaqs west virginia stateplant index page net96 by nox emissions'

distance = 1169
spam score = 50
title = 'epa ttn naaqs ozone areas stateplant net96 oregon'

distance = 1177
spam score = 52
title = 'epa ttn naaqs new york stateplant index page net96 by map id'

distance = 1178
spam score = 94
title = 'epa ttn naaqs ozone areas etscem data'

distance = 1185
spam score = 44
title = 'epa ttn naaqs wisconsin stateplant index page net96 by map id'

distance = 1193
spam score = 48
title = 'epa ttn naaqs new jersey stateplant index page net96 by map id'

distance = 1194
spam score = 96
title = 'epa ttn naaqs ozone areas etscem data'

distance = 1253
spam score = 87
title = 'epa ttn naaqs ozone areas sample data'

distance = 1320
spam score = 93
title = 'epa ttn naaqs ozone areas other data'

distance = 1370
spam score = 91
title = 'epa ttn naaqs ozone areas download county emission summary'

distance = 1389
spam score = 78
title = 'epa ttn naaqs co lockheed information technology co'

distance = 1394
spam score = 63
title = 'epa ttn naaqs az gila river productscourtaulds perf film'

distance = 1399
spam score = 62
title = 'epa ttn naaqs az mccarthy cabinet co'

distance = 1411
spam score = 63
title = 'epa ttn naaqs wi valley cabinet inc'

distance = 1415
spam score = 64
title = 'epa ttn naaqs wa long painting co'

distance = 1420
spam score = 67
title = 'epa ttn naaqs nc martin marietta haw river quarry'

distance = 1421
spam score = 65
title = 'epa ttn naaqs nc martin marietta burlington quarry'

distance = 1425
spam score = 67
title = 'epa ttn naaqs fl east coast asphalt'

distance = 1426
spam score = 68
title = 'epa ttn naaqs va data visible corp'

distance = 1429
spam score = 66
title = 'epa ttn naaqs fl florida gas transmission co taylor co'

distance = 1447
spam score = 73
title = 'epa ttn naaqs ozone areas origin of net 1996 data'

distance = 1472
spam score = 68
title = 'epa ttn naaqs pa new columbia joist co'

distance = 1477
spam score = 60
title = 'epa ttn naaqs wa weyerhaueser co'

distance = 1484
spam score = 65
title = 'epa ttn naaqs ozone areas tribal puyallup reservation'

distance = 1492
spam score = 67
title = 'epa ttn naaqs fl trademark metals recycling'

distance = 1588
spam score = 82
title = 'epa ttn amtic passive monitoring documents'

distance = 1637
spam score = 55
title = 'epa ttn naaqs pa yorktowne'

distance = 1670
spam score = 48
title = ''

distance = 1681
spam score = 52
title = '2d and 3d trajectories'

distance = 1681
spam score = 51
title = '2d and 3d trajectories'

distance = 1687
spam score = 62
title = '2d and 3d trajectories'

distance = 1766
spam score = 26
title = 'accent emissions'

distance = 511
spam score = 59
title = ''

distance = 695
spam score = 60
title = ''

distance = 733
spam score = 90
title = ''

distance = 736
spam score = 93
title = ''

distance = 750
spam score = 68
title = ''

distance = 766
spam score = 72
title = ''

distance = 773
spam score = 75
title = ''

distance = 781
spam score = 77
title = ''

distance = 790
spam score = 76
title = ''

distance = 802
spam score = 74
title = ''

distance = 812
spam score = 71
title = ''

distance = 816
spam score = 73
title = ''

distance = 827
spam score = 83
title = ''

distance = 845
spam score = 80
title = ''

distance = 847
spam score = 74
title = ''

distance = 860
spam score = 69
title = ''

distance = 877
spam score = 76
title = ''

distance = 877
spam score = 82
title = ''

distance = 880
spam score = 68
title = ''

distance = 881
spam score = 77
title = ''

distance = 891
spam score = 78
title = ''

distance = 894
spam score = 74
title = ''

distance = 896
spam score = 79
title = ''

distance = 901
spam score = 87
title = ''

distance = 904
spam score = 80
title = ''

distance = 905
spam score = 80
title = ''

distance = 917
spam score = 73
title = ''

distance = 937
spam score = 80
title = ''

distance = 941
spam score = 86
title = ''

distance = 942
spam score = 82
title = ''

distance = 956
spam score = 67
title = ''

distance = 963
spam score = 89
title = ''

distance = 979
spam score = 49
title = ''

distance = 988
spam score = 66
title = ''

distance = 992
spam score = 83
title = ''

distance = 993
spam score = 83
title = ''

distance = 1046
spam score = 74
title = ''

distance = 1217
spam score = 65
title = ''

distance = 1226
spam score = 64
title = ''

distance = 1242
spam score = 64
title = ''

distance = 1245
spam score = 72
title = ''

distance = 1690
spam score = 87
title = ''

distance = 348
spam score = 53
title = 'espon data navigator choose subtheme'

distance = 382
spam score = 48
title = 'espon data navigator choose subtheme'

distance = 398
spam score = 49
title = 'espon data navigator choose subtheme'

distance = 401
spam score = 48
title = 'espon data navigator choose subtheme'

distance = 409
spam score = 49
title = 'espon data navigator choose subtheme'

distance = 416
spam score = 50
title = 'espon data navigator choose subtheme'

distance = 426
spam score = 47
title = 'espon data navigator choose subtheme'

distance = 435
spam score = 52
title = 'espon data navigator choose subtheme'

distance = 455
spam score = 50
title = 'espon data navigator choose subtheme'

distance = 458
spam score = 46
title = 'espon data navigator choose subtheme'

distance = 466
spam score = 49
title = 'espon data navigator choose subtheme'

distance = 469
spam score = 49
title = 'espon data navigator choose subtheme'

distance = 476
spam score = 46
title = 'espon data navigator choose subtheme'

distance = 477
spam score = 53
title = 'espon data navigator choose subtheme'

distance = 486
spam score = 51
title = 'espon data navigator choose subtheme'

distance = 504
spam score = 54
title = 'espon data navigator choose subtheme'

distance = 506
spam score = 53
title = 'espon data navigator choose subtheme'

distance = 506
spam score = 47
title = 'espon data navigator choose subtheme'

distance = 508
spam score = 52
title = 'espon data navigator choose subtheme'

distance = 508
spam score = 51
title = 'espon data navigator choose subtheme'

distance = 635
spam score = 52
title = 'espon data navigator choose subtheme'

distance = 637
spam score = 40
title = 'espon data navigator choose subtheme'

distance = 637
spam score = 48
title = 'espon data navigator choose subtheme'

distance = 637
spam score = 59
title = 'espon data navigator choose subtheme'

distance = 638
spam score = 47
title = 'espon data navigator choose subtheme'

distance = 638
spam score = 52
title = 'espon data navigator choose subtheme'

distance = 640
spam score = 52
title = 'espon data navigator choose subtheme'

distance = 641
spam score = 52
title = 'espon data navigator choose subtheme'

distance = 642
spam score = 52
title = 'espon data navigator choose subtheme'

distance = 644
spam score = 51
title = 'espon data navigator choose subtheme'

distance = 676
spam score = 55
title = 'espon data navigator choose subtheme'

distance = 677
spam score = 41
title = 'espon data navigator choose subtheme'

distance = 680
spam score = 53
title = 'espon data navigator choose subtheme'

distance = 682
spam score = 44
title = 'espon data navigator choose subtheme'

distance = 682
spam score = 45
title = 'espon data navigator choose subtheme'

distance = 682
spam score = 51
title = 'espon data navigator choose subtheme'

distance = 684
spam score = 45
title = 'espon data navigator choose subtheme'

distance = 686
spam score = 51
title = 'espon data navigator choose subtheme'

distance = 686
spam score = 56
title = 'espon data navigator choose subtheme'

distance = 687
spam score = 71
title = 'espon data navigator choose subtheme'

distance = 733
spam score = 45
title = 'espon data navigator choose subtheme'

distance = 733
spam score = 46
title = 'espon data navigator choose subtheme'

distance = 734
spam score = 66
title = 'espon data navigator choose subtheme'

distance = 736
spam score = 48
title = 'espon data navigator choose subtheme'

distance = 738
spam score = 49
title = 'espon data navigator choose subtheme'

distance = 740
spam score = 44
title = 'espon data navigator choose subtheme'

distance = 741
spam score = 64
title = 'espon data navigator choose subtheme'

distance = 741
spam score = 54
title = 'espon data navigator choose subtheme'

distance = 741
spam score = 44
title = 'espon data navigator choose subtheme'

distance = 742
spam score = 42
title = 'espon data navigator choose subtheme'

distance = 788
spam score = 54
title = 'espon data navigator choose subtheme'

distance = 789
spam score = 44
title = 'espon data navigator choose subtheme'

distance = 789
spam score = 57
title = 'espon data navigator choose subtheme'

distance = 790
spam score = 47
title = 'espon data navigator choose subtheme'

distance = 790
spam score = 55
title = 'espon data navigator choose subtheme'

distance = 791
spam score = 41
title = 'espon data navigator choose subtheme'

distance = 792
spam score = 68
title = 'espon data navigator choose subtheme'

distance = 793
spam score = 51
title = 'espon data navigator choose subtheme'

distance = 797
spam score = 50
title = 'espon data navigator choose subtheme'

distance = 797
spam score = 47
title = 'espon data navigator choose subtheme'

distance = 864
spam score = 50
title = 'espon data navigator choose subtheme'

distance = 864
spam score = 46
title = 'espon data navigator choose subtheme'

distance = 870
spam score = 51
title = 'espon data navigator choose subtheme'

distance = 874
spam score = 55
title = 'espon data navigator choose subtheme'

distance = 874
spam score = 51
title = 'espon data navigator choose subtheme'

distance = 879
spam score = 52
title = 'espon data navigator choose subtheme'

distance = 881
spam score = 57
title = 'espon data navigator choose subtheme'

distance = 886
spam score = 62
title = 'espon data navigator choose subtheme'

distance = 893
spam score = 61
title = 'espon data navigator choose subtheme'

distance = 896
spam score = 55
title = 'espon data navigator choose subtheme'

distance = 981
spam score = 41
title = 'espon data navigator choose subtheme'

distance = 982
spam score = 51
title = 'espon data navigator choose subtheme'

distance = 990
spam score = 53
title = 'espon data navigator choose subtheme'

distance = 990
spam score = 42
title = 'espon data navigator choose subtheme'

distance = 992
spam score = 63
title = 'espon data navigator choose subtheme'

distance = 992
spam score = 42
title = 'espon data navigator choose subtheme'

distance = 997
spam score = 56
title = 'espon data navigator choose subtheme'

distance = 1005
spam score = 47
title = 'espon data navigator choose subtheme'

distance = 1006
spam score = 49
title = 'espon data navigator choose subtheme'

distance = 1008
spam score = 48
title = 'espon data navigator choose subtheme'

distance = 1162
spam score = 56
title = 'espon data navigator choose subtheme'

distance = 1173
spam score = 49
title = 'espon data navigator choose subtheme'

distance = 1182
spam score = 53
title = 'espon data navigator choose subtheme'

distance = 1196
spam score = 45
title = 'espon data navigator choose subtheme'

distance = 1199
spam score = 50
title = 'espon data navigator choose subtheme'

distance = 1202
spam score = 57
title = 'espon data navigator choose subtheme'

distance = 1203
spam score = 45
title = 'espon data navigator choose subtheme'

distance = 1203
spam score = 39
title = 'espon data navigator choose theme'

distance = 1205
spam score = 54
title = 'espon data navigator choose subtheme'

distance = 1207
spam score = 44
title = 'espon data navigator choose theme'

distance = 1281
spam score = 47
title = 'espon data navigator choose theme'

distance = 1289
spam score = 54
title = 'espon data navigator choose subtheme'

distance = 1291
spam score = 46
title = 'espon data navigator choose theme'

distance = 1292
spam score = 56
title = 'espon data navigator choose subtheme'

distance = 1296
spam score = 55
title = 'espon data navigator choose subtheme'

distance = 1297
spam score = 62
title = 'espon data navigator choose subtheme'

distance = 1311
spam score = 38
title = 'espon data navigator choose subtheme'

distance = 1312
spam score = 47
title = 'espon data navigator choose theme'

distance = 1323
spam score = 46
title = 'espon data navigator search results'

distance = 1330
spam score = 49
title = 'espon data navigator search results'

distance = 1648
spam score = 39
title = 'espon data navigator search results'

distance = 1668
spam score = 47
title = 'espon data navigator search results'

distance = 1683
spam score = 57
title = 'espon data navigator search results'

distance = 1688
spam score = 55
title = 'espon data navigator search results'

distance = 1692
spam score = 83
title = 'electronic navigation charts enc'

distance = 1697
spam score = 48
title = ''

distance = 1737
spam score = 44
title = 'hawaii mapping research group'

distance = 1812
spam score = 54
title = 'flat station'

distance = 642
spam score = 45
title = 'nineteenth century in print periodicals volume list'

distance = 643
spam score = 53
title = 'nineteenth century in print periodicals volume list'

distance = 661
spam score = 59
title = 'nineteenth century in print periodicals volume list'

distance = 661
spam score = 54
title = 'nineteenth century in print periodicals volume list'

distance = 671
spam score = 53
title = 'nineteenth century in print periodicals volume list'

distance = 673
spam score = 49
title = 'nineteenth century in print periodicals volume list'

distance = 673
spam score = 54
title = 'nineteenth century in print periodicals volume list'

distance = 678
spam score = 51
title = 'nineteenth century in print periodicals volume list'

distance = 679
spam score = 49
title = 'nineteenth century in print periodicals volume list'

distance = 679
spam score = 40
title = 'nineteenth century in print periodicals volume list'

distance = 681
spam score = 44
title = 'nineteenth century in print periodicals volume list'

distance = 686
spam score = 45
title = 'nineteenth century in print periodicals volume list'

distance = 687
spam score = 45
title = 'nineteenth century in print periodicals volume list'

distance = 691
spam score = 51
title = 'nineteenth century in print periodicals volume list'

distance = 693
spam score = 48
title = 'nineteenth century in print periodicals volume list'

distance = 695
spam score = 53
title = 'nineteenth century in print periodicals volume list'

distance = 701
spam score = 59
title = 'nineteenth century in print periodicals volume list'

distance = 704
spam score = 57
title = 'nineteenth century in print periodicals volume list'

distance = 707
spam score = 50
title = 'nineteenth century in print periodicals volume list'

distance = 711
spam score = 55
title = 'nineteenth century in print periodicals volume list'

distance = 734
spam score = 39
title = 'nineteenth century in print periodicals volume list'

distance = 735
spam score = 55
title = 'nineteenth century in print periodicals volume list'

distance = 736
spam score = 53
title = 'nineteenth century in print periodicals volume list'

distance = 736
spam score = 51
title = 'nineteenth century in print periodicals volume list'

distance = 736
spam score = 50
title = 'nineteenth century in print periodicals volume list'

distance = 736
spam score = 48
title = 'nineteenth century in print periodicals volume list'

distance = 737
spam score = 67
title = 'nineteenth century in print periodicals volume list'

distance = 737
spam score = 53
title = 'nineteenth century in print periodicals volume list'

distance = 739
spam score = 48
title = 'nineteenth century in print periodicals volume list'

distance = 740
spam score = 65
title = 'nineteenth century in print periodicals volume list'

distance = 752
spam score = 44
title = 'nineteenth century in print periodicals volume list'

distance = 752
spam score = 47
title = 'nineteenth century in print periodicals volume list'

distance = 753
spam score = 55
title = 'nineteenth century in print periodicals volume list'

distance = 753
spam score = 41
title = 'nineteenth century in print periodicals volume list'

distance = 754
spam score = 47
title = 'nineteenth century in print periodicals volume list'

distance = 755
spam score = 53
title = 'nineteenth century in print periodicals volume list'

distance = 757
spam score = 53
title = 'nineteenth century in print periodicals volume list'

distance = 763
spam score = 70
title = 'nineteenth century in print periodicals volume list'

distance = 763
spam score = 55
title = 'nineteenth century in print periodicals volume list'

distance = 764
spam score = 66
title = 'nineteenth century in print periodicals volume list'

distance = 773
spam score = 47
title = 'nineteenth century in print periodicals volume list'

distance = 773
spam score = 63
title = 'nineteenth century in print periodicals volume list'

distance = 774
spam score = 50
title = 'nineteenth century in print periodicals volume list'

distance = 775
spam score = 62
title = 'nineteenth century in print periodicals volume list'

distance = 776
spam score = 76
title = 'nineteenth century in print periodicals volume list'

distance = 777
spam score = 54
title = 'nineteenth century in print periodicals volume list'

distance = 777
spam score = 65
title = 'nineteenth century in print periodicals volume list'

distance = 780
spam score = 57
title = 'nineteenth century in print periodicals volume list'

distance = 780
spam score = 50
title = 'nineteenth century in print periodicals volume list'

distance = 781
spam score = 45
title = 'nineteenth century in print periodicals volume list'

distance = 789
spam score = 56
title = 'nineteenth century in print periodicals volume list'

distance = 790
spam score = 55
title = 'nineteenth century in print periodicals volume list'

distance = 790
spam score = 61
title = 'nineteenth century in print periodicals volume list'

distance = 791
spam score = 69
title = 'nineteenth century in print periodicals volume list'

distance = 795
spam score = 45
title = 'nineteenth century in print periodicals volume list'

distance = 797
spam score = 63
title = 'nineteenth century in print periodicals volume list'

distance = 802
spam score = 44
title = 'nineteenth century in print periodicals volume list'

distance = 802
spam score = 46
title = 'nineteenth century in print periodicals volume list'

distance = 803
spam score = 68
title = 'nineteenth century in print periodicals volume list'

distance = 807
spam score = 59
title = 'nineteenth century in print periodicals volume list'

distance = 828
spam score = 50
title = 'nineteenth century in print periodicals volume list'

distance = 830
spam score = 53
title = 'nineteenth century in print periodicals volume list'

distance = 830
spam score = 47
title = 'nineteenth century in print periodicals volume list'

distance = 830
spam score = 57
title = 'nineteenth century in print periodicals volume list'

distance = 830
spam score = 53
title = 'nineteenth century in print periodicals volume list'

distance = 831
spam score = 63
title = 'nineteenth century in print periodicals volume list'

distance = 832
spam score = 65
title = 'nineteenth century in print periodicals volume list'

distance = 833
spam score = 62
title = 'nineteenth century in print periodicals volume list'

distance = 834
spam score = 44
title = 'nineteenth century in print periodicals volume list'

distance = 838
spam score = 42
title = 'nineteenth century in print periodicals volume list'

distance = 857
spam score = 47
title = 'nineteenth century in print periodicals volume list'

distance = 860
spam score = 50
title = 'nineteenth century in print periodicals volume list'

distance = 863
spam score = 62
title = 'nineteenth century in print periodicals volume list'

distance = 864
spam score = 58
title = 'nineteenth century in print periodicals volume list'

distance = 867
spam score = 49
title = 'nineteenth century in print periodicals volume list'

distance = 870
spam score = 67
title = 'nineteenth century in print periodicals volume list'

distance = 870
spam score = 69
title = 'nineteenth century in print periodicals volume list'

distance = 873
spam score = 60
title = 'nineteenth century in print periodicals volume list'

distance = 878
spam score = 49
title = 'nineteenth century in print periodicals volume list'

distance = 882
spam score = 55
title = 'nineteenth century in print periodicals volume list'

distance = 903
spam score = 51
title = 'nineteenth century in print periodicals volume list'

distance = 906
spam score = 65
title = 'nineteenth century in print periodicals volume list'

distance = 909
spam score = 63
title = 'nineteenth century in print periodicals volume list'

distance = 916
spam score = 56
title = 'nineteenth century in print periodicals volume list'

distance = 937
spam score = 50
title = 'nineteenth century in print periodicals volume list'

distance = 938
spam score = 47
title = 'nineteenth century in print periodicals volume list'

distance = 1006
spam score = 54
title = 'nineteenth century in print periodicals volume list'

distance = 1034
spam score = 65
title = 'nineteenth century in print periodicals volume list'

distance = 1045
spam score = 57
title = 'nineteenth century in print periodicals volume list'

distance = 1384
spam score = 85
title = 'special education ims'

distance = 1395
spam score = 85
title = 'special education ims'

distance = 1395
spam score = 86
title = 'special education ims'

distance = 1395
spam score = 85
title = 'special education ims'

distance = 1395
spam score = 86
title = 'special education ims'

distance = 1397
spam score = 85
title = 'special education ims'

distance = 1397
spam score = 86
title = 'special education ims'

distance = 1397
spam score = 86
title = 'special education ims'

distance = 1397
spam score = 87
title = 'special education ims'

distance = 1398
spam score = 84
title = 'special education ims'

distance = 1398
spam score = 83
title = 'special education ims'

distance = 1401
spam score = 89
title = 'special education ims'

distance = 1403
spam score = 90
title = 'special education ims'

distance = 1404
spam score = 84
title = 'special education ims'

distance = 1404
spam score = 87
title = 'special education ims'

distance = 1405
spam score = 86
title = 'special education ims'

distance = 1407
spam score = 86
title = 'special education ims'

distance = 1413
spam score = 86
title = 'special education ims'

distance = 1859
spam score = 12
title = 'lntube365 idina menzel all of the above'

distance = 932
spam score = 24
title = ''

distance = 949
spam score = 94
title = ''

distance = 263
spam score = 47
title = 'indexratetrdagytrd'

distance = 266
spam score = 45
title = 'indexratetrdagytrd'

distance = 269
spam score = 53
title = 'indexratetrdagytrd'

distance = 270
spam score = 47
title = 'indexratetrdagytrd'

distance = 270
spam score = 50
title = 'indexratetrdagytrd'

distance = 270
spam score = 52
title = 'indexratetrdagytrd'

distance = 272
spam score = 46
title = 'indexratetrdagytrd'

distance = 273
spam score = 48
title = 'indexratetrdagytrd'

distance = 273
spam score = 44
title = 'indexratetrdagytrd'

distance = 273
spam score = 50
title = 'indexratetrdagytrd'

distance = 274
spam score = 54
title = 'indexratetrdagytrd'

distance = 276
spam score = 46
title = 'indexratetrdagytrd'

distance = 276
spam score = 48
title = 'indexratetrdagytrd'

distance = 278
spam score = 47
title = 'indexratetrdagytrd'

distance = 280
spam score = 46
title = 'indexratetrdagytrd'

distance = 282
spam score = 49
title = 'indexratetrdagytrd'

distance = 283
spam score = 50
title = 'indexratetrdagytrd'

distance = 283
spam score = 47
title = 'indexratetrdagytrd'

distance = 283
spam score = 49
title = 'indexratetrdagytrd'

distance = 284
spam score = 47
title = 'indexratetrdagytrd'

distance = 311
spam score = 46
title = 'indexratetrdagytrd'

distance = 311
spam score = 39
title = 'profiletrdagytrd'

distance = 311
spam score = 48
title = 'indexratetrdagytrd'

distance = 312
spam score = 49
title = 'indexratetrdagytrd'

distance = 312
spam score = 53
title = 'indexratetrdagytrd'

distance = 312
spam score = 53
title = 'indexratetrdagytrd'

distance = 313
spam score = 49
title = 'indexratetrdagytrd'

distance = 314
spam score = 47
title = 'indexratetrdagytrd'

distance = 314
spam score = 37
title = 'profiletrdagytrd'

distance = 316
spam score = 41
title = 'profiletrdagytrd'

distance = 325
spam score = 44
title = 'profiletrdagytrd'

distance = 325
spam score = 38
title = 'profiletrdagytrd'

distance = 325
spam score = 55
title = 'indexratetrdagytrd'

distance = 325
spam score = 52
title = 'indexratetrdagytrd'

distance = 325
spam score = 54
title = 'indexratetrdagytrd'

distance = 326
spam score = 54
title = 'indexratetrdagytrd'

distance = 326
spam score = 40
title = 'profiletrdagytrd'

distance = 326
spam score = 45
title = 'profiletrdagytrd'

distance = 327
spam score = 41
title = 'profiletrdagytrd'

distance = 327
spam score = 44
title = 'profiletrdagytrd'

distance = 338
spam score = 45
title = 'profiletrdagytrd'

distance = 338
spam score = 43
title = 'profiletrdagytrd'

distance = 338
spam score = 43
title = 'profiletrdagytrd'

distance = 339
spam score = 56
title = 'indexratetrdagytrd'

distance = 339
spam score = 46
title = 'profiletrdagytrd'

distance = 339
spam score = 47
title = 'profiletrdagytrd'

distance = 339
spam score = 40
title = 'profiletrdagytrd'

distance = 339
spam score = 48
title = 'indexratetrdagytrd'

distance = 339
spam score = 42
title = 'profiletrdagytrd'

distance = 339
spam score = 42
title = 'profiletrdagytrd'

distance = 353
spam score = 45
title = 'profiletrdagytrd'

distance = 353
spam score = 47
title = 'profiletrdagytrd'

distance = 354
spam score = 45
title = 'profiletrdagytrd'

distance = 354
spam score = 43
title = 'profiletrdagytrd'

distance = 354
spam score = 43
title = 'profiletrdagytrd'

distance = 354
spam score = 40
title = 'profiletrdagytrd'

distance = 356
spam score = 48
title = 'indexratetrdagytrd'

distance = 356
spam score = 46
title = 'profiletrdagytrd'

distance = 360
spam score = 43
title = 'indexratetrdagytrd'

distance = 362
spam score = 43
title = 'profiletrdagytrd'

distance = 1079
spam score = 42
title = 'indexoffclragy0102'

distance = 1101
spam score = 51
title = 'indexoffclragy0304'

distance = 1198
spam score = 47
title = 'arrests'

distance = 1207
spam score = 41
title = 'arrests'

distance = 1207
spam score = 35
title = 'arrests'

distance = 1209
spam score = 36
title = 'arrests'

distance = 1209
spam score = 40
title = 'arrests'

distance = 1210
spam score = 41
title = 'arrests'

distance = 1211
spam score = 42
title = 'arrests'

distance = 1212
spam score = 44
title = 'arrests'

distance = 1236
spam score = 40
title = 'arrests'

distance = 1238
spam score = 36
title = 'arrests'

distance = 1239
spam score = 63
title = 'index of crime us and new york metropolitan statistical area'

distance = 1240
spam score = 38
title = 'arrests'

distance = 1240
spam score = 38
title = 'arrests'

distance = 1241
spam score = 63
title = 'arrests'

distance = 1244
spam score = 39
title = 'arrests'

distance = 1249
spam score = 36
title = 'arrests'

distance = 1251
spam score = 36
title = 'arrests'

distance = 1288
spam score = 36
title = 'arrests'

distance = 1417
spam score = 66
title = 'table 11 missouri crime in the united states 2006'

distance = 1423
spam score = 40
title = 'ojjdp bulletin august 2005 juvenile arrests 2003'

distance = 1423
spam score = 65
title = 'table 8 district of columbia crime in the united states 2006'

distance = 1424
spam score = 38
title = 'ojjdp bulletin september 2004 juvenile arrests 2002'

distance = 1424
spam score = 42
title = 'ojjdp bulletin december 2003 juvenile arrests 2001'

distance = 1428
spam score = 53
title = 'table 8 district of columbia crime in the united states 2007'

distance = 1430
spam score = 56
title = 'table 8 hawaii crime in the united states 2007'

distance = 1432
spam score = 67
title = 'table 11 puerto rico and other outlying areas crime in the united states 2006'

distance = 1433
spam score = 33
title = 'federal judicial court districts'

distance = 1435
spam score = 65
title = 'table 8 hawaii crime in the united states 2006'

distance = 1504
spam score = 55
title = 'table 8 delaware crime in the united states 2006'

distance = 1505
spam score = 36
title = 'ojjdp bulletin december 2006 juvenile arrests 2004'

distance = 1507
spam score = 60
title = 'ojjdp bulletin july 2004 victims of violent juvenile crime'

distance = 1510
spam score = 49
title = 'table 8 montana crime in the united states 2007'

distance = 1511
spam score = 47
title = 'san juan county partnership community databank'

distance = 1511
spam score = 43
title = 'arroffadtjuvco9900'

distance = 1515
spam score = 71
title = 'larcenytheft crime in the united states 2005'

distance = 1516
spam score = 42
title = 'indexoffarsontyptrd'

distance = 1517
spam score = 50
title = 'table 8 rhode island crime in the united states 2006'

distance = 1520
spam score = 45
title = 'table 8 idaho crime in the united states 2006'

distance = 1592
spam score = 51
title = 'portlandmaps'

distance = 1595
spam score = 71
title = 'ltgnocdcgtstnbspjohn thenbspbaptist parish public safety'

distance = 1600
spam score = 68
title = 'ltgnocdcgttangipahoa parish public safety'

distance = 1611
spam score = 31
title = 'monitronics shield security security systems polk county winter haven lakeland'

distance = 1620
spam score = 83
title = 'violence and abuse'

distance = 1626
spam score = 48
title = 'ojjdp national report series bulletin december 2001 law enforcement and juvenile crime'

distance = 1637
spam score = 66
title = 'montana board of crime control'

distance = 1661
spam score = 53
title = 'community health information project'

distance = 1701
spam score = 31
title = ''

distance = 551
spam score = 50
title = ''

distance = 554
spam score = 46
title = ''

distance = 554
spam score = 47
title = ''

distance = 555
spam score = 49
title = ''

distance = 556
spam score = 49
title = ''

distance = 562
spam score = 49
title = ''

distance = 669
spam score = 51
title = ''

distance = 669
spam score = 50
title = ''

distance = 669
spam score = 49
title = ''

distance = 673
spam score = 49
title = ''

distance = 673
spam score = 52
title = ''

distance = 673
spam score = 52
title = ''

distance = 841
spam score = 68
title = ''

distance = 841
spam score = 48
title = ''

distance = 841
spam score = 63
title = ''

distance = 844
spam score = 62
title = ''

distance = 846
spam score = 48
title = ''

distance = 846
spam score = 58
title = ''

distance = 996
spam score = 51
title = ''

distance = 996
spam score = 51
title = ''

distance = 997
spam score = 45
title = ''

distance = 999
spam score = 47
title = ''

distance = 1080
spam score = 46
title = ''

distance = 1080
spam score = 43
title = ''

distance = 1082
spam score = 43
title = ''

distance = 1082
spam score = 41
title = ''

distance = 1082
spam score = 42
title = ''

distance = 1466
spam score = 81
title = ''

distance = 1475
spam score = 59
title = ''

distance = 1520
spam score = 75
title = ''

distance = 1546
spam score = 68
title = ''

distance = 444
spam score = 61
title = ''

distance = 508
spam score = 48
title = ''

distance = 579
spam score = 55
title = ''

distance = 681
spam score = 64
title = ''

distance = 726
spam score = 47
title = ''

distance = 930
spam score = 40
title = ''

distance = 1075
spam score = 47
title = ''

distance = 1836
spam score = 74
title = ''

distance = 504
spam score = 53
title = 'econpapers what makes the modelspolicy interaction successful'

distance = 537
spam score = 34
title = 'econpapers control theory with applications to economics'

distance = 541
spam score = 36
title = 'econpapers the agricultural transformation'

distance = 542
spam score = 32
title = 'econpapers foreign public capital flows'

distance = 544
spam score = 45
title = 'econpapers search'

distance = 545
spam score = 38
title = 'econpapers modelling capital expenditure'

distance = 546
spam score = 37
title = 'econpapers dynamical systems with applications to economics'

distance = 547
spam score = 36
title = 'econpapers on sabotage in collective tournaments'

distance = 549
spam score = 35
title = 'econpapers a mathematics teacher'

distance = 549
spam score = 40
title = 'econpapers oligopoly theory'

distance = 550
spam score = 37
title = 'econpapers measure theory with applications to economics'

distance = 554
spam score = 46
title = 'econpapers orange light for the competitive model'

distance = 557
spam score = 43
title = 'econpapers asset inequality over the life cycle'

distance = 560
spam score = 59
title = 'econpapers individual learning in different social contexts'

distance = 562
spam score = 29
title = 'econpapers taxation for developing countries'

distance = 565
spam score = 39
title = 'econpapers overlapping generations'

distance = 570
spam score = 33
title = 'econpapers shortrun macroeconomics'

distance = 576
spam score = 43
title = 'econpapers social choice'

distance = 580
spam score = 46
title = 'econpapers the theory of optimal taxation'

distance = 581
spam score = 49
title = 'econpapers a note on mechanization and wage bargaining'

distance = 701
spam score = 35
title = 'econpapers subscriber churn in the australian isp market'

distance = 703
spam score = 24
title = 'econpapers quantitative restrictions in experimental postedoffer markets'

distance = 703
spam score = 34
title = 'econpapers the effects of bonus systems on firm performance in taiwans hightech sector'

distance = 704
spam score = 45
title = 'econpapers production economics of farming in relation to land reconstruction can we use or in this field'

distance = 705
spam score = 39
title = 'econpapers thinking rigorously about future costs in cost effectiveness analysis'

distance = 705
spam score = 39
title = 'econpapers managing currency risksbuy or sell forward'

distance = 706
spam score = 25
title = 'econpapers selfcentered fairness in games with more than two players'

distance = 706
spam score = 30
title = 'econpapers spiteful behavior in voluntary contribution mechanism experiments'

distance = 706
spam score = 34
title = 'econpapers a method for evaluating the excess burden associated with characteristics of the goods'

distance = 706
spam score = 35
title = 'econpapers dynamics of sticky information and sticky price models in a new keynesian dsge framework'

distance = 775
spam score = 41
title = 'econpapers urban transportation'

distance = 777
spam score = 47
title = 'econpapers effective and economical productionplanning and control the costeffectiveness approach to select productionplanning and control systems'

distance = 777
spam score = 34
title = 'econpapers optimisation of field machinery for an arable farm converting to organic farming'

distance = 777
spam score = 29
title = 'econpapers constrained labor supply and riskaversion'

distance = 777
spam score = 29
title = 'econpapers threeway experimental election results strategic voting coordinated outcomes and duvergers law'

distance = 778
spam score = 42
title = 'econpapers the measurement of productivity and scarcity rents the case of asbestos in canada'

distance = 779
spam score = 50
title = 'econpapers reflections on growth theory'

distance = 779
spam score = 34
title = 'econpapers contagion in global equity markets in 1998 the effects of the russian and ltcm crises'

distance = 780
spam score = 31
title = 'econpapers information technology organizational form and transition to the market'

distance = 782
spam score = 42
title = 'econpapers a family of inventory models with demand met either from stock or by special production runs'

distance = 846
spam score = 54
title = 'econpapers historical perspectives on us economic geography'

distance = 846
spam score = 45
title = 'econpapers voluntary disclosure under imperfect competition experimental evidence'

distance = 846
spam score = 35
title = 'econpapers the timevarying policy neutral rate in realtime a predictor for future inflation'

distance = 846
spam score = 32
title = 'econpapers deadlines and distractions'

distance = 848
spam score = 34
title = 'econpapers climatic information and decisionmaking in maize crop production systems of the argentinean pampas'

distance = 851
spam score = 48
title = 'econpapers trends in sizes and structures of urban areas'

distance = 851
spam score = 31
title = 'econpapers row configuration in rainfed cotton systems modification of the ozcot simulation model'

distance = 853
spam score = 40
title = 'econpapers efficiency in index options markets and trading in stock baskets'

distance = 854
spam score = 34
title = 'econpapers maize yield potential critical processes and simulation modeling in a highyielding environment'

distance = 854
spam score = 42
title = 'econpapers managing capital expenditures for construction projects kenneth m guthrie published by craftsman book company solana beach ca 1977 624 pages 3000'

distance = 931
spam score = 46
title = 'econpapers technical regulations and specialization in international trade'

distance = 934
spam score = 38
title = 'econpapers a repeated coalitional bargaining model'

distance = 935
spam score = 54
title = 'econpapers chapter 11 technological change and the environment'

distance = 937
spam score = 55
title = 'econpapers microfoundations of urban agglomeration economies'

distance = 938
spam score = 65
title = 'econpapers writing and teaching national history in africa in an era of global history'

distance = 939
spam score = 69
title = 'econpapers mozambiques tainted parliamentary and presidential elections december 2004'

distance = 940
spam score = 32
title = 'econpapers modeling the effect of abrupt changes in nitrogen availability on lettuce growth rootshoot partitioning and nitrate concentration'

distance = 942
spam score = 35
title = 'econpapers closedform solutions to stochastic process switching problems'

distance = 942
spam score = 44
title = 'econpapers terrorism theory and applications'

distance = 944
spam score = 34
title = 'econpapers agronomic handbook management of crops soils and their fertility jb jones jr crc boca raton 2003 450 pages hardback isbn 0849308976 us9995'

distance = 997
spam score = 46
title = 'econpapers hans langeveld and niels rling editors changing european farming systems for a better future new visions for rural areas wageningen academic publishers wageningen the netherlands 2006 480 pp us10700 hardback isbn13 9789086860029'

distance = 997
spam score = 37
title = 'econpapers epistics a dynamic model to generate nitrogen fertilisation and irrigation schedules in apple orchards with special attention to qualitative evaluation of the model'

distance = 997
spam score = 72
title = 'econpapers structural change in agriculture in the canton of zurich assessing development predicted in 1995'

distance = 1001
spam score = 52
title = 'econpapers capacity constraints asymmetries and the business cycle'

distance = 1001
spam score = 30
title = 'econpapers cooperatives as the enfants terribles of economics some implications for the social economy'

distance = 1002
spam score = 37
title = 'econpapers james anthony lawson on commercial panics and their recurrence'

distance = 1003
spam score = 31
title = 'econpapers testing for unit roots in threedimensional heterogeneous panels in the presence of crosssectional dependence'

distance = 1003
spam score = 50
title = 'econpapers population poverty and the natural environment'

distance = 1004
spam score = 34
title = 'econpapers a quantitative and constraintspecific method to assess the potential impact of new agricultural technology the case of frost resistant potato for the altiplano peru and bolivia'

distance = 1005
spam score = 70
title = 'econpapers lake kivus methane gas natural risk or source of energy and political security'

distance = 1060
spam score = 53
title = 'econpapers explaining crosscountry income differences'

distance = 1064
spam score = 33
title = 'econpapers political polarization and the electoral effects of media bias'

distance = 1065
spam score = 32
title = 'econpapers measuring immigrations effects on labor demand a reexamination of the mariel boatlift'

distance = 1066
spam score = 39
title = 'econpapers growth theory through the lens of development economics'

distance = 1067
spam score = 44
title = 'econpapers dynamics in innovation systems evidence from japans game software industry'

distance = 1067
spam score = 53
title = 'econpapers the system of payment settlements in the european union'

distance = 1068
spam score = 61
title = 'econpapers umgang externer akteure mit der neuen friedens und sicherheitsarchitektur afrikas'

distance = 1068
spam score = 43
title = 'econpapers handbook of econometrics vol 2'

distance = 1069
spam score = 49
title = 'econpapers training under changes in public sectoreastern european perspectives'

distance = 1069
spam score = 56
title = 'econpapers handbook of defense economics'

distance = 1123
spam score = 40
title = 'econpapers a revisit on dissecting the ppp puzzle evidence from a nonlinear approach'

distance = 1123
spam score = 32
title = 'econpapers energyincome causality in oecd countries revisited the key role of capital stock'

distance = 1124
spam score = 30
title = 'econpapers is training more frequent when the wage premium is smaller evidence from the european community household panel'

distance = 1125
spam score = 71
title = 'econpapers indikatoren einer nachhaltigen kommunalen entwicklung in den grostdten afrikas das beispiel dakar'

distance = 1126
spam score = 48
title = 'econpapers dvaluation et autosuffisance alimentaire le cas de la filire riz en cte divoire'

distance = 1127
spam score = 17
title = 'econpapers journal of policy modeling'

distance = 1128
spam score = 45
title = 'econpapers community initiatives in building and managing temporary checkdams across seasonal streams for water harvesting in south india'

distance = 1130
spam score = 40
title = 'econpapers prioritizing cultural competence in the implementation of an evidencebased practice model'

distance = 1130
spam score = 36
title = 'econpapers too many theories too few facts what the data tell us about the link between span of control compensation and career dynamics'

distance = 1132
spam score = 56
title = 'econpapers punish once or punish twice a theory of the use of criminal sanctions in addition to regulatory penalties'

distance = 1196
spam score = 47
title = 'econpapers the consolidation on banking supervision in the context of a pan european banking system'

distance = 1198
spam score = 67
title = 'econpapers cricketsim a genetic and evolutionary computer simulation'

distance = 1199
spam score = 76
title = 'econpapers nigerias manifest destiny in west africa dominance without power'

distance = 1203
spam score = 36
title = 'econpapers ex interim voting an experimental study of referendums for publicgood provision'

distance = 1208
spam score = 80
title = 'econpapers productivity of refugee camps social and political dynamics from the somalilandethiopia border 19882001'

distance = 1209
spam score = 74
title = 'econpapers a model to test how diversity affects resilience in regional innovation networks'

distance = 1209
spam score = 35
title = 'econpapers mobility and stability the dynamics of job change in labor markets'

distance = 1209
spam score = 61
title = 'econpapers the new economy information aspect'

distance = 1209
spam score = 54
title = 'econpapers optimal management of molds in stored corn'

distance = 1217
spam score = 56
title = 'econpapers is religion an evolutionary adaptation'

distance = 1404
spam score = 53
title = 'econpapers ring dike system to harness floodwater from the mekong river for paddy rice cultivation in the tonle sap lake floodplain in cambodia'

distance = 1405
spam score = 49
title = 'econpapers energy requirements for transport and surface application of liquid pig manure in manitoba canada'

distance = 1500
spam score = 37
title = 'econpapers pasture and forage crop systems for nonirrigated dairy farms in southern australia 2 interannual variation in forage supply and business risk'

distance = 1526
spam score = 69
title = 'econpapers emergent community structure in social tagging systems'

distance = 621
spam score = 65
title = 'em3 embedded system module with mpc8560 systemonmodules products men mikro elektronik'

distance = 632
spam score = 65
title = 'em1n embedded system module with mpc5200b systemonmodules products men mikro elektronik'

distance = 644
spam score = 66
title = 'em9 embedded system module with mpc8548 systemonmodules products men mikro elektronik'

distance = 661
spam score = 55
title = 'b202s 3u vmebus mmodule carrier board vmebus products men mikro elektronik'

distance = 667
spam score = 65
title = 'em8 embedded system module with mpc8540 systemonmodules products men mikro elektronik'

distance = 673
spam score = 70
title = 'em9 embedded system module with mpc8548 pc104 products men mikro elektronik'

distance = 673
spam score = 65
title = 'em3 embedded system module with mpc8560 pc104 products men mikro elektronik'

distance = 682
spam score = 68
title = 'em1n embedded system module with mpc5200b pc104 products men mikro elektronik'

distance = 684
spam score = 64
title = 'em8a embedded system module with mpc8540 pc104 products men mikro elektronik'

distance = 690
spam score = 62
title = '3u 12hp psu for 19 systems 66154v systems amp components products men mikro elektronik'

distance = 692
spam score = 67
title = 'em1 embedded system module with mpc5200 pc104 products men mikro elektronik'

distance = 695
spam score = 56
title = 'a201s 6u vmebus mmodule carrier board vmebus products men mikro elektronik'

distance = 698
spam score = 67
title = '3u 8hp psu for 19 systems 936v systems amp components products men mikro elektronik'

distance = 703
spam score = 62
title = '16z025uart uart controller products men mikro elektronik'

distance = 703
spam score = 68
title = 'em8 embedded system module with mpc8540 pc104 products men mikro elektronik'

distance = 706
spam score = 64
title = '16z025uart uart controller products men mikro elektronik'

distance = 708
spam score = 64
title = '3u 8hp psu for 19 systems 36154v systems amp components products men mikro elektronik'

distance = 711
spam score = 51
title = '16z034gpio gpio controller products men mikro elektronik'

distance = 711
spam score = 56
title = '16z029can can controller products men mikro elektronik'

distance = 715
spam score = 66
title = '3u 12hp psu for 19 systems 66154v systems amp components products men mikro elektronik'

distance = 799
spam score = 67
title = 'ad67 6u io extension for a12 a15 d3 sc13 vmebus products men mikro elektronik'

distance = 800
spam score = 71
title = 'sa22 ibis saadapter products men mikro elektronik'

distance = 800
spam score = 65
title = 'm72 motion counter mmodule mezzanines products men mikro elektronik'

distance = 802
spam score = 65
title = 'm199 usm main mmodule mmodule mezzanines products men mikro elektronik'

distance = 805
spam score = 65
title = 'cpci rack 07010030 6 slots double euro systems amp components products men mikro elektronik'

distance = 806
spam score = 67
title = 'm97 universal counter mmodule mezzanines products men mikro elektronik'

distance = 806
spam score = 63
title = '3u 12hp psu for 19 systems 66154v compactpciplus products men mikro elektronik'

distance = 807
spam score = 67
title = 'vme64 rack 07000012 8 slots double euro systems amp components products men mikro elektronik'

distance = 807
spam score = 62
title = '3u 8hp psu for 19 systems 36154v compactpciplus products men mikro elektronik'

distance = 809
spam score = 60
title = 'sa15 digital io saadapter products men mikro elektronik'

distance = 843
spam score = 68
title = 'em1a embedded system module with mpc5200b systemonmodules products men mikro elektronik'

distance = 843
spam score = 58
title = 'a15c 6u vme64 mpc8245 sbc pmc vmebus products men mikro elektronik'

distance = 844
spam score = 83
title = 'a201s 6u vmebus mmodule carrier board vmebus products men mikro elektronik'

distance = 844
spam score = 59
title = 'em8 embedded system module with mpc8540 systemonmodules products men mikro elektronik'

distance = 845
spam score = 62
title = 'em1 embedded system module with mpc5200 systemonmodules products men mikro elektronik'

distance = 846
spam score = 63
title = 'sf4 3u unmanaged 8port ethernet switch with m12 ethernet switches products men mikro elektronik'

distance = 846
spam score = 65
title = 'xc1 esmexpress evaluation carrier board atx systemonmodules products men mikro elektronik'

distance = 848
spam score = 64
title = 'sf3 3u managed 8port ethernet switch with m12 ethernet switches products men mikro elektronik'

distance = 849
spam score = 70
title = 'c205 pci mezzanine test adapter io boards products men mikro elektronik'

distance = 850
spam score = 64
title = 'm56 16channel analog multiplexer mmodule mezzanines products men mikro elektronik'

distance = 885
spam score = 66
title = 'em3 embedded system module with mpc8560 pc104 products men mikro elektronik'

distance = 886
spam score = 64
title = 'f207 3u compactpci pci104 carrier board pc104 products men mikro elektronik'

distance = 887
spam score = 68
title = 'em3a embedded system module with mpc8560 pc104 products men mikro elektronik'

distance = 887
spam score = 59
title = 'd202 6u compactpci pcmip carrier board pmc xmc pcmip products men mikro elektronik'

distance = 888
spam score = 70
title = 'ae12 esmexpress module to com express carrier adapter systemonmodules products men mikro elektronik'

distance = 888
spam score = 56
title = 'f12n 3u compactpci mpc5200b sbc compactpciplus products men mikro elektronik'

distance = 888
spam score = 75
title = 'cpci rack 07010030 6 slots double euro systems amp components products men mikro elektronik'

distance = 889
spam score = 70
title = 'ae12 esmexpress module to com express carrier adapter systemonmodules products men mikro elektronik'

distance = 890
spam score = 62
title = 'm199 usm main mmodule mmodule mezzanines products men mikro elektronik'

distance = 891
spam score = 70
title = 'cpci desktop 07010046 3 slots single euro systems amp components products men mikro elektronik'

distance = 917
spam score = 68
title = 'sa15 digital io saadapter products men mikro elektronik'

distance = 919
spam score = 62
title = 'cpci rack 07010021 8 slots single euro compactpciplus products men mikro elektronik'

distance = 919
spam score = 63
title = 'kahlua box industrial control system busless amp standalone products men mikro elektronik'

distance = 921
spam score = 84
title = 'f203 3u compactpci pcmip carrier board pmc xmc pcmip products men mikro elektronik'

distance = 922
spam score = 65
title = 'm199 usm main mmodule mmodule mezzanines products men mikro elektronik'

distance = 922
spam score = 65
title = 'p602 quad redundant gigabit ethernet xmc pmc xmc pcmip products men mikro elektronik'

distance = 923
spam score = 65
title = 'p599 usm main pmc io boards products men mikro elektronik'

distance = 925
spam score = 65
title = 'm68 4channel function waveform generator mmodule mezzanines products men mikro elektronik'

distance = 925
spam score = 77
title = 'kahlua box industrial control system systems amp components products men mikro elektronik'

distance = 926
spam score = 67
title = 'kahlua box industrial control system systems amp components products men mikro elektronik'

distance = 942
spam score = 69
title = 'sf2 3u managed 8port ethernet switch with rj45 ethernet switches products men mikro elektronik'

distance = 943
spam score = 78
title = 'm16 4channel data acquisition mmodule mezzanines products men mikro elektronik'

distance = 943
spam score = 70
title = 'a15b 6u vme64 mpc8245 sbc mmodule vmebus products men mikro elektronik'

distance = 944
spam score = 69
title = 'em1a embedded system module with mpc5200b pc104 products men mikro elektronik'

distance = 945
spam score = 66
title = '3u 8hp psu for 19 systems 1872v compactpciplus products men mikro elektronik'

distance = 946
spam score = 65
title = 'em1 embedded system module with mpc5200 systemonmodules products men mikro elektronik'

distance = 947
spam score = 72
title = 'f700 3u compactpci express xmcpmc carrier pmc xmc pcmip products men mikro elektronik'

distance = 948
spam score = 63
title = 'em8 embedded system module with mpc8540 pc104 products men mikro elektronik'

distance = 949
spam score = 61
title = 'kahlua box industrial control system busless amp standalone products men mikro elektronik'

distance = 949
spam score = 69
title = 'm63 3216bit binary data acquisitiongeneration io boards products men mikro elektronik'

distance = 986
spam score = 65
title = 'm67 1channel digital oscilloscope mmodule mezzanines products men mikro elektronik'

distance = 987
spam score = 62
title = 'a12a 6u vmebus mpc8245 sbc pcmip vmebus products men mikro elektronik'

distance = 990
spam score = 74
title = 'ae12 esmexpress module to com express carrier adapter systemonmodules products men mikro elektronik'

distance = 991
spam score = 87
title = 'p599 usm main pmc pmc xmc pcmip products men mikro elektronik'

distance = 991
spam score = 66
title = 'p14 pcmip firewire controller pmc xmc pcmip products men mikro elektronik'

distance = 998
spam score = 69
title = 'm63 3216bit binary data acquisitiongeneration mmodule mezzanines products men mikro elektronik'

distance = 998
spam score = 65
title = 'ek5n esm starter kit with em7n pentium iii busless amp standalone products men mikro elektronik'

distance = 1000
spam score = 65
title = 'p5 pcmip intelligent can interface pmc xmc pcmip products men mikro elektronik'

distance = 1002
spam score = 67
title = 'ek5n esm starter kit with em7n pentium iii systemonmodules products men mikro elektronik'

distance = 1002
spam score = 71
title = 'm67 1channel digital oscilloscope io boards products men mikro elektronik'

distance = 1052
spam score = 67
title = 'em4n embedded system module with mpc8245 systemonmodules products men mikro elektronik'

distance = 1056
spam score = 70
title = 'sf1 3u unmanaged 8port ethernet switch with rj45 ethernet switches products men mikro elektronik'

distance = 1056
spam score = 72
title = 'f205 3u compactpci mmodules carrier board compactpciplus products men mikro elektronik'

distance = 1057
spam score = 70
title = 'p601 quad redundant gigabit ethernet xmc pmc xmc pcmip products men mikro elektronik'

distance = 1057
spam score = 70
title = 'ubox rugged embedded or panel computer busless amp standalone products men mikro elektronik'

distance = 1058
spam score = 63
title = 'm56 16channel analog multiplexer mmodule mezzanines products men mikro elektronik'

distance = 1059
spam score = 61
title = 'd700 mezzanine card for d9 a19 compactpciplus products men mikro elektronik'

distance = 1060
spam score = 71
title = 'a15c 6u vme64 mpc8245 sbc pmc vmebus products men mikro elektronik'

distance = 1065
spam score = 79
title = 'sf1 3u unmanaged 8port ethernet switch with rj45 ethernet switches products men mikro elektronik'

distance = 1067
spam score = 72
title = 'cpci rack 07010030 6 slots double euro systems amp components products men mikro elektronik'

distance = 1123
spam score = 78
title = 'sf3 3u managed 8port ethernet switch with m12 ethernet switches products men mikro elektronik'

distance = 1124
spam score = 68
title = 'f302 3u compactpci managed 81port eth switch ethernet switches products men mikro elektronik'

distance = 1124
spam score = 57
title = 'm8 iec bus controller mmodule mezzanines products men mikro elektronik'

distance = 1124
spam score = 72
title = 'cpci rack 07010021 8 slots single euro systems amp components products men mikro elektronik'

distance = 1127
spam score = 73
title = 'xc2 esmexpress carrier board for intelligent displays systemonmodules products men mikro elektronik'

distance = 1128
spam score = 80
title = 'p15 pcmip nonvolatile sram pmc xmc pcmip products men mikro elektronik'

distance = 1134
spam score = 77
title = 'sf1 3u unmanaged 8port ethernet switch with rj45 ethernet switches products men mikro elektronik'

distance = 1135
spam score = 57
title = 'p5 pcmip intelligent can interface pmc xmc pcmip products men mikro elektronik'

distance = 1135
spam score = 70
title = 'm76 digital multimeter mmodule mezzanines products men mikro elektronik'

distance = 1136
spam score = 73
title = 'm70 temperature acquisition mmodule mezzanines products men mikro elektronik'

distance = 1651
spam score = 64
title = 'alaris products products and services cardinal health'

distance = 1661
spam score = 61
title = 'alaris products products and services cardinal health'

distance = 1689
spam score = 79
title = 'resuscitation of frozen cells'

distance = 313
spam score = 46
title = ''

distance = 315
spam score = 52
title = ''

distance = 320
spam score = 47
title = ''

distance = 323
spam score = 43
title = ''

distance = 329
spam score = 47
title = ''

distance = 331
spam score = 51
title = ''

distance = 331
spam score = 51
title = ''

distance = 334
spam score = 47
title = ''

distance = 336
spam score = 47
title = ''

distance = 340
spam score = 44
title = ''

distance = 340
spam score = 47
title = ''

distance = 343
spam score = 43
title = ''

distance = 344
spam score = 44
title = ''

distance = 345
spam score = 44
title = ''

distance = 345
spam score = 44
title = ''

distance = 351
spam score = 50
title = ''

distance = 352
spam score = 43
title = ''

distance = 354
spam score = 51
title = ''

distance = 355
spam score = 44
title = ''

distance = 357
spam score = 43
title = ''

distance = 370
spam score = 46
title = ''

distance = 377
spam score = 46
title = ''

distance = 379
spam score = 43
title = ''

distance = 380
spam score = 43
title = ''

distance = 381
spam score = 43
title = ''

distance = 381
spam score = 45
title = ''

distance = 384
spam score = 43
title = ''

distance = 384
spam score = 47
title = ''

distance = 386
spam score = 43
title = ''

distance = 387
spam score = 46
title = ''

distance = 395
spam score = 44
title = ''

distance = 396
spam score = 47
title = ''

distance = 398
spam score = 45
title = ''

distance = 399
spam score = 46
title = ''

distance = 400
spam score = 45
title = ''

distance = 403
spam score = 47
title = ''

distance = 404
spam score = 46
title = ''

distance = 405
spam score = 47
title = ''

distance = 407
spam score = 42
title = ''

distance = 420
spam score = 45
title = ''

distance = 470
spam score = 42
title = ''

distance = 470
spam score = 44
title = ''

distance = 480
spam score = 43
title = ''

distance = 498
spam score = 47
title = ''

distance = 499
spam score = 46
title = ''

distance = 500
spam score = 44
title = ''

distance = 500
spam score = 44
title = ''

distance = 502
spam score = 46
title = ''

distance = 505
spam score = 44
title = ''

distance = 520
spam score = 43
title = ''

distance = 542
spam score = 46
title = ''

distance = 543
spam score = 47
title = ''

distance = 551
spam score = 43
title = ''

distance = 556
spam score = 45
title = ''

distance = 562
spam score = 45
title = ''

distance = 562
spam score = 51
title = ''

distance = 564
spam score = 46
title = ''

distance = 570
spam score = 45
title = ''

distance = 645
spam score = 46
title = ''

distance = 654
spam score = 44
title = ''

distance = 735
spam score = 46
title = ''

distance = 741
spam score = 43
title = ''

distance = 744
spam score = 43
title = ''

distance = 957
spam score = 40
title = ''

distance = 972
spam score = 45
title = ''

distance = 1039
spam score = 51
title = ''

distance = 1055
spam score = 43
title = ''

distance = 1067
spam score = 39
title = ''

distance = 1105
spam score = 41
title = ''

distance = 1111
spam score = 40
title = ''

distance = 1131
spam score = 51
title = ''

distance = 1131
spam score = 47
title = ''

distance = 1139
spam score = 49
title = ''

distance = 1140
spam score = 48
title = ''

distance = 1147
spam score = 59
title = ''

distance = 1258
spam score = 58
title = ''

distance = 1259
spam score = 58
title = ''

distance = 1261
spam score = 57
title = ''

distance = 1262
spam score = 57
title = ''

distance = 1262
spam score = 57
title = ''

distance = 1271
spam score = 60
title = ''

distance = 1271
spam score = 59
title = ''

distance = 1272
spam score = 62
title = ''

distance = 1275
spam score = 60
title = ''

distance = 1283
spam score = 61
title = ''

distance = 1346
spam score = 46
title = ''

distance = 1349
spam score = 63
title = ''

distance = 1354
spam score = 63
title = ''

distance = 1355
spam score = 63
title = ''

distance = 1359
spam score = 61
title = ''

distance = 1515
spam score = 37
title = ''

distance = 1517
spam score = 34
title = ''

distance = 1526
spam score = 37
title = ''

distance = 1562
spam score = 47
title = ''

distance = 1563
spam score = 33
title = ''

distance = 1564
spam score = 27
title = ''

distance = 1571
spam score = 28
title = ''

distance = 1576
spam score = 50
title = ''

distance = 1586
spam score = 52
title = ''

distance = 1588
spam score = 31
title = ''

distance = 1606
spam score = 49
title = ''

distance = 1608
spam score = 28
title = ''

distance = 1610
spam score = 47
title = ''

distance = 1618
spam score = 52
title = ''

distance = 1632
spam score = 37
title = ''

distance = 1639
spam score = 30
title = ''

distance = 1762
spam score = 35
title = ''

distance = 1843
spam score = 59
title = '3gpp2 specifications'

distance = 342
spam score = 39
title = 'entity ptyweight'

distance = 343
spam score = 40
title = 'entity ptycurrentdensity'

distance = 349
spam score = 37
title = 'entity ptyconductivity'

distance = 352
spam score = 35
title = 'entity ptyconductivity'

distance = 352
spam score = 41
title = 'entity ptycorrosionrate'

distance = 357
spam score = 38
title = 'entity ptyacousticpower'

distance = 361
spam score = 36
title = 'entity ptyacousticpower'

distance = 365
spam score = 38
title = 'entity ptyacousticenergy'

distance = 381
spam score = 36
title = 'entity ptyangularvelocity'

distance = 383
spam score = 39
title = 'entity ptyacousticintensity'

distance = 390
spam score = 38
title = 'entity ptyacousticintensity'

distance = 397
spam score = 38
title = 'entity ptyabsorbeddose'

distance = 398
spam score = 42
title = 'entity ptysalinity'

distance = 415
spam score = 41
title = 'entity ptyelectricpolarization'

distance = 422
spam score = 41
title = 'entity ptypourtemperature'

distance = 434
spam score = 39
title = 'entity ptyacousticimpedance'

distance = 436
spam score = 37
title = 'entity ptyacousticimpedance'

distance = 437
spam score = 41
title = 'entity ptyboilingtemperature'

distance = 438
spam score = 42
title = 'entity ptynaturalgasolinecontent'

distance = 439
spam score = 38
title = 'entity ptycapillarynumber'

distance = 487
spam score = 39
title = 'entity ptyequationofstateomegab'

distance = 487
spam score = 39
title = 'entity ptyequationofstateomegaa'

distance = 490
spam score = 37
title = 'entity ptymatrixdensity'

distance = 498
spam score = 42
title = 'entity ptycloudpointtemperature'

distance = 501
spam score = 42
title = 'entity ptyrefractiveindex'

distance = 505
spam score = 41
title = 'entity ptyacousticvelocity'

distance = 514
spam score = 39
title = 'entity ptyvolumefraction'

distance = 521
spam score = 38
title = 'entity ptygaswatersolubility'

distance = 522
spam score = 42
title = 'entity ptynetthickness'

distance = 522
spam score = 39
title = 'entity ptybinaryinteractioncoefficient'

distance = 540
spam score = 35
title = 'entity ptylandlegaldescription'

distance = 543
spam score = 45
title = 'entity ptydensitymolar'

distance = 553
spam score = 35
title = 'entity ptywatsoncharacterizationfactor'

distance = 554
spam score = 33
title = 'entity ptypyrolysiss0'

distance = 558
spam score = 34
title = 'entity ptybiotcoefficient'

distance = 558
spam score = 36
title = 'entity ptycementationfactor'

distance = 559
spam score = 30
title = 'entity ptybiotcoefficient'

distance = 559
spam score = 32
title = 'entity ptyaquiferlinearpenetration'

distance = 560
spam score = 37
title = 'entity ptycalorificvaluegasvolume'

distance = 560
spam score = 39
title = 'entity ptycalorificvaluegasvolume'

distance = 605
spam score = 39
title = 'entity ptybulkdensity'

distance = 606
spam score = 37
title = 'entity ptybulkdensity'

distance = 616
spam score = 39
title = 'entity ptycalorificvaluemassbasis'

distance = 627
spam score = 35
title = 'entity ptycationexchangecapacity'

distance = 628
spam score = 29
title = 'entity ptypyrolysiss1'

distance = 633
spam score = 39
title = 'entity ptypseudocompositionalalphafactor'

distance = 634
spam score = 34
title = 'entity ptyintervaltransittime'

distance = 636
spam score = 39
title = 'entity ptystratigraphicthickness'

distance = 638
spam score = 40
title = 'entity ptycapillarytransitionzoneheight'

distance = 638
spam score = 37
title = 'entity ptytotalorganicmatter'

distance = 665
spam score = 37
title = 'entity ptycalorificvaluemolebasis'

distance = 672
spam score = 34
title = 'entity ptyvitrinitereflectance'

distance = 716
spam score = 34
title = 'entity ptyspatialgammaradiationintensity'

distance = 762
spam score = 35
title = 'entity ptypyrolysishydrogenindex'

distance = 773
spam score = 38
title = 'entity ptyconodontcolor'

distance = 777
spam score = 36
title = 'entity ptypyrolysisoxygenindex'

distance = 779
spam score = 37
title = 'entity ptyconodontcolor'

distance = 805
spam score = 42
title = 'entity ptybulkvolumetotal'

distance = 844
spam score = 38
title = 'entity ptysporecolor'

distance = 950
spam score = 46
title = 'entity otherspatialobject'

distance = 1063
spam score = 46
title = 'entity contractclauseitem'

distance = 1118
spam score = 51
title = 'processdataitem'

distance = 1120
spam score = 40
title = 'entity isoline'

distance = 1120
spam score = 41
title = 'entity isoline'

distance = 1141
spam score = 39
title = 'entity fluidphasecomposition'

distance = 1142
spam score = 44
title = 'entity gridunstructured'

distance = 1143
spam score = 52
title = 'entity fluidphasecomposition'

distance = 1161
spam score = 50
title = 'entity regulationclause'

distance = 1167
spam score = 50
title = 'entity regulationclause'

distance = 1167
spam score = 32
title = 'entity ellipsoidalias'

distance = 1177
spam score = 35
title = 'entity temporalobjectalias'

distance = 1181
spam score = 45
title = 'datacollection'

distance = 1183
spam score = 34
title = 'entity temporalobjectalias'

distance = 1184
spam score = 51
title = 'entity contractalias'

distance = 1185
spam score = 36
title = 'entity contractalias'

distance = 1185
spam score = 38
title = 'entity inventoryobjectalias'

distance = 1185
spam score = 34
title = 'entity inventoryobjectalias'

distance = 1190
spam score = 39
title = 'entity imagepalette'

distance = 1193
spam score = 50
title = 'entity imagepalette'

distance = 1194
spam score = 37
title = 'entity seismographrecording'

distance = 1220
spam score = 39
title = 'entity grayscalepalette'

distance = 1226
spam score = 58
title = 'entity regulationreference'

distance = 1237
spam score = 36
title = 'entity logtracealias'

distance = 1239
spam score = 54
title = 'entity geologicprocesssequence'

distance = 1240
spam score = 42
title = 'entity geologicprocesssequence'

distance = 1245
spam score = 51
title = 'entity fluidphaseinterface'

distance = 1245
spam score = 33
title = 'entity stratigraphicmarkeralias'

distance = 1245
spam score = 36
title = 'entity stratigraphicmarkeralias'

distance = 1246
spam score = 46
title = 'entity gridstructured'

distance = 1250
spam score = 39
title = 'entity logtracealias'

distance = 1293
spam score = 50
title = 'entity cell'

distance = 1298
spam score = 37
title = 'entity pfnuperiodreport'

distance = 1299
spam score = 44
title = 'entity pfnuperiodreport'

distance = 1304
spam score = 56
title = 'graphicalelement'

distance = 1311
spam score = 50
title = 'entity areapatternfill'

distance = 1331
spam score = 33
title = 'entity grid1dparametric'

distance = 1346
spam score = 46
title = 'entity pfnugridcellconnection'

distance = 1347
spam score = 48
title = 'association'

distance = 1347
spam score = 54
title = 'entity pfnugridcellconnection'

distance = 1371
spam score = 37
title = 'entity rockfluidinteraction'

distance = 1467
spam score = 50
title = 'entity geocentriccoordinatesystem'

distance = 1470
spam score = 51
title = 'entity geocentriccoordinatesystem'

distance = 1500
spam score = 44
title = 'entity refpositionsystemidentifier'

distance = 1501
spam score = 67
title = 'entity refcoordinatesystemconstraint'

distance = 1507
spam score = 49
title = 'entity refclassificationsystem'

distance = 1510
spam score = 54
title = 'entity refcapillarypressure'

distance = 1512
spam score = 44
title = 'entity refclassificationsystem'

distance = 1555
spam score = 54
title = 'entity refcoordinatetransformconstraint'

distance = 1826
spam score = 38
title = ''

distance = 13
spam score = 72
title = 'data collection information'

distance = 18
spam score = 75
title = 'data collection information'

distance = 20
spam score = 71
title = 'data collection information'

distance = 20
spam score = 74
title = 'data collection information'

distance = 21
spam score = 71
title = 'data collection information'

distance = 24
spam score = 76
title = 'data collection information'

distance = 27
spam score = 72
title = 'data collection information'

distance = 30
spam score = 73
title = 'data collection information'

distance = 32
spam score = 72
title = 'data collection information'

distance = 41
spam score = 73
title = 'data collection information'

distance = 43
spam score = 69
title = 'data collection information'

distance = 53
spam score = 73
title = 'data collection information'

distance = 53
spam score = 71
title = 'data collection information'

distance = 61
spam score = 72
title = 'data collection information'

distance = 83
spam score = 75
title = 'data collection 11303101 treasurers and controllers'

distance = 99
spam score = 72
title = 'data collection 19405102 nuclear monitoring technicians'

distance = 99
spam score = 72
title = 'data collection 49302301 automotive master mechanics'

distance = 147
spam score = 68
title = 'data collection information'

distance = 172
spam score = 70
title = 'data collection information'

distance = 177
spam score = 71
title = 'data collection 51419400 tool grinders filers and sharpeners'

distance = 779
spam score = 71
title = 'tools amp technology 15106100 database administrators'

distance = 788
spam score = 67
title = 'tools amp technology 19203100 chemists'

distance = 801
spam score = 69
title = 'tools amp technology'

distance = 806
spam score = 68
title = 'indemand occupation'

distance = 807
spam score = 68
title = 'tools amp technology'

distance = 807
spam score = 68
title = 'tools amp technology'

distance = 812
spam score = 66
title = 'tools amp technology'

distance = 825
spam score = 65
title = 'tools amp technology'

distance = 830
spam score = 63
title = 'tools amp technology'

distance = 831
spam score = 69
title = 'indemand occupation'

distance = 861
spam score = 77
title = 'browse by onet descriptor'

distance = 864
spam score = 66
title = 'tools amp technology'

distance = 870
spam score = 77
title = 'tools amp technology'

distance = 874
spam score = 80
title = 'browse by onet descriptor'

distance = 874
spam score = 74
title = 'tools amp technology'

distance = 875
spam score = 62
title = 'tools amp technology 51404100 machinists'

distance = 875
spam score = 68
title = 'tools amp technology'

distance = 882
spam score = 86
title = 'information input'

distance = 885
spam score = 72
title = 'tools amp technology'

distance = 900
spam score = 60
title = 'tools amp technology 15107100 network and computer systems administrators'

distance = 920
spam score = 79
title = 'tools amp technology'

distance = 926
spam score = 74
title = 'indemand occupation'

distance = 929
spam score = 70
title = '55301500 command and control center specialists'

distance = 930
spam score = 79
title = 'onet code connector detailed information'

distance = 935
spam score = 67
title = 'tools amp technology'

distance = 941
spam score = 87
title = 'onet online help'

distance = 948
spam score = 78
title = 'indemand occupation'

distance = 952
spam score = 79
title = 'tools amp technology'

distance = 955
spam score = 62
title = 'tools amp technology 53202100 air traffic controllers'

distance = 966
spam score = 62
title = 'other indemand occupation'

distance = 992
spam score = 82
title = 'onet code connector detailed information'

distance = 994
spam score = 63
title = 'tools amp technology'

distance = 994
spam score = 85
title = 'onet code connector detailed information'

distance = 1000
spam score = 72
title = 'onet code connector detailed information'

distance = 1003
spam score = 77
title = 'onet code connector detailed information'

distance = 1004
spam score = 67
title = 'tools amp technology 17214100 mechanical engineers'

distance = 1006
spam score = 70
title = 'indemand occupation'

distance = 1007
spam score = 70
title = 'browse by onet descriptor'

distance = 1008
spam score = 64
title = 'onet code connector detailed information'

distance = 1013
spam score = 68
title = 'onet code connector detailed information'

distance = 1026
spam score = 61
title = 'tools amp technology 51401100 computercontrolled machine tool operators metal and plastic'

distance = 1033
spam score = 68
title = 'onet code connector detailed information'

distance = 1035
spam score = 84
title = 'summary report'

distance = 1041
spam score = 67
title = 'abilities far vision'

distance = 1044
spam score = 69
title = 'browse by onet descriptor'

distance = 1048
spam score = 74
title = 'onet code connector detailed information'

distance = 1049
spam score = 81
title = 'tools amp technology'

distance = 1049
spam score = 67
title = 'onet code connector detailed information'

distance = 1051
spam score = 68
title = 'onet code connector detailed information'

distance = 1052
spam score = 67
title = 'onet code connector detailed information'

distance = 1081
spam score = 63
title = 'onet code connector detailed information'

distance = 1081
spam score = 54
title = 'onet code connector detailed information'

distance = 1082
spam score = 70
title = 'onet code connector detailed information'

distance = 1084
spam score = 82
title = 'browse by onet descriptor'

distance = 1091
spam score = 77
title = 'onet code connector detailed information'

distance = 1095
spam score = 77
title = 'onet code connector detailed information'

distance = 1098
spam score = 53
title = 'onet code connector detailed information'

distance = 1101
spam score = 71
title = 'onet code connector detailed information'

distance = 1101
spam score = 64
title = 'onet code connector detailed information'

distance = 1103
spam score = 62
title = 'tools amp technology 53302200 bus drivers school'

distance = 1126
spam score = 61
title = 'abilities perceptual speed'

distance = 1129
spam score = 65
title = 'onet code connector detailed information'

distance = 1139
spam score = 84
title = 'onet resource center appendix d the development of the occupational information onet analyst database'

distance = 1143
spam score = 74
title = 'onet code connector detailed information'

distance = 1145
spam score = 66
title = 'onet code connector detailed information'

distance = 1151
spam score = 75
title = 'browse by onet descriptor'

distance = 1152
spam score = 62
title = 'onet code connector detailed information'

distance = 1161
spam score = 89
title = 'onet code connector coding assistance'

distance = 1166
spam score = 62
title = 'onet code connector detailed information'

distance = 1167
spam score = 62
title = 'abilities auditory attention'

distance = 1229
spam score = 88
title = 'onet resource center summary report updating the detailed work activities'

distance = 1242
spam score = 80
title = 'onet code connector detailed information'

distance = 1243
spam score = 88
title = 'onet code connector detailed information'

distance = 1246
spam score = 88
title = 'onet resource center data publication schedule'

distance = 1253
spam score = 67
title = 'onet code connector detailed information'

distance = 1272
spam score = 91
title = 'onet resource center onet tools and technology a synopsis of data development procedures'

distance = 1315
spam score = 92
title = 'onet resource center updating the onetsoc taxonomy'

distance = 1317
spam score = 91
title = 'onet resource center protocol for matching onet work context questionnaire item response scale values between the original quotanalystquot form and the revised incumbent form'

distance = 1329
spam score = 91
title = 'onet resource center onet 40 spanish version database'

distance = 1379
spam score = 59
title = 'onet code connector detailed information'

distance = 437
spam score = 54
title = ''

distance = 470
spam score = 77
title = ''

distance = 660
spam score = 60
title = ''

distance = 782
spam score = 76
title = ''

distance = 849
spam score = 55
title = ''

distance = 860
spam score = 46
title = ''

distance = 873
spam score = 58
title = ''

distance = 887
spam score = 52
title = ''

distance = 983
spam score = 69
title = ''

distance = 989
spam score = 48
title = ''

distance = 1030
spam score = 56
title = ''

distance = 1868
spam score = 21
title = ''

distance = 475
spam score = 39
title = ''

distance = 476
spam score = 38
title = ''

distance = 485
spam score = 41
title = ''

distance = 485
spam score = 40
title = ''

distance = 498
spam score = 45
title = ''

distance = 500
spam score = 42
title = ''

distance = 502
spam score = 45
title = ''

distance = 515
spam score = 42
title = ''

distance = 518
spam score = 41
title = ''

distance = 532
spam score = 43
title = ''

distance = 536
spam score = 42
title = ''

distance = 552
spam score = 41
title = ''

distance = 556
spam score = 41
title = ''

distance = 557
spam score = 39
title = ''

distance = 570
spam score = 39
title = ''

distance = 579
spam score = 50
title = ''

distance = 579
spam score = 39
title = ''

distance = 584
spam score = 38
title = ''

distance = 591
spam score = 40
title = ''

distance = 592
spam score = 41
title = ''

distance = 606
spam score = 39
title = ''

distance = 637
spam score = 38
title = ''

distance = 658
spam score = 39
title = ''

distance = 658
spam score = 39
title = ''

distance = 674
spam score = 41
title = ''

distance = 719
spam score = 47
title = ''

distance = 785
spam score = 48
title = ''

distance = 828
spam score = 40
title = ''

distance = 922
spam score = 42
title = ''

distance = 923
spam score = 33
title = ''

distance = 925
spam score = 38
title = ''

distance = 927
spam score = 36
title = ''

distance = 929
spam score = 42
title = ''

distance = 934
spam score = 35
title = ''

distance = 936
spam score = 36
title = ''

distance = 936
spam score = 37
title = ''

distance = 936
spam score = 38
title = ''

distance = 937
spam score = 34
title = ''

distance = 939
spam score = 36
title = ''

distance = 939
spam score = 35
title = ''

distance = 940
spam score = 37
title = ''

distance = 942
spam score = 35
title = ''

distance = 942
spam score = 37
title = ''

distance = 943
spam score = 35
title = ''

distance = 944
spam score = 42
title = ''

distance = 953
spam score = 40
title = ''

distance = 971
spam score = 37
title = ''

distance = 975
spam score = 31
title = ''

distance = 978
spam score = 38
title = ''

distance = 981
spam score = 36
title = ''

distance = 993
spam score = 38
title = ''

distance = 1005
spam score = 36
title = ''

distance = 1008
spam score = 35
title = ''

distance = 1009
spam score = 40
title = ''

distance = 1022
spam score = 38
title = ''

distance = 1039
spam score = 41
title = ''

distance = 1041
spam score = 36
title = ''

distance = 1043
spam score = 33
title = ''

distance = 1048
spam score = 37
title = ''

distance = 1048
spam score = 37
title = ''

distance = 1070
spam score = 37
title = ''

distance = 1074
spam score = 37
title = ''

distance = 1074
spam score = 38
title = ''

distance = 1082
spam score = 37
title = ''

distance = 1238
spam score = 39
title = ''

distance = 1315
spam score = 42
title = ''

distance = 1412
spam score = 40
title = ''

distance = 1453
spam score = 46
title = ''

distance = 1588
spam score = 44
title = ''

distance = 1588
spam score = 47
title = ''

distance = 1601
spam score = 39
title = ''

distance = 1603
spam score = 42
title = ''

distance = 1707
spam score = 58
title = ''

distance = 1850
spam score = 22
title = ''

distance = 540
spam score = 93
title = ''

distance = 544
spam score = 97
title = ''

distance = 557
spam score = 97
title = ''

distance = 563
spam score = 93
title = ''

distance = 710
spam score = 97
title = ''

distance = 712
spam score = 97
title = ''

distance = 739
spam score = 98
title = ''

distance = 739
spam score = 97
title = ''

distance = 832
spam score = 96
title = ''

distance = 837
spam score = 96
title = ''

distance = 1015
spam score = 98
title = ''

distance = 1097
spam score = 94
title = ''

distance = 1128
spam score = 97
title = ''

distance = 1138
spam score = 96
title = ''

distance = 1141
spam score = 93
title = ''

distance = 1143
spam score = 96
title = ''

distance = 1143
spam score = 96
title = ''

distance = 1792
spam score = 24
title = ''

distance = 358
spam score = 76
title = 'safety msds data for 3nitrostyrene'

distance = 375
spam score = 84
title = 'safety msds data for indium'

distance = 380
spam score = 76
title = 'safety msds data for lthreonine'

distance = 382
spam score = 79
title = 'safety msds data for 9chloroanthracene'

distance = 392
spam score = 77
title = 'safety msds data for 2benzoylthiophene'

distance = 405
spam score = 81
title = 'safety msds data for 2nitrosotoluene'

distance = 405
spam score = 80
title = 'safety msds data for lserine'

distance = 408
spam score = 81
title = 'safety msds data for 9anthracenecarbonitrile'

distance = 423
spam score = 72
title = 'safety msds data for nnnntetramethylbenzidine'

distance = 427
spam score = 74
title = 'safety msds data for anthraquinone2carboxylic acid'

distance = 430
spam score = 77
title = 'safety msds data for aniline blue ws'

distance = 431
spam score = 76
title = 'safety msds data for 2methylpentadecane'

distance = 431
spam score = 77
title = 'safety msds data for 261014tetramethylpentadecane'

distance = 435
spam score = 83
title = 'safety msds data for insulin from bovine pancreas'

distance = 439
spam score = 75
title = 'safety data for thioxanthen9one'

distance = 441
spam score = 76
title = 'safety data for bay k8644'

distance = 443
spam score = 80
title = 'safety msds data for thorin'

distance = 444
spam score = 76
title = 'safety msds data for 12indandione'

distance = 449
spam score = 83
title = 'safety msds data for 1234tetrafluorobenzene'

distance = 450
spam score = 70
title = 'safety msds data for 6chloro1hexene'

distance = 566
spam score = 79
title = 'safety msds data for toluene34dithiol zinc derivative'

distance = 569
spam score = 81
title = 'safety data for 22chloroethoxyethyl acetate'

distance = 570
spam score = 75
title = 'safety msds data for butylbenzene'

distance = 572
spam score = 81
title = 'safety msds data for antimony copper oxide'

distance = 573
spam score = 85
title = 'safety msds data for thorium carbonate'

distance = 573
spam score = 76
title = 'safety msds data for thymol blue sodium salt'

distance = 574
spam score = 77
title = 'safety msds data for 1245benzenetetracarboxylic acid'

distance = 577
spam score = 73
title = 'safety data for 2methylnaphthalene'

distance = 578
spam score = 77
title = 'safety msds data for r3benzyloxy12propanediol'

distance = 579
spam score = 77
title = 'safety msds data for nickel cyanide'

distance = 620
spam score = 84
title = 'safety msds data for tetraethylammonium chloride 4hydrate'

distance = 620
spam score = 79
title = 'safety msds data for serotonin hydrochloride'

distance = 621
spam score = 75
title = 'safety msds data for 1245benzenetetracarbonitrile'

distance = 628
spam score = 83
title = 'safety msds data for 4nitrophenyl chloroformate'

distance = 629
spam score = 69
title = 'safety msds data for sildenafil citrate'

distance = 633
spam score = 75
title = 'safety msds data for 3nitrobenzoic acid'

distance = 634
spam score = 77
title = 'safety msds data for benzilic acid'

distance = 636
spam score = 80
title = 'safety msds data for benzoghiperylene'

distance = 638
spam score = 80
title = 'safety msds data for 3methylanisole'

distance = 638
spam score = 71
title = 'safety msds data for 2356tetrahydroxy25cyclohexadiene14dione'

distance = 685
spam score = 77
title = 'safety msds data for barium hydroxide anhydrous'

distance = 685
spam score = 81
title = 'safety msds data for 4nitrophenol sodium salt'

distance = 685
spam score = 70
title = 'safety msds data for 1fluoro4nitrobenzene'

distance = 685
spam score = 68
title = 'safety msds data for ethyleneimine'

distance = 686
spam score = 84
title = 'safety msds data for tetraethylammonium perchlorate'

distance = 690
spam score = 72
title = 'safety msds data for 12benzanthracene'

distance = 691
spam score = 69
title = 'safety msds data for cobalt iii acetylacetonate'

distance = 691
spam score = 84
title = 'safety msds data for tetraethylammonium chloride'

distance = 692
spam score = 75
title = 'safety msds data for 2chloro2nitropropane'

distance = 693
spam score = 87
title = 'safety msds data for tellurium dioxide'

distance = 727
spam score = 78
title = 'safety msds data for 4nitroanisole'

distance = 732
spam score = 64
title = 'safety msds data for dibutyl ether'

distance = 732
spam score = 80
title = 'safety msds data for 3nitrobenzenesulfonic acid sodium salt'

distance = 734
spam score = 67
title = 'safety msds data for 12dicyanobenzene'

distance = 736
spam score = 77
title = 'safety msds data for tolyltriazole'

distance = 739
spam score = 74
title = 'safety msds data for 1chloro11difluoroethane'

distance = 743
spam score = 75
title = 'safety msds data for hydroxymethyl mercury'

distance = 745
spam score = 61
title = 'safety msds data for 145677hexachlorobicyclo222hept5ene23dicarboxylic acid'

distance = 746
spam score = 74
title = 'safety msds data for carbaryl'

distance = 748
spam score = 76
title = 'safety msds data for nitrobenzene'

distance = 820
spam score = 74
title = 'safety msds data for diphenylacetylene'

distance = 826
spam score = 78
title = 'safety msds data for anthraquinone2sulfonic acid sodium salt'

distance = 839
spam score = 75
title = 'safety data for 5nitrootoluidine'

distance = 840
spam score = 75
title = 'safety msds data for nacetyllmethionine'

distance = 840
spam score = 69
title = 'safety msds data for 4aminophenol'

distance = 840
spam score = 74
title = 'safety msds data for 2methylbutane'

distance = 842
spam score = 81
title = 'safety msds data for thionyl fluoride'

distance = 847
spam score = 76
title = 'safety msds data for 5101520tetraphenyl21h23hporphine cobalt ii'

distance = 848
spam score = 74
title = 'safety msds data for arsensic pentoxide'

distance = 848
spam score = 70
title = 'safety msds data for polyethylene glycol 8000'

distance = 936
spam score = 75
title = 'safety msds data for dihexyl sulfide'

distance = 936
spam score = 81
title = 'safety msds data for thiamine nitrate'

distance = 937
spam score = 76
title = 'safety msds data for acetamiprid'

distance = 938
spam score = 66
title = 'safety msds data for fluorene'

distance = 945
spam score = 73
title = 'safety msds data for tris2ethylhexylphosphate'

distance = 948
spam score = 81
title = 'safety msds data for 35nitro2furanylmethyleneamino2oxazolidinone'

distance = 951
spam score = 64
title = 'safety msds data for hexamethylphosphoramide'

distance = 957
spam score = 62
title = 'safety msds data for methyl methanesulfonate'

distance = 957
spam score = 68
title = 'safety msds data for diethyl sulfate'

distance = 969
spam score = 80
title = 'safety msds data for 1methyl1phenylethyl peroxyneodecanoate'

distance = 1394
spam score = 68
title = 'organic chemistry and safety'

distance = 1398
spam score = 28
title = 'serenity theme preview'

distance = 1401
spam score = 53
title = 'material safety data sheets'

distance = 1403
spam score = 78
title = 'camd saftey and msds'

distance = 1405
spam score = 25
title = 'serenity theme preview'

distance = 1407
spam score = 96
title = 'safety officer'

distance = 1410
spam score = 41
title = 'msds'

distance = 1412
spam score = 57
title = 'links to material safety data sheet information'

distance = 1421
spam score = 76
title = 'camd saftey and msds'

distance = 1426
spam score = 77
title = 'msds and rtk labels righttoknow labeling information'

distance = 1518
spam score = 96
title = 'general chemistry online faq chemistry of everyday life where can i find information about a substances toxicity'

distance = 1518
spam score = 80
title = 'msds and chemical information'

distance = 1518
spam score = 87
title = 'osu hazard communication compliance'

distance = 1519
spam score = 89
title = 'riskware hazardous chemical msds'

distance = 1520
spam score = 38
title = 'whmis overview introduction'

distance = 1531
spam score = 88
title = 'osu hazard communication compliance'

distance = 1532
spam score = 80
title = 'the msds hyperglossary wilson risk scale of material hazards'

distance = 1532
spam score = 60
title = 'reach tools for prevention gt safety data sheet'

distance = 1534
spam score = 45
title = 'reach site map'

distance = 1534
spam score = 83
title = 'msds translation'

distance = 1701
spam score = 73
title = 'safety msds data for vat blue 4'

distance = 1728
spam score = 68
title = 'lexan vinyl polyethylene converter for the screen print industry regal graphics'

distance = 1753
spam score = 6
title = 'butanol butanol phrases phrase dictionary'

distance = 1772
spam score = 83
title = 'mineral technologies smi products bc'

distance = 1838
spam score = 78
title = 'documentation for immediately dangerous to life or health concentrations idlhs 75434'

distance = 672
spam score = 94
title = ''

distance = 678
spam score = 89
title = ''

distance = 694
spam score = 87
title = ''

distance = 696
spam score = 88
title = ''

distance = 794
spam score = 93
title = ''

distance = 800
spam score = 82
title = ''

distance = 931
spam score = 71
title = ''

distance = 934
spam score = 77
title = ''

distance = 948
spam score = 92
title = ''

distance = 956
spam score = 85
title = ''

distance = 1005
spam score = 94
title = ''

distance = 1010
spam score = 96
title = ''

distance = 1054
spam score = 90
title = ''

distance = 1062
spam score = 85
title = ''

distance = 1160
spam score = 96
title = ''

distance = 1164
spam score = 97
title = ''

distance = 1509
spam score = 87
title = ''

distance = 127
spam score = 48
title = ''

distance = 128
spam score = 44
title = ''

distance = 1679
spam score = 36
title = ''

distance = 434
spam score = 61
title = 'senegal communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 448
spam score = 62
title = 'senegal communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 460
spam score = 50
title = 'israel communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics'

distance = 497
spam score = 49
title = 'israel communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 510
spam score = 58
title = 'swaziland communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 514
spam score = 45
title = 'malta communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 521
spam score = 64
title = 'chad communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 521
spam score = 59
title = 'swaziland communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 530
spam score = 56
title = 'tanzania communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 531
spam score = 64
title = 'senegal communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 555
spam score = 42
title = 'senegal communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 555
spam score = 68
title = 'lesotho communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 566
spam score = 38
title = 'israel communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics'

distance = 570
spam score = 66
title = 'monaco communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 577
spam score = 58
title = 'tanzania communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 581
spam score = 70
title = 'swaziland communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 592
spam score = 69
title = 'lesotho communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 593
spam score = 57
title = 'united kingdom communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 594
spam score = 47
title = 'senegal communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 596
spam score = 50
title = 'israel communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 600
spam score = 54
title = 'swaziland communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 601
spam score = 67
title = 'tanzania communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 602
spam score = 52
title = 'chad communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 613
spam score = 62
title = 'mozambique communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 626
spam score = 53
title = 'united kingdom communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics'

distance = 630
spam score = 61
title = 'united kingdom communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 633
spam score = 65
title = 'sudan communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 637
spam score = 49
title = 'puerto rico communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 639
spam score = 51
title = 'seychelles communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 640
spam score = 47
title = 'puerto rico communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 644
spam score = 53
title = 'barbados communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 656
spam score = 50
title = 'swaziland communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 665
spam score = 64
title = 'cape verde communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 693
spam score = 55
title = 'puerto rico communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 699
spam score = 47
title = 'thailand communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 701
spam score = 52
title = 'germany communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics'

distance = 702
spam score = 57
title = 'austria communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 708
spam score = 50
title = 'germany communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 710
spam score = 67
title = 'netherlands communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 710
spam score = 44
title = 'lesotho communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 711
spam score = 43
title = 'united kingdom communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics'

distance = 712
spam score = 70
title = 'togo communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 714
spam score = 60
title = 'bolivia communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 717
spam score = 57
title = 'nigeria communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 721
spam score = 53
title = 'el salvador communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 730
spam score = 55
title = 'nicaragua communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 732
spam score = 46
title = 'tanzania communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 736
spam score = 41
title = 'puerto rico communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 740
spam score = 53
title = 'united kingdom communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 752
spam score = 49
title = 'gabon communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 753
spam score = 67
title = 'cuba communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 762
spam score = 43
title = 'gabon communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 769
spam score = 56
title = 'bolivia communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 787
spam score = 51
title = 'united states communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 791
spam score = 38
title = 'antarctica communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 800
spam score = 52
title = 'bolivia 2003 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 807
spam score = 58
title = 'saint vincent and the grenadines communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 812
spam score = 44
title = 'germany communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics'

distance = 818
spam score = 54
title = 'united states communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics'

distance = 826
spam score = 53
title = 'united states communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 833
spam score = 63
title = 'hungary communications 2001 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 840
spam score = 54
title = 'china communications 2005 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 852
spam score = 35
title = 'zimbabwe communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 861
spam score = 33
title = 'argentina communications 1997 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 869
spam score = 64
title = 'saint vincent and the grenadines communications 2004 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 870
spam score = 47
title = 'china communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 870
spam score = 72
title = 'united states 2003 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 876
spam score = 50
title = 'united states communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 884
spam score = 55
title = 'china communications 2007 flags maps economy geography climate natural resources current issues international agreements population social statistics'

distance = 892
spam score = 69
title = 'china 2003 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 893
spam score = 43
title = 'china communications 2006 flags maps economy geography climate natural resources current issues international agreements population social statistics'

distance = 917
spam score = 57
title = 'saint vincent and the grenadines communications 2002 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1094
spam score = 55
title = 'united kingdom communications 2000 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1094
spam score = 69
title = 'united kingdom communications 2000 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1103
spam score = 51
title = 'world government 1998 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1110
spam score = 65
title = 'korea north communications flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1112
spam score = 65
title = 'korea north communications flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1196
spam score = 62
title = 'moldova governmental system flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1222
spam score = 77
title = 'somalia prison system flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1236
spam score = 65
title = 'china communications 2000 flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1253
spam score = 54
title = 'paraguay rail system flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1281
spam score = 72
title = 'paraguay the criminal justice system flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1310
spam score = 67
title = 'poland the welfare system flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1358
spam score = 11
title = 'communications in lesotho'

distance = 1373
spam score = 74
title = 'somalia criminal justice flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1380
spam score = 8
title = 'communications in mauritania'

distance = 1388
spam score = 68
title = 'romania railroads flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1389
spam score = 60
title = 'austria penal system flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1392
spam score = 69
title = 'romania transportation and telecommunications flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1398
spam score = 71
title = 'greece the penal system flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1400
spam score = 61
title = 'turks and caicos islands health and welfare flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1400
spam score = 66
title = 'poland penal system flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1412
spam score = 62
title = 'romania computers and automation technology flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1416
spam score = 85
title = 'world government flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1424
spam score = 70
title = 'uganda rail and road systems flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1434
spam score = 64
title = 'turks and caicos islands national security flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1483
spam score = 9
title = 'communications in the marshall islands'

distance = 1491
spam score = 24
title = 'article about quotcommunications in tanzaniaquot in the english wikipedia on 24jul2004'

distance = 1522
spam score = 38
title = 'slovakia formation of the dual system flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1523
spam score = 61
title = 'india the road system flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1524
spam score = 18
title = 'geographyiq world atlas oceania guam communications facts and figures'

distance = 1557
spam score = 18
title = 'article about quotcommunications in the marshall islandsquot in the english wikipedia on 24jul2004'

distance = 1602
spam score = 62
title = 'laos the kingdom of laos flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1603
spam score = 75
title = 'sri lanka caste among the tamils flags maps economy history climate natural resources current issues international agreements population social statistics political system'

distance = 1686
spam score = 59
title = 'sri lanka early settlements flags maps economy geography climate natural resources current issues international agreements population social statistics political system'

distance = 1768
spam score = 25
title = 'monytel sa abinee'

distance = 540
spam score = 41
title = ''

distance = 544
spam score = 40
title = ''

distance = 547
spam score = 41
title = ''

distance = 548
spam score = 45
title = ''

distance = 551
spam score = 45
title = ''

distance = 552
spam score = 47
title = ''

distance = 556
spam score = 46
title = ''

distance = 558
spam score = 46
title = ''

distance = 558
spam score = 43
title = ''

distance = 558
spam score = 41
title = ''

distance = 558
spam score = 40
title = ''

distance = 559
spam score = 43
title = ''

distance = 559
spam score = 45
title = ''

distance = 560
spam score = 37
title = ''

distance = 561
spam score = 43
title = ''

distance = 561
spam score = 42
title = ''

distance = 563
spam score = 44
title = ''

distance = 564
spam score = 47
title = ''

distance = 565
spam score = 46
title = ''

distance = 565
spam score = 46
title = ''

distance = 615
spam score = 44
title = ''

distance = 615
spam score = 44
title = ''

distance = 617
spam score = 46
title = ''

distance = 628
spam score = 46
title = ''

distance = 628
spam score = 44
title = ''

distance = 661
spam score = 39
title = ''

distance = 663
spam score = 38
title = ''

distance = 665
spam score = 37
title = ''

distance = 665
spam score = 48
title = ''

distance = 666
spam score = 38
title = ''

distance = 672
spam score = 44
title = ''

distance = 672
spam score = 50
title = ''

distance = 673
spam score = 38
title = ''

distance = 674
spam score = 48
title = ''

distance = 677
spam score = 45
title = ''

distance = 683
spam score = 45
title = ''

distance = 684
spam score = 48
title = ''

distance = 684
spam score = 44
title = ''

distance = 687
spam score = 38
title = ''

distance = 687
spam score = 38
title = ''

distance = 695
spam score = 45
title = ''

distance = 695
spam score = 44
title = ''

distance = 695
spam score = 44
title = ''

distance = 698
spam score = 46
title = ''

distance = 699
spam score = 42
title = ''

distance = 700
spam score = 45
title = ''

distance = 702
spam score = 40
title = ''

distance = 704
spam score = 40
title = ''

distance = 707
spam score = 41
title = ''

distance = 708
spam score = 41
title = ''

distance = 716
spam score = 42
title = ''

distance = 716
spam score = 42
title = ''

distance = 718
spam score = 44
title = ''

distance = 720
spam score = 41
title = ''

distance = 722
spam score = 41
title = ''

distance = 724
spam score = 42
title = ''

distance = 728
spam score = 44
title = ''

distance = 728
spam score = 41
title = ''

distance = 733
spam score = 42
title = ''

distance = 940
spam score = 44
title = ''

distance = 944
spam score = 42
title = ''

distance = 945
spam score = 44
title = ''

distance = 945
spam score = 45
title = ''

distance = 947
spam score = 41
title = ''

distance = 948
spam score = 42
title = ''

distance = 948
spam score = 44
title = ''

distance = 948
spam score = 36
title = ''

distance = 949
spam score = 42
title = ''

distance = 949
spam score = 42
title = ''

distance = 949
spam score = 45
title = ''

distance = 954
spam score = 40
title = ''

distance = 955
spam score = 42
title = ''

distance = 956
spam score = 40
title = ''

distance = 958
spam score = 40
title = ''

distance = 958
spam score = 38
title = ''

distance = 958
spam score = 43
title = ''

distance = 962
spam score = 44
title = ''

distance = 1186
spam score = 33
title = ''

distance = 1186
spam score = 37
title = ''

distance = 1193
spam score = 52
title = ''

distance = 1266
spam score = 42
title = ''

distance = 1267
spam score = 47
title = ''

distance = 1273
spam score = 41
title = ''

distance = 1274
spam score = 44
title = ''

distance = 1315
spam score = 42
title = ''

distance = 1322
spam score = 43
title = ''

distance = 1350
spam score = 42
title = ''

distance = 1356
spam score = 38
title = ''

distance = 1367
spam score = 50
title = ''

distance = 1427
spam score = 66
title = 'external interface specification open process framework opf repository'

distance = 1468
spam score = 51
title = ''

distance = 1480
spam score = 72
title = 'software requirements specification'

distance = 1500
spam score = 35
title = ''

distance = 1504
spam score = 35
title = ''

distance = 1511
spam score = 37
title = ''

distance = 1519
spam score = 61
title = 'define system scope and boundaries'

distance = 1529
spam score = 72
title = ''

distance = 1545
spam score = 36
title = ''

distance = 1563
spam score = 37
title = ''

distance = 1564
spam score = 35
title = ''

distance = 1618
spam score = 44
title = ''

distance = 1623
spam score = 51
title = ''

distance = 1624
spam score = 54
title = ''

distance = 1635
spam score = 51
title = ''

distance = 1655
spam score = 62
title = 'ieee 11561 standard microprocessor environmental specifications for computer modules ihs inc'

distance = 1761
spam score = 32
title = 'formatting object summary'

distance = 397
spam score = 84
title = 'acacia aulacocarpa fabaceae hear species info'

distance = 399
spam score = 84
title = 'acacia glauca fabaceae hear species info'

distance = 413
spam score = 88
title = 'acacia boliviana fabaceae hear species info'

distance = 417
spam score = 86
title = 'flemingia macrophylla fabaceae hear species info'

distance = 418
spam score = 87
title = 'rubus alceifolius rosaceae hear species info'

distance = 420
spam score = 88
title = 'cyrtococcum oxyphyllum poaceae hear species info'

distance = 420
spam score = 83
title = 'acacia crassicarpa fabaceae hear species info'

distance = 425
spam score = 84
title = 'galium canescens rubiaceae hear species info'

distance = 430
spam score = 88
title = 'elaeocarpus angustifolius elaeocarpaceae hear species info'

distance = 439
spam score = 83
title = 'austroeupatorium inulifolium asteraceae hear species info'

distance = 440
spam score = 80
title = 'cereus peruvianus cactaceae hear species info'

distance = 443
spam score = 90
title = 'memecylon floribundum melastomataceae hear species info'

distance = 444
spam score = 88
title = 'passiflora caerulea passifloraceae hear species info'

distance = 452
spam score = 82
title = 'amaranthus interruptus amaranthaceae hear species info'

distance = 454
spam score = 82
title = 'senna hirsuta fabaceae hear species info'

distance = 455
spam score = 83
title = 'luffa sepium cucurbitaceae hear species info'

distance = 458
spam score = 83
title = 'bromelia pinguin bromeliaceae hear species info'

distance = 460
spam score = 82
title = 'matisia cordata bombacaceae hear species info'

distance = 461
spam score = 84
title = 'alternanthera mexicana amaranthaceae hear species info'

distance = 464
spam score = 82
title = 'gymnocoronis spilanthoides asteraceae hear species info'

distance = 628
spam score = 83
title = 'gliricidia sepium fabaceae hear species info'

distance = 652
spam score = 87
title = 'crotalaria micans fabaceae hear species info'

distance = 653
spam score = 90
title = 'cenchrus brownii poaceae hear species info'

distance = 678
spam score = 87
title = 'dieffenbachia seguine araceae hear species info'

distance = 679
spam score = 89
title = 'moringa oleifera moringaceae hear species info'

distance = 683
spam score = 85
title = 'nassella cernua poaceae hear species info'

distance = 684
spam score = 84
title = 'aptenia cordifolia aizoaceae hear species info'

distance = 692
spam score = 85
title = 'acacia lasiocalyx fabaceae hear species info'

distance = 701
spam score = 83
title = 'acacia prominens fabaceae hear species info'

distance = 702
spam score = 87
title = 'acacia sinuata fabaceae hear species info'

distance = 739
spam score = 75
title = 'equisetum ramosissimum equisetaceae hear species info'

distance = 750
spam score = 93
title = 'odontonema tubaeforme acanthaceae hear species info'

distance = 750
spam score = 79
title = 'anastrepta orcadensis jungermanniaceae hear species info'

distance = 756
spam score = 79
title = 'anastrophyllum fissum jungermanniaceae hear species info'

distance = 756
spam score = 93
title = 'clerodendrum quadriloculare verbenaceae hear species info'

distance = 758
spam score = 85
title = 'acaena exigua rosaceae hear species info'

distance = 759
spam score = 83
title = 'abies pinsapo pinaceae hear species info'

distance = 759
spam score = 90
title = 'descurainia sophia brassicaceae hear species info'

distance = 760
spam score = 90
title = 'abutilon grandiflorum malvaceae hear species info'

distance = 764
spam score = 78
title = 'amphidium lapponicum dicranaceae hear species info'

distance = 793
spam score = 89
title = 'acacia longifolia var sophorae fabaceae hear species info'

distance = 793
spam score = 79
title = 'asplenium x sphenocookii aspleniaceae hear species info'

distance = 794
spam score = 88
title = 'abutilon darwinii x pictum malvaceae hear species info'

distance = 796
spam score = 88
title = 'pimenta racemosa myrtaceae hear species info'

distance = 801
spam score = 87
title = 'ziziphus mauritiana rhamnaceae hear species info'

distance = 802
spam score = 87
title = 'dioscorea sansibarensis dioscoreaceae hear species info'

distance = 804
spam score = 79
title = 'asplenium kaulfussii f gemmiparum aspleniaceae hear species info'

distance = 805
spam score = 85
title = 'abelmoschus manihot subsp manihot malvaceae hear species info'

distance = 805
spam score = 89
title = 'microlaena stipoides poaceae hear species info'

distance = 808
spam score = 77
title = 'asplenium kaulfussii f dareoides aspleniaceae hear species info'

distance = 845
spam score = 86
title = 'alternanthera brasiliana amaranthaceae hear species info'

distance = 848
spam score = 88
title = 'zantedeschia aethiopica araceae hear species info'

distance = 852
spam score = 90
title = 'chamaecrista nictitans fabaceae hear species info'

distance = 854
spam score = 89
title = 'acanthocereus tetragonus cactaceae hear species info'

distance = 858
spam score = 81
title = 'eragrostis ciliaris poaceae hear species info'

distance = 862
spam score = 95
title = 'cordia alliodora boraginaceae hear species info'

distance = 862
spam score = 84
title = 'abelmoschus manihot subsp tetraphyllus malvaceae hear species info'

distance = 863
spam score = 83
title = 'duranta erecta verbenaceae hear species info'

distance = 864
spam score = 91
title = 'acacia spp fabaceae hear species info'

distance = 864
spam score = 74
title = 'anastrophyllum esenbeckii jungermanniaceae hear species info'

distance = 928
spam score = 93
title = 'acacia mangium fabaceae hear species info'

distance = 941
spam score = 88
title = 'ficus benjamina moraceae hear species info'

distance = 941
spam score = 86
title = 'chloris gayana poaceae hear species info'

distance = 941
spam score = 80
title = 'averrhoa carambola oxalidaceae hear species info'

distance = 952
spam score = 94
title = 'dactylis glomerata poaceae hear species info'

distance = 952
spam score = 81
title = 'berberis glaucocarpa berberidaceae hear species info'

distance = 956
spam score = 82
title = 'berberis darwinii berberidaceae hear species info'

distance = 956
spam score = 76
title = 'adiantum capillusveneris pteridaceae hear species info'

distance = 960
spam score = 90
title = 'abutilon sandwicense malvaceae hear species info'

distance = 960
spam score = 87
title = 'argemone mexicana papaveraceae hear species info'

distance = 1027
spam score = 79
title = 'cryphonectria parasitica a type of plant pathogen hear species info'

distance = 1029
spam score = 90
title = 'anagallis arvensis primulaceae hear species info'

distance = 1034
spam score = 82
title = 'asplenium lobulatum aspleniaceae hear species info'

distance = 1046
spam score = 80
title = 'aedes aegypti a type of mosquito hear species info'

distance = 1048
spam score = 77
title = 'argyroxiphium kauense asteraceae hear species info'

distance = 1049
spam score = 75
title = 'achyranthes mutica amaranthaceae hear species info'

distance = 1050
spam score = 79
title = 'asplenium trichomanes subsp densum aspleniaceae hear species info'

distance = 1057
spam score = 90
title = 'acacia podalyriifolia fabaceae hear species info'

distance = 1059
spam score = 94
title = 'tetrazygia bicolor melastomataceae hear species info'

distance = 1062
spam score = 88
title = 'barleria cristata acanthaceae hear species info'

distance = 1144
spam score = 83
title = 'cerapachys biroi formicidae hear species info'

distance = 1147
spam score = 79
title = 'chaetochloa lutescens poaceae hear species info'

distance = 1151
spam score = 81
title = 'chamaeleo jacksonii subsp xantholophus reptileslizards hear species info'

distance = 1166
spam score = 78
title = 'botryllus spp ladder tunicates styelidae hear species info'

distance = 1186
spam score = 79
title = 'bromus rigidus subsp gussonei poaceae hear species info'

distance = 1226
spam score = 82
title = 'bettongia lesueur potoroidae hear species info'

distance = 1229
spam score = 82
title = 'chloropleca terpsichorella tineidae hear species info'

distance = 1242
spam score = 89
title = 'ochetellus glaber formicidae hear species info'

distance = 1246
spam score = 82
title = 'bradybaena similaris bradybaenidae hear species info'

distance = 1249
spam score = 85
title = 'caretta caretta cheloniidae hear species info'

distance = 1468
spam score = 43
title = 'plant threats to pacific ecosystems namukailau island'

distance = 1478
spam score = 44
title = 'plant threats to pacific ecosystems hunter island'

distance = 1479
spam score = 45
title = 'plant threats to pacific ecosystems takutea island'

distance = 1492
spam score = 50
title = 'plant threats to pacific ecosystems new britain island'

distance = 1496
spam score = 46
title = 'plant threats to pacific ecosystems tikei tikai tiku island'

distance = 1509
spam score = 43
title = 'plant threats to pacific ecosystems lau island'

distance = 1510
spam score = 94
title = 'eleutherodactylus planirostris amphibiansfrogs hear species info'

distance = 1512
spam score = 61
title = 'equisetum ramosissimum subsp debile pier species info'

distance = 1513
spam score = 49
title = 'commonwealth of the northern mariana islands us'

distance = 1514
spam score = 63
title = 'mollugo verticillata pier species info'

distance = 1679
spam score = 58
title = 'dalbergia latifolia pier species info'

distance = 1698
spam score = 72
title = 'desmodium nicaraguense pier species info'

distance = 1698
spam score = 73
title = 'desmodium nicaraguense pier species info'

distance = 1725
spam score = 62
title = 'syzygium jambos myrtaceae herbarium voucher specimen from raivavae raevavae island tubuai austral islandsfrench polynesiapacific region'

distance = 1841
spam score = 67
title = 'freshwater mussel genera of the world'

distance = 1842
spam score = 72
title = 'freshwater mussel genera of the world'

distance = 227
spam score = 90
title = ''

distance = 277
spam score = 94
title = ''

distance = 282
spam score = 89
title = ''

distance = 288
spam score = 94
title = ''

distance = 289
spam score = 89
title = ''

distance = 383
spam score = 87
title = ''

distance = 586
spam score = 90
title = ''

distance = 1297
spam score = 79
title = ''

distance = 1302
spam score = 96
title = ''

distance = 1423
spam score = 84
title = ''

distance = 1436
spam score = 95
title = ''

distance = 1440
spam score = 96
title = ''

distance = 1566
spam score = 72
title = ''

distance = 536
spam score = 29
title = 'econpapers rural employment in england some data sources and their use'

distance = 572
spam score = 54
title = 'econpapers introduction'

distance = 583
spam score = 41
title = 'econpapers arbitrage and completeness in financial markets with given ndimensional distributions'

distance = 586
spam score = 45
title = 'econpapers the theory of corporate finance by jean tirole'

distance = 600
spam score = 35
title = 'econpapers applied welfare economics by chris jones'

distance = 600
spam score = 31
title = 'econpapers major consumer trends affecting the us food system'

distance = 601
spam score = 40
title = 'econpapers sibling similarities and economic inequality in the us'

distance = 603
spam score = 67
title = 'econpapers industrial economics an overview'

distance = 605
spam score = 55
title = 'econpapers comment'

distance = 610
spam score = 49
title = 'econpapers a tribute to richard abel musgrave'

distance = 620
spam score = 48
title = 'econpapers rejoinder'

distance = 621
spam score = 46
title = 'econpapers comment'

distance = 622
spam score = 30
title = 'econpapers food security in kwazulu results of a householdbased programming model'

distance = 623
spam score = 45
title = 'econpapers on contracting out some labour market considerations'

distance = 624
spam score = 33
title = 'econpapers government expenditure on agriculture and agricultural performance in developing countries an empirical evalution'

distance = 626
spam score = 45
title = 'econpapers rejoinder'

distance = 627
spam score = 38
title = 'econpapers production analysis a nonparametric time series application to us agriculture'

distance = 627
spam score = 43
title = 'econpapers comment'

distance = 628
spam score = 39
title = 'econpapers a note on arbitrage in term structure'

distance = 643
spam score = 51
title = 'econpapers australian innovation data'

distance = 819
spam score = 52
title = 'econpapers introduction'

distance = 819
spam score = 52
title = 'econpapers partitioning procedures for solving mixedvariables programming problems'

distance = 820
spam score = 50
title = 'econpapers linking energy system and macroeconomic growth models'

distance = 820
spam score = 37
title = 'econpapers on the dynamics of profitled and wageled growth'

distance = 820
spam score = 32
title = 'econpapers gps inc a case of investment under uncertainty'

distance = 821
spam score = 34
title = 'econpapers balancing state market and social justice russian experiences and lessons to learn'

distance = 821
spam score = 43
title = 'econpapers does trade credit redistribution thwart monetary policy evidence from italy'

distance = 822
spam score = 47
title = 'econpapers a flexible method to measure synchrony in neuronal firing'

distance = 822
spam score = 44
title = 'econpapers global and national macroeconometric modelling by anthony garratt kevin lee m hashem pesaran and yongcheol shin'

distance = 822
spam score = 38
title = 'econpapers the investment performance of socially responsible investment funds in australia'

distance = 875
spam score = 49
title = 'econpapers ripped from the headlines what can the popular press teach us about software piracy'

distance = 876
spam score = 48
title = 'econpapers the impact of crossborder mergers on investment'

distance = 876
spam score = 59
title = 'econpapers on testing easterlins hypothesis using relative cohort size as a proxy for relative income an analysis of canadian data'

distance = 876
spam score = 46
title = 'econpapers does protection for sale apply to the us food industries'

distance = 877
spam score = 37
title = 'econpapers panel composition and judicial compliance on the us courts of appeals'

distance = 878
spam score = 55
title = 'econpapers the macroeconomics of hivaids'

distance = 878
spam score = 48
title = 'econpapers internet technologies in china insights on the morally important influence of managers'

distance = 879
spam score = 35
title = 'econpapers stabilization policy a reconsideration'

distance = 879
spam score = 48
title = 'econpapers transparency of corporate social responsibility in dutch breweries'

distance = 879
spam score = 47
title = 'econpapers competition and custom in economic contracts a case study of illinois agriculture'

distance = 942
spam score = 45
title = 'econpapers the impacts of sociopolitical instability on construction dimension'

distance = 942
spam score = 48
title = 'econpapers do australian qualifications help the effect of host country qualification on migrant participation and unemployment'

distance = 942
spam score = 41
title = 'econpapers the happiness of young australians empirical evidence on the role of labour market experience'

distance = 943
spam score = 54
title = 'econpapers skills required of managers in livestock production evidence from focus group research'

distance = 943
spam score = 43
title = 'econpapers nonprofit wage premium in the japanese child care market evidence from employeremployee matched data'

distance = 944
spam score = 46
title = 'econpapers an empirical examination of the timing of land conversions in the presence of farmland preservation programs'

distance = 944
spam score = 43
title = 'econpapers are younger cohorts demanding less fresh vegetables'

distance = 944
spam score = 38
title = 'econpapers market size and the survival of foreignowned firms'

distance = 945
spam score = 38
title = 'econpapers investment decisions in hog finishing an application of the real options approach'

distance = 945
spam score = 40
title = 'econpapers a cost approach to economic analysis under statecontingent production uncertainty'

distance = 986
spam score = 47
title = 'econpapers the baring crisis and the great latin american meltdown of the 1890s'

distance = 987
spam score = 50
title = 'econpapers sources of australian labour productivity change 19501994'

distance = 987
spam score = 52
title = 'econpapers a monte carlo em algorithm for the estimation of a logistic autologistic model with missing data'

distance = 987
spam score = 51
title = 'econpapers an illustration of a pitfall in estimating the effects of aggregate variables on micro unit'

distance = 987
spam score = 61
title = 'econpapers quality control in nonstaple food markets evidence from india'

distance = 987
spam score = 42
title = 'econpapers four themes to explain the rise in hours worked in the united states'

distance = 987
spam score = 47
title = 'econpapers impact of cooperatives on smallholders commercialization behavior evidence from ethiopia'

distance = 988
spam score = 50
title = 'econpapers on macroeconomic policy and macroeconometric models'

distance = 988
spam score = 58
title = 'econpapers restructuring research communication costs and the democratization of university innovation'

distance = 989
spam score = 63
title = 'econpapers voting on unemployment insurance'

distance = 1028
spam score = 45
title = 'econpapers guest editors introduction'

distance = 1028
spam score = 35
title = 'econpapers using a realoptions approach to model technology adoption under carbon price uncertainty an application to the australian electricity generation sector'

distance = 1029
spam score = 45
title = 'econpapers henry georges political critics'

distance = 1029
spam score = 49
title = 'econpapers media portrayal of voluntary public reporting about corporate social responsibility performance does coverage encourage or discourage ethical management'

distance = 1029
spam score = 61
title = 'econpapers impacts of considering climate variability on investment decisions in ethiopia'

distance = 1029
spam score = 46
title = 'econpapers the nonparametric identification of treatment effects in duration models'

distance = 1029
spam score = 30
title = 'econpapers estimation of the mean function with panel count data using monotone polynomial splines'

distance = 1030
spam score = 50
title = 'econpapers a richer understanding of australias productivity performance in the 1990s improved estimates based upon firmlevel panel data'

distance = 1030
spam score = 56
title = 'econpapers calibration of computable general equilibrium models from synthetic benchmark equilibrium data sets'

distance = 1030
spam score = 34
title = 'econpapers fiscal insurance and debt management in oecd economies'

distance = 1082
spam score = 38
title = 'econpapers the lags of monetary policy'

distance = 1082
spam score = 60
title = 'econpapers editorial'

distance = 1082
spam score = 68
title = 'econpapers priority setting for research on aquatic resources an application of modified economic surplus analysis to natural resource systems'

distance = 1082
spam score = 37
title = 'econpapers valuation of american continuousinstallment options'

distance = 1083
spam score = 60
title = 'econpapers repec and swopec internet access to electronic preprints in economics'

distance = 1084
spam score = 57
title = 'econpapers ostdeutsche industrie holt auf entwicklung des verarbeitenden gewerbes in berlin und brandenburg'

distance = 1084
spam score = 27
title = 'econpapers modelling the privatization process in transition economies'

distance = 1085
spam score = 34
title = 'econpapers the relationship between firm size and innovation activity a double decision approach'

distance = 1086
spam score = 57
title = 'econpapers particulars of us information technology and productivity lessons for europe'

distance = 1086
spam score = 52
title = 'econpapers improving public transit access to incity villages'

distance = 1132
spam score = 56
title = 'econpapers integration of dea with inputoutput table for national economy efficiency analysis'

distance = 1132
spam score = 42
title = 'econpapers modelling multiple time series via common factors'

distance = 1134
spam score = 57
title = 'econpapers a c computational environment for biomolecular sequence management'

distance = 1135
spam score = 57
title = 'econpapers unternehmen und arbeitsmarkt in bewegung was gewinnt die forschung durch amtliche mikrodaten'

distance = 1136
spam score = 52
title = 'econpapers irrigation technology adoption and its implication for water conservation in the texas high plains a real options approach'

distance = 1136
spam score = 32
title = 'econpapers an application of the blacklitterman model with egarchmderived views for international portfolio management'

distance = 1136
spam score = 42
title = 'econpapers nonparametric estimation of causespecific cross hazard ratio with bivariate competing risks data'

distance = 1137
spam score = 36
title = 'econpapers valuing executive stock options performance hurdles early exercise and stochastic volatility'

distance = 1138
spam score = 44
title = 'econpapers on the intertemporal value relevance of conventional financial accounting in australia'

distance = 1138
spam score = 32
title = 'econpapers credit risk versus capital requirements under basel ii are sme loans and retail credit really different'

distance = 1208
spam score = 35
title = 'econpapers dynamic causality between intraday return and order imbalance in nasdaq speculative top gainers'

distance = 1208
spam score = 40
title = 'econpapers semiparametric modelbased inference in the presence of missing responses'

distance = 1209
spam score = 53
title = 'econpapers the virtual and the imaginary the role of diasphoric new media in the construction of a national identity during the breakup of yugoslavia'

distance = 1209
spam score = 53
title = 'econpapers disintegration and integration polish provinces before and after the recovery of independence'

distance = 1210
spam score = 33
title = 'econpapers discounted cash flow methods and the fallacious reinvestment assumption a review of recent texts'

distance = 1210
spam score = 60
title = 'econpapers quarterly real gdp estimates for china and asean4 with a forecast evaluation'

distance = 1210
spam score = 42
title = 'econpapers developing a sectoral environmental database for inputoutput analysis the comprehensive environmental data archive of the us'

distance = 1214
spam score = 65
title = 'econpapers mining fuzzy temporal patterns from process instances with weighted temporal graphs'

distance = 1215
spam score = 45
title = 'econpapers the birth and death processes of hypercycle spirals'

distance = 1220
spam score = 35
title = 'econpapers modeling unexpected events in temporally disaggregated econometric inputoutput models of regional economies'

distance = 1374
spam score = 54
title = 'econpapers sum rule for multiscale representations of kinematically described systems'

distance = 1378
spam score = 66
title = 'econpapers measuring solidarity in agentbased models of resource sharing situations'

distance = 1399
spam score = 41
title = 'econpapers ivendog stata module to calculate durbinwuhausman endogeneity test after ivreg'

distance = 1408
spam score = 44
title = 'econpapers the theory and practice of the policy of dividend payments in public companies'

distance = 1420
spam score = 51
title = 'econpapers neutral evolution and mutation rates of sequential dynamical systems'

distance = 1446
spam score = 63
title = 'econpapers an agentbased model of mediterranean agricultural landusecover change for examining wildfire risk'

distance = 1447
spam score = 74
title = 'econpapers analele universitatii eftimie murgu resita'

distance = 1471
spam score = 50
title = 'econpapers from crowd dynamics to crowd safety a videobased analysis'

distance = 1479
spam score = 67
title = 'econpapers predicting credit card customer churn in banks using data mining'

distance = 468
spam score = 95
title = '2009 aviso'

distance = 478
spam score = 97
title = '2009 aviso'

distance = 483
spam score = 96
title = 'indicator products aviso'

distance = 486
spam score = 94
title = 'indicator products aviso'

distance = 497
spam score = 93
title = 'gdr aviso'

distance = 516
spam score = 98
title = 'media aviso'

distance = 526
spam score = 97
title = 'media aviso'

distance = 527
spam score = 96
title = 'data extraction tool aviso'

distance = 528
spam score = 97
title = 'data extraction tool aviso'

distance = 536
spam score = 99
title = 'ftp aviso'

distance = 551
spam score = 98
title = 'media aviso'

distance = 557
spam score = 95
title = 'expert aviso'

distance = 559
spam score = 98
title = 'live access server las aviso'

distance = 562
spam score = 97
title = 'expert aviso'

distance = 571
spam score = 96
title = 'live access server las aviso'

distance = 572
spam score = 92
title = 'spot aviso'

distance = 573
spam score = 97
title = 'expert aviso'

distance = 576
spam score = 95
title = 'novice aviso'

distance = 578
spam score = 91
title = 'jason3 aviso'

distance = 578
spam score = 92
title = 'january 15 2004 round the earth with a current aviso'

distance = 740
spam score = 95
title = 'june 30 2003 south of africa currents and sea level heights aviso'

distance = 740
spam score = 97
title = 'in situ global statistics aviso'

distance = 740
spam score = 96
title = 'gfo aviso'

distance = 745
spam score = 95
title = 'aplicaciones aviso'

distance = 749
spam score = 98
title = 'in situ global statistics aviso'

distance = 749
spam score = 97
title = 'july 28 2003 north atlantic eddies aviso'

distance = 750
spam score = 94
title = 'ostst aviso'

distance = 755
spam score = 91
title = 'ostst aviso'

distance = 760
spam score = 95
title = 'quotobserving the ocean from spacequot leaflet series aviso'

distance = 762
spam score = 94
title = 'ostst aviso'

distance = 810
spam score = 94
title = 'mss aviso'

distance = 810
spam score = 94
title = 'gpsp aviso'

distance = 810
spam score = 96
title = 'march 18 2005 resolution and smoothing aviso'

distance = 812
spam score = 97
title = 'gallery aviso'

distance = 812
spam score = 92
title = 'august 16 2004 el nio on novembers aviso'

distance = 815
spam score = 90
title = 'forecasts which are increasingly more reliable aviso'

distance = 815
spam score = 96
title = 'american great lakes aviso'

distance = 817
spam score = 95
title = 'ssaltoduacs products aviso'

distance = 818
spam score = 95
title = 'doris missions aviso'

distance = 818
spam score = 93
title = 'american great lakes aviso'

distance = 865
spam score = 95
title = 'august 17 2005 the seasons of the gulf stream aviso'

distance = 865
spam score = 96
title = 'interface interactivo 3d aviso'

distance = 866
spam score = 92
title = 'october 20 2003 averaging an area aviso'

distance = 866
spam score = 97
title = 'pod aviso'

distance = 869
spam score = 98
title = 'newsletter 9 aviso'

distance = 872
spam score = 97
title = 'orbit aviso'

distance = 873
spam score = 94
title = 'july 31 2006 nearreal time vs delayed time aviso'

distance = 874
spam score = 96
title = 'january 16 2009 global product vs mediterranean product aviso'

distance = 876
spam score = 92
title = 'calendar days or julian days aviso'

distance = 877
spam score = 92
title = 'august 17 2005 the seasons of the gulf stream aviso'

distance = 914
spam score = 98
title = 'newsletter 1 aviso'

distance = 915
spam score = 93
title = 'november 17 2005 averages in slice aviso'

distance = 916
spam score = 97
title = 'jul 2007 cruising speed measurements aviso'

distance = 917
spam score = 90
title = 'jul 2005 several altimetry satellites for ocean forecasts aviso'

distance = 917
spam score = 95
title = 'duacs aviso'

distance = 919
spam score = 96
title = 'may 23 2005 looks on indian monsoon aviso'

distance = 919
spam score = 99
title = 'newsletter 1 aviso'

distance = 919
spam score = 97
title = 'soprane tracks the ocean in four dimensions aviso'

distance = 919
spam score = 95
title = 'january 23 2007 the equator against the current aviso'

distance = 920
spam score = 91
title = 'debroc dumont laurent parlier and thiercelin aviso'

distance = 955
spam score = 92
title = '2006 aviso'

distance = 955
spam score = 91
title = 'sep 2004 four satellites to watch over the mediterranean aviso'

distance = 956
spam score = 81
title = 'mar 2008 black seas eddies aviso'

distance = 957
spam score = 89
title = 'october 17 2006 land effects vs land mask effects aviso'

distance = 957
spam score = 98
title = 'doris measures a glaciers drift aviso'

distance = 959
spam score = 93
title = 'processing steps and data levels aviso'

distance = 959
spam score = 93
title = '2006 aviso'

distance = 960
spam score = 94
title = 'sep 2006 mediterranean currents aviso'

distance = 963
spam score = 94
title = 'citation aviso'

distance = 967
spam score = 94
title = 'processing steps and data levels aviso'

distance = 1019
spam score = 93
title = 'by category aviso'

distance = 1022
spam score = 96
title = 'future improvements aviso'

distance = 1023
spam score = 95
title = 'may 15 2008 rossby waves in enso events aviso'

distance = 1034
spam score = 95
title = '2003 aviso'

distance = 1036
spam score = 95
title = '2003 aviso'

distance = 1038
spam score = 98
title = 'jun 2006 tehuantepec eddies aviso'

distance = 1043
spam score = 94
title = 'july 13 2005 variations on mdt aviso'

distance = 1043
spam score = 96
title = 'ground beacons aviso'

distance = 1043
spam score = 78
title = 'apr 2005 series of hurricanes aviso'

distance = 1044
spam score = 90
title = 'description fes2004 aviso'

distance = 1109
spam score = 98
title = 'january 22 2008 la nia westerly current aviso'

distance = 1110
spam score = 94
title = 'corssh aviso'

distance = 1110
spam score = 96
title = 'january 22 2008 la nia westerly current aviso'

distance = 1110
spam score = 94
title = 'products aviso'

distance = 1111
spam score = 91
title = 'sla monomission aviso'

distance = 1119
spam score = 91
title = 'swh and sigma0 in corssh aviso'

distance = 1130
spam score = 97
title = 'may 2006 ice on lake baikal aviso'

distance = 1132
spam score = 92
title = 'real time processing aviso'

distance = 1136
spam score = 87
title = 'opendap sea level anomaly products aviso'

distance = 1136
spam score = 96
title = 'real time processing aviso'

distance = 1392
spam score = 79
title = 'radar altimetry tutorial 4233 missions jason1 missions objectives'

distance = 1396
spam score = 84
title = 'madt mediterranean aviso'

distance = 1419
spam score = 63
title = 'altimeter product dataglobalavisotpwvfdr'

distance = 1433
spam score = 79
title = 'radar altimetry tutorial 42313 missions jason1 doris instruments'

distance = 1438
spam score = 59
title = 'altimeter product dataglobalavisonrtmsla'

distance = 1440
spam score = 69
title = 'altimeter product dataglobalavisonrtmwindswh'

distance = 1453
spam score = 98
title = 'what is aviso aviso'

distance = 1453
spam score = 96
title = 'what is aviso aviso'

distance = 1456
spam score = 75
title = 'radar altimetry tutorial 43212 missions cryosat doris instrument'

distance = 1457
spam score = 67
title = 'radar altimetry tutorial 4312 missions jason2 orbit'

distance = 1705
spam score = 93
title = 'erowa robot systems'

distance = 1727
spam score = 65
title = 'das forschungsdatenzentrum der ba im iab outline'

distance = 1735
spam score = 65
title = 'publikationen bildungsservice englisch water in the 21st century lifestyle and water'

distance = 1742
spam score = 72
title = 'publikationen bildungsservice englisch water in the 21st century lifestyle and water'

distance = 1748
spam score = 93
title = 'news evt eye vision technology'

distance = 1750
spam score = 78
title = 'publikationen bildungsservice englisch water in the 21st century lifestyle and water'

distance = 1752
spam score = 86
title = 'requirements'

distance = 1776
spam score = 86
title = 'gefrderte projektenbspnbspuniversitaumlt ulm'

distance = 1790
spam score = 68
title = 'publikationen bildungsservice bildungsmaterialien sekundarstufe iii englisch klimaschutz und klimapolitik handreichung f252r lehrkr228fte'

distance = 478
spam score = 47
title = 'sealing compound'

distance = 483
spam score = 57
title = 'sealing compound'

distance = 489
spam score = 51
title = 'liquid cleaner'

distance = 492
spam score = 48
title = 'liquid cleaner'

distance = 493
spam score = 57
title = 'caustic etch'

distance = 493
spam score = 44
title = 'liquid cleaner'

distance = 495
spam score = 56
title = 'caustic etch'

distance = 497
spam score = 53
title = 'silver filled epoxy resin'

distance = 497
spam score = 53
title = 'silver filled epoxy resin'

distance = 508
spam score = 58
title = 'caustic etch solution'

distance = 508
spam score = 53
title = 'silver filled epoxy resin'

distance = 508
spam score = 51
title = 'silver filled epoxy resin'

distance = 511
spam score = 56
title = 'pressure sensitive adhesive'

distance = 514
spam score = 46
title = 'tonerdeveloper drum'

distance = 514
spam score = 46
title = 'oyltitestik'

distance = 517
spam score = 47
title = 'silver filled epoxy resin'

distance = 517
spam score = 48
title = 'silver filled epoxy resin'

distance = 520
spam score = 48
title = 'caustic etch solution'

distance = 521
spam score = 54
title = 'modified epoxy'

distance = 521
spam score = 47
title = 'isoprep 500 l'

distance = 623
spam score = 55
title = 'alcoholdenatured'

distance = 623
spam score = 46
title = 'durabond d3001 acrylic cove base adhesive'

distance = 631
spam score = 47
title = 'xcell bar chain oil'

distance = 634
spam score = 56
title = 'see supplemental data'

distance = 636
spam score = 54
title = 'rtv siliconetungsten'

distance = 640
spam score = 57
title = 'perlite volcanic glass'

distance = 641
spam score = 56
title = 'polishing compound'

distance = 641
spam score = 53
title = 'perlite volcanic glass'

distance = 646
spam score = 42
title = 'flux soldering paste for electrical application'

distance = 658
spam score = 43
title = 'antiseize compound'

distance = 677
spam score = 44
title = 'pliobond general purpose adhesive'

distance = 678
spam score = 59
title = 'fused silicaall grades rg2 rp2 rp1'

distance = 678
spam score = 50
title = 'pliobond general purpose adhesive'

distance = 679
spam score = 48
title = 'fused silicaall grades rg2 rp2 rp1'

distance = 679
spam score = 57
title = 'fused silicaall grades rg2 rp2 rp1'

distance = 680
spam score = 49
title = 'fused silicaall grades rg2 rp2 rp1'

distance = 680
spam score = 51
title = 'slic tite paste with teflon'

distance = 681
spam score = 44
title = '740 shredder oil'

distance = 682
spam score = 60
title = 'reclaim extrusion wax'

distance = 682
spam score = 48
title = 'fused silicaall grades rg2 rp2 rp1'

distance = 705
spam score = 56
title = 'silver nitrateacs'

distance = 706
spam score = 60
title = 'sealing resincompound'

distance = 707
spam score = 48
title = 'compound lubricatio 16 ozl'

distance = 712
spam score = 41
title = 'hydrochloric acid'

distance = 713
spam score = 49
title = 'silicone paste'

distance = 715
spam score = 48
title = 'pad metal polish impregnated see msds 175528'

distance = 717
spam score = 52
title = 'pad metal polish impregnated see msds 175528'

distance = 717
spam score = 41
title = 'lubricant'

distance = 719
spam score = 49
title = 'distilled water'

distance = 720
spam score = 50
title = 'adhesive'

distance = 737
spam score = 52
title = 'adhesive latex 780'

distance = 739
spam score = 46
title = 'enamel aa2787'

distance = 740
spam score = 43
title = 'adhesive latex 780'

distance = 740
spam score = 49
title = 'solvent cement'

distance = 741
spam score = 48
title = 'penetrating fluid'

distance = 741
spam score = 52
title = 'penetrating fluid'

distance = 743
spam score = 45
title = 'molecular sieve silica 513'

distance = 743
spam score = 46
title = 'orange shellac'

distance = 743
spam score = 54
title = 'molecular sieve silica 513'

distance = 744
spam score = 52
title = 'norsil rtv 138 part a'

distance = 767
spam score = 61
title = 'flux soldering'

distance = 767
spam score = 45
title = 'cleaning compound'

distance = 771
spam score = 41
title = 'resin coating thermosetting shell 828 see msds 11998'

distance = 771
spam score = 57
title = 'flux soldering'

distance = 772
spam score = 60
title = 'flux soldering'

distance = 775
spam score = 46
title = 'sealing compound ge rtv 630'

distance = 776
spam score = 51
title = 'polysulfide polymer'

distance = 777
spam score = 50
title = 'polysulfide polymer'

distance = 779
spam score = 58
title = 'flux soldering'

distance = 781
spam score = 44
title = 'polysulfide polymer'

distance = 921
spam score = 47
title = 'preventive corrosion cpd'

distance = 1179
spam score = 31
title = 'msds allerpetb c or d'

distance = 1184
spam score = 34
title = 'msds allerpetb c or d'

distance = 1196
spam score = 26
title = 'msds ez trap'

distance = 1221
spam score = 37
title = 'msds fly repellent ointment vip'

distance = 1233
spam score = 24
title = 'msds flysoff fly repellent ointment'

distance = 1256
spam score = 51
title = 'msds ferret ear wash'

distance = 1274
spam score = 36
title = 'msds adams 14 day flea dip'

distance = 1304
spam score = 49
title = ''

distance = 1305
spam score = 48
title = 'msds farnam vitamin e amp selenium crumbles'

distance = 1449
spam score = 42
title = ''

distance = 1461
spam score = 44
title = 'fibertite roofing systems msds explanation of sections'

distance = 1462
spam score = 51
title = 'msds adams plus fampt shampoo winsect growth regulator igr'

distance = 1463
spam score = 55
title = ''

distance = 1465
spam score = 90
title = 'appendix iii whmis msds workplace hazardous materials information system whmis a guide to the legislation ontario ministry of labour'

distance = 1468
spam score = 50
title = 'msds adams flea amp tick shampoo'

distance = 1473
spam score = 62
title = 'msds adams home flea amp tick spray'

distance = 1478
spam score = 48
title = 'dynatron bondo 908 epoxy glue adhesive resin'

distance = 1478
spam score = 40
title = 'msds adams flea amp tick shampoo'

distance = 1482
spam score = 77
title = 'erowid tobacco vault nicotine material safety data sheet f2123 chem service'

distance = 1577
spam score = 44
title = 'magnetek hesgon woven fiberglass tape all styles'

distance = 1585
spam score = 54
title = 'msds adams plus breakaway flea amp tick collar for cats amp kittens'

distance = 1596
spam score = 52
title = 'msds adams flea amp tick collar for dogs'

distance = 1600
spam score = 42
title = 'penray 5001 windshield washer antifreeze'

distance = 1601
spam score = 72
title = 'saxs dangerous properties of industrial materials 11th edition 3 volume set'

distance = 1603
spam score = 90
title = 'uh chemistry graduate studies'

distance = 1609
spam score = 52
title = 'radiator specialty tite seal cpvc cement t6132'

distance = 1613
spam score = 60
title = 'strongware reg for managing osha and epa data'

distance = 1615
spam score = 85
title = 'frequently asked questions workplace hazardous materials information system whmis'

distance = 1617
spam score = 44
title = 'tetrabutyl ammonium hydrogen sulphate'

distance = 1803
spam score = 32
title = 'greg bender dellrsquoorto carburetors atomizer specifications'

distance = 1844
spam score = 61
title = ''

distance = 350
spam score = 73
title = 'aware to man pages w1'

distance = 356
spam score = 76
title = 'aware to man pages which1'

distance = 360
spam score = 78
title = 'aware to man pages from1'

distance = 392
spam score = 90
title = 'aware to man pages man1'

distance = 405
spam score = 83
title = 'aware to man pages printenv1'

distance = 411
spam score = 77
title = 'aware to man pages ldd1'

distance = 413
spam score = 80
title = 'aware to man pages lptest1'

distance = 414
spam score = 81
title = 'aware to man pages zforce1'

distance = 418
spam score = 77
title = 'aware to man pages biff1'

distance = 418
spam score = 77
title = 'aware to man pages users1'

distance = 418
spam score = 76
title = 'aware to man pages kdestroy1'

distance = 419
spam score = 78
title = 'aware to man pages false1'

distance = 419
spam score = 82
title = 'aware to man pages mixerctl1'

distance = 419
spam score = 78
title = 'aware to man pages ipsecadm1'

distance = 420
spam score = 71
title = 'aware to man pages mopchk1'

distance = 420
spam score = 90
title = 'aware to man pages od1'

distance = 420
spam score = 72
title = 'aware to man pages rwall1'

distance = 422
spam score = 72
title = 'aware to man pages startkey1'

distance = 423
spam score = 75
title = 'aware to man pages uname1'

distance = 423
spam score = 76
title = 'aware to man pages true1'

distance = 681
spam score = 67
title = 'aware to perl arrays of hashes'

distance = 684
spam score = 71
title = 'aware to perl bitwise and'

distance = 685
spam score = 80
title = 'aware to man pages du1'

distance = 689
spam score = 69
title = 'aware to perl lists of hashes'

distance = 694
spam score = 68
title = 'aware to perl hashes of lists'

distance = 702
spam score = 77
title = 'aware to perl additive operators'

distance = 703
spam score = 76
title = 'aware to perl time'

distance = 706
spam score = 69
title = 'aware to perl tr'

distance = 712
spam score = 72
title = 'aware to perl destroy this'

distance = 713
spam score = 74
title = 'aware to perl more elaborate constructs'

distance = 801
spam score = 72
title = 'aware to perl sin expr'

distance = 802
spam score = 73
title = 'aware to man pages rmdir1'

distance = 802
spam score = 80
title = 'aware to man pages lam1'

distance = 803
spam score = 69
title = 'aware to perl how do i select a random element from an array'

distance = 803
spam score = 72
title = 'aware to perl how do i process an entire hash'

distance = 809
spam score = 66
title = 'aware to perl how do i avoid zombies on a unix system'

distance = 810
spam score = 70
title = 'aware to perl declaration of a hash of hashes'

distance = 811
spam score = 72
title = 'aware to perl connect socketname'

distance = 811
spam score = 65
title = 'aware to perl truncate filehandlelength'

distance = 811
spam score = 85
title = 'aware to man pages amq8'

distance = 881
spam score = 63
title = 'aware to perl is there a leakbug in glob'

distance = 882
spam score = 63
title = 'aware to perl embedding improvements'

distance = 883
spam score = 75
title = 'aware to perl index strsubstrposition'

distance = 885
spam score = 71
title = 'aware to perl lcfirst expr'

distance = 890
spam score = 70
title = 'aware to perl how do i fetch a news article or the active newsgroups'

distance = 891
spam score = 72
title = 'aware to perl how can i find the julian day'

distance = 892
spam score = 70
title = 'aware to perl printf this list'

distance = 894
spam score = 75
title = 'aware to perl how do i expand function calls in a string'

distance = 894
spam score = 62
title = 'aware to perl why doesnt glob get all the files'

distance = 896
spam score = 76
title = 'aware to perl how do i download a file from the users machine how do i open a file on another machine'

distance = 976
spam score = 75
title = 'aware to perl realgroupid'

distance = 979
spam score = 78
title = 'aware to man pages mountcd96608'

distance = 981
spam score = 68
title = 'aware to perl what is the difference between array1 and array1'

distance = 983
spam score = 85
title = 'aware default selections scsi'

distance = 984
spam score = 72
title = 'aware to perl effectiveuserid'

distance = 989
spam score = 73
title = 'aware to man pages ruptime1'

distance = 990
spam score = 74
title = 'aware to perl how do i shuffle an array randomly'

distance = 990
spam score = 75
title = 'aware to perl how can i reliably rename a file'

distance = 992
spam score = 81
title = 'aware to man pages ceil3'

distance = 993
spam score = 76
title = 'aware to perl constant folding'

distance = 1073
spam score = 72
title = 'aware to perl why does passing a subroutine an undefined element in a hash create it'

distance = 1077
spam score = 78
title = 'aware to man pages mprotect2'

distance = 1078
spam score = 78
title = 'aware to man pages sync2'

distance = 1082
spam score = 75
title = 'aware to perl relational operators'

distance = 1082
spam score = 76
title = 'aware to perl fcntl'

distance = 1082
spam score = 75
title = 'aware perl hebrew'

distance = 1082
spam score = 79
title = 'aware to man pages erf3'

distance = 1082
spam score = 73
title = 'aware to man pages tan3'

distance = 1083
spam score = 71
title = 'aware to perl syswrite filehandlescalarlengthoffset'

distance = 1083
spam score = 75
title = 'aware man pages software licensing'

distance = 1147
spam score = 80
title = 'aware to man pages rmt8'

distance = 1147
spam score = 95
title = 'aware perl running process information'

distance = 1147
spam score = 93
title = 'aware perl editable text data storage'

distance = 1148
spam score = 71
title = 'aware man pages scsi'

distance = 1148
spam score = 82
title = 'aware to man pages vfork2'

distance = 1148
spam score = 87
title = 'aware to man pages killpg3'

distance = 1148
spam score = 88
title = 'aware perl curses forms'

distance = 1152
spam score = 74
title = 'aware to perl crypt plaintextsalt'

distance = 1155
spam score = 78
title = 'aware man pages midi'

distance = 1155
spam score = 93
title = 'aware default selections next'

distance = 1224
spam score = 91
title = 'aware default selections beos'

distance = 1224
spam score = 79
title = 'aware useful tech info 3d action games'

distance = 1225
spam score = 95
title = 'aware perl process limits identity'

distance = 1226
spam score = 79
title = 'aware man pages client server implementation'

distance = 1226
spam score = 75
title = 'aware to man pages kuserok3'

distance = 1230
spam score = 87
title = 'aware to man pages mountnull8'

distance = 1231
spam score = 73
title = 'aware to perl generation of a hash of lists'

distance = 1231
spam score = 89
title = 'aware man pages statistical functions'

distance = 1231
spam score = 79
title = 'aware to man pages sha11'

distance = 1233
spam score = 86
title = 'aware perl freebsd specific'

distance = 1316
spam score = 84
title = 'aware to man pages siginterrupt3'

distance = 1318
spam score = 97
title = 'aware programmers webliography and index'

distance = 1319
spam score = 83
title = 'aware useful tech info turn by turn games'

distance = 1320
spam score = 70
title = 'aware to perl how can i capture stderr from an external command'

distance = 1320
spam score = 83
title = 'aware useful tech info image transmission'

distance = 1320
spam score = 89
title = 'aware default selections serial io'

distance = 1321
spam score = 82
title = 'aware useful tech info persistent data'

distance = 1322
spam score = 89
title = 'aware to man pages fdformat1'

distance = 1327
spam score = 76
title = 'aware to perl references'

distance = 1327
spam score = 79
title = 'aware useful tech info card games'

distance = 1521
spam score = 92
title = 'aware default selections data structures in memory'

distance = 1533
spam score = 88
title = 'aware useful tech info realtime related'

distance = 1559
spam score = 93
title = 'aware man pages remote process communication'

distance = 1565
spam score = 92
title = 'aware default selections unix'

distance = 1588
spam score = 90
title = 'aware default selections distributed discussion systems'

distance = 1674
spam score = 82
title = 'aware man pages kerberos authentication'

distance = 1676
spam score = 95
title = 'aware default selections specific computer brands'

distance = 1748
spam score = 29
title = 'extract text between keywords'

distance = 781
spam score = 42
title = ''

distance = 1188
spam score = 41
title = ''

distance = 660
spam score = 98
title = ''

distance = 713
spam score = 96
title = ''

distance = 736
spam score = 94
title = ''

distance = 736
spam score = 96
title = ''

distance = 760
spam score = 98
title = ''

distance = 766
spam score = 95
title = ''

distance = 771
spam score = 96
title = ''

distance = 791
spam score = 96
title = ''

distance = 802
spam score = 95
title = ''

distance = 805
spam score = 99
title = ''

distance = 809
spam score = 97
title = ''

distance = 840
spam score = 97
title = ''

distance = 843
spam score = 98
title = ''

distance = 860
spam score = 93
title = ''

distance = 864
spam score = 95
title = ''

distance = 875
spam score = 94
title = ''

distance = 879
spam score = 95
title = ''

distance = 880
spam score = 98
title = ''

distance = 888
spam score = 98
title = ''

distance = 898
spam score = 87
title = ''

distance = 906
spam score = 96
title = ''

distance = 919
spam score = 94
title = ''

distance = 923
spam score = 94
title = ''

distance = 925
spam score = 97
title = ''

distance = 941
spam score = 93
title = ''

distance = 952
spam score = 98
title = ''

distance = 966
spam score = 95
title = ''

distance = 987
spam score = 98
title = ''

distance = 1008
spam score = 94
title = ''

distance = 1027
spam score = 93
title = ''

distance = 1047
spam score = 93
title = ''

distance = 1056
spam score = 97
title = ''

distance = 1057
spam score = 97
title = ''

distance = 1070
spam score = 94
title = ''

distance = 1086
spam score = 98
title = ''

distance = 1115
spam score = 98
title = ''

distance = 1123
spam score = 99
title = ''

distance = 1131
spam score = 98
title = ''

distance = 1131
spam score = 88
title = ''

distance = 1136
spam score = 91
title = ''

distance = 1158
spam score = 96
title = ''

distance = 1166
spam score = 95
title = ''

distance = 1203
spam score = 94
title = ''

distance = 1206
spam score = 99
title = ''

distance = 1299
spam score = 96
title = ''

distance = 1326
spam score = 73
title = ''

distance = 1583
spam score = 89
title = ''

distance = 1643
spam score = 88
title = ''

distance = 746
spam score = 64
title = ''

distance = 770
spam score = 55
title = ''

distance = 843
spam score = 46
title = ''

distance = 991
spam score = 57
title = ''

distance = 1011
spam score = 69
title = ''

distance = 1015
spam score = 65
title = ''

distance = 1490
spam score = 78
title = ''

distance = 618
spam score = 83
title = 'revision of the corporate goods price index bank of japan'

distance = 625
spam score = 80
title = 'revision of the corporate goods price index bank of japan'

distance = 625
spam score = 83
title = 'revision of the corporate goods price index bank of japan'

distance = 629
spam score = 82
title = 'revision of the corporate goods price index bank of japan'

distance = 631
spam score = 80
title = 'revision of the corporate goods price index bank of japan'

distance = 635
spam score = 83
title = 'revision of the corporate goods price index bank of japan'

distance = 644
spam score = 79
title = 'correction of data on certificates of deposit outstanding bank of japan'

distance = 646
spam score = 83
title = 'revision of the released longterm timeseries data of the corporate goods price index bank of japan'

distance = 646
spam score = 82
title = 'revision of the corporate goods price index bank of japan'

distance = 650
spam score = 78
title = 'correction to data for amount outstanding of loans and discounts bank of japan'

distance = 650
spam score = 80
title = 'correction to data for amount outstanding of loans and discounts bank of japan'

distance = 651
spam score = 77
title = 'correction to data in money stock released today bank of japan'

distance = 654
spam score = 82
title = 'revision of the corporate goods price index bank of japan'

distance = 655
spam score = 80
title = 'correction to data for amount outstanding of loans and discounts bank of japan'

distance = 656
spam score = 80
title = 'correction to data for amount outstanding of loans and discounts bank of japan'

distance = 657
spam score = 80
title = 'correction to data for amount outstanding of loans and discounts bank of japan'

distance = 661
spam score = 75
title = 'correction of data on certificates of deposit outstanding bank of japan'

distance = 664
spam score = 80
title = 'correction of data on assets and liabilities of financial institutions etc bank of japan'

distance = 664
spam score = 80
title = 'correction to data for amount outstanding of loans and discounts bank of japan'

distance = 664
spam score = 81
title = 'correction of data on certificates of deposit outstanding bank of japan'

distance = 784
spam score = 76
title = 'correction to data in principal figures of financial institutions bank of japan'

distance = 785
spam score = 73
title = 'corrections to data in average contracted interest rates on loans and discounts bank of japan'

distance = 786
spam score = 81
title = 'alterations in the loans and discounts by the bank of japan bank of japan'

distance = 787
spam score = 86
title = 'correction to data in commitment lines extended by japanese banks bank of japan'

distance = 791
spam score = 77
title = 'revision of the corporate services price index bank of japan'

distance = 793
spam score = 72
title = 'correction to data in commitment lines extended by japanese banks bank of japan'

distance = 798
spam score = 88
title = 'correction to data in principal figures of financial institutions bank of japan'

distance = 799
spam score = 84
title = 'revision of amounts outstanding of deposits by depositor shinkin banks bank of japan'

distance = 800
spam score = 79
title = 'change in presentation of statistical figures in reserves data bank of japan'

distance = 800
spam score = 84
title = 'corrections to data in average contracted interest rates on loans and discounts bank of japan'

distance = 844
spam score = 66
title = 'bill rates bank of japan'

distance = 845
spam score = 84
title = 'correction to data in principal figures of financial institutions preliminary figures bank of japan'

distance = 846
spam score = 76
title = 'the alterations of the statistics in financial and economic statistics monthly october 2004 bank of japan'

distance = 849
spam score = 81
title = 'revision of deposits loans and discounts outstanding of domestically licensed banks by prefecture bank of japan'

distance = 852
spam score = 85
title = 'revision of data in the results of the regular derivatives market statistics in japan bank of japan'

distance = 852
spam score = 79
title = 'correction to data in shortterm money market and bond market bank of japan'

distance = 852
spam score = 78
title = 'periodic revision of the corporate services price index bank of japan'

distance = 852
spam score = 80
title = 'revision of deposits loans and discounts outstanding of domestically licensed banks by prefecture bank of japan'

distance = 853
spam score = 88
title = 'the schedule for the alteration of the statistics in financial and economic statistics monthly bank of japan'

distance = 857
spam score = 88
title = 'revision of the corporate goods price index bank of japan'

distance = 883
spam score = 79
title = 'data on commitment lines extended by japanese banks january 2007 bank of japan'

distance = 883
spam score = 61
title = 'monetary base bank of japan'

distance = 885
spam score = 76
title = 'boj current account balances by sector bank of japan'

distance = 885
spam score = 90
title = 'data on commitment lines extended by japanese banks november 2008 bank of japan'

distance = 886
spam score = 81
title = 'correction to data in principal figures of financial institutions bank of japan'

distance = 889
spam score = 87
title = 'data on commitment lines extended by japanese banks december 2008 bank of japan'

distance = 889
spam score = 84
title = 'correction to data in principal figures of financial institutions bank of japan'

distance = 890
spam score = 81
title = 'the alterations of the statistics in financial and economic statistics monthly february 2008 bank of japan'

distance = 891
spam score = 89
title = 'correction to data in principal figures of financial institutions bank of japan'

distance = 891
spam score = 78
title = 'the alterations of the statistics in financial and economic statistics monthly february 2008 bank of japan'

distance = 949
spam score = 78
title = 'correction to data in longterm timeseries data of foreign exchange rates monthly bank of japan'

distance = 950
spam score = 83
title = 'correction to data in principal figures of financial institutions bank of japan'

distance = 951
spam score = 81
title = 'changes to payment and settlement statistics bank of japan'

distance = 952
spam score = 75
title = 'additional release of the loans and discounts outstanding by sector by type of major industries bank of japan'

distance = 953
spam score = 90
title = 'correction to data in principal figures of financial institutions bank of japan'

distance = 953
spam score = 80
title = 'correction of data on quotaverage interest rates on time deposits by term new receiptsquot and quottime deposits new receipts and outstandingquot bank of japan'

distance = 953
spam score = 77
title = 'an additional item to certificates of deposit outstanding in the amounts outstanding in shortterm money market bank of japan'

distance = 954
spam score = 85
title = 'an additional item to certificates of deposit outstanding in the amounts outstanding in shortterm money market bank of japan'

distance = 955
spam score = 81
title = 'revision of deposits vault cash and loans and discounts outstanding and loans and discounts outstanding by sector bank of japan'

distance = 957
spam score = 84
title = 'release of industrialregional breakdowns of direct investment data bank of japan'

distance = 1009
spam score = 76
title = 'tokyo repo rate for january 26 2009 bank of japan'

distance = 1010
spam score = 80
title = 'time deposits new receipts and outstanding bank of japan'

distance = 1010
spam score = 73
title = 'bond market yields bank of japan'

distance = 1011
spam score = 77
title = 'tokyo repo rate for january 30 2009 bank of japan'

distance = 1012
spam score = 80
title = 'corrections to data in review of japanese banks activitiesprofits and balance sheets in fiscal 2002 bank of japan'

distance = 1013
spam score = 80
title = 'alternations in principal accounts of the shoko chukin bank bank of japan'

distance = 1014
spam score = 76
title = 'tokyo repo rate for january 27 2009 bank of japan'

distance = 1014
spam score = 77
title = 'bank of japan statistics and other key statistics available on this website bank of japan'

distance = 1015
spam score = 77
title = 'new files monetary base and the bank of japans transactions and national government debt bank of japan'

distance = 1016
spam score = 77
title = 'shortterm money market rates bank of japan'

distance = 1072
spam score = 77
title = 'alterations in the amount outstanding of deposits by depositor excludes financial institutions deposits etc average outstanding loans and discounts outstanding by sector bank of japan'

distance = 1072
spam score = 90
title = 'financial system report bank of japan'

distance = 1076
spam score = 90
title = 'financial system report bank of japan'

distance = 1081
spam score = 88
title = 'financial system stability bank of japan'

distance = 1082
spam score = 68
title = 'rates bank of japan'

distance = 1084
spam score = 81
title = 'statistics bank of japan'

distance = 1084
spam score = 87
title = 'results of the regular derivatives market statistics in japan bank of japan'

distance = 1085
spam score = 77
title = 'alterations in the amounts outstanding in shortterm money market certificates of deposit outstanding bank of japan'

distance = 1086
spam score = 74
title = 'change in the annual revision schedule of the flow of funds accounts bank of japan'

distance = 1087
spam score = 76
title = 'deposits loans and discounts outstanding of domestically licensed banks by prefecture bank of japan'

distance = 1166
spam score = 74
title = 'issues redemptions and amounts outstanding of public and corporate bonds bank of japan'

distance = 1166
spam score = 85
title = 'changing the file format of longterm timeseries data released in the bank of japans web site bank of japan'

distance = 1167
spam score = 83
title = 'an assessment of financial system stability focusing on the banking sector simplified chinese version bank of japan'

distance = 1167
spam score = 89
title = 'release of the payment and settlement systems report bank of japan'

distance = 1172
spam score = 70
title = 'introduction of the new rtgs system bank of japan'

distance = 1173
spam score = 86
title = 'bank of japan bank of japan'

distance = 1175
spam score = 87
title = 'seasonal adjustment for money stock data bank of japan'

distance = 1177
spam score = 75
title = 'schedule for updates of the longterm timeseries data for the next six months from january to june 2009 bank of japan'

distance = 1178
spam score = 74
title = 'information for issues redemptions and amounts outstanding of public and corporate bonds domestic flotation bank of japan'

distance = 1178
spam score = 90
title = 'financial system reportmeasures taken by the bank of japan for financial system stability bank of japan'

distance = 1291
spam score = 78
title = 'explanation of the 2000 base corporate services price index cspi bank of japan'

distance = 1292
spam score = 89
title = 'amendment to guidelines on eligible collateral bank of japan'

distance = 1295
spam score = 73
title = 'research papers bank of japan'

distance = 1299
spam score = 82
title = 'proposed revisions to the contents of payment and settlement statistics bank of japan'

distance = 1299
spam score = 75
title = 'the outline of the reference tablechannels of fundraising by the nonfinancial sector bank of japan'

distance = 1300
spam score = 86
title = 'revision in the indices of aggregated sales bank of japan'

distance = 1301
spam score = 84
title = 'principal enterprises tankan annual projections bank of japan'

distance = 1301
spam score = 84
title = 'revision in the indices of aggregated sales bank of japan'

distance = 1304
spam score = 70
title = 'the outline of the reference tablechannels of fundraising by the nonfinancial sector bank of japan'

distance = 1305
spam score = 91
title = 'proposed revisions to the contents of payment and settlement statistics bank of japan'

distance = 1714
spam score = 49
title = 'statistics norway index of commodity consumption july 2005 increased household consumption'

distance = 1790
spam score = 41
title = 'refpolicy milter mail filters'

distance = 763
spam score = 55
title = ''

distance = 778
spam score = 52
title = ''

distance = 825
spam score = 46
title = ''

distance = 830
spam score = 49
title = ''

distance = 841
spam score = 53
title = ''

distance = 859
spam score = 45
title = ''

distance = 869
spam score = 61
title = ''

distance = 874
spam score = 51
title = ''

distance = 885
spam score = 48
title = ''

distance = 929
spam score = 50
title = ''

distance = 949
spam score = 44
title = ''

distance = 973
spam score = 46
title = ''

distance = 980
spam score = 37
title = ''

distance = 1009
spam score = 50
title = ''

distance = 1019
spam score = 50
title = ''

distance = 1031
spam score = 69
title = ''

distance = 1035
spam score = 43
title = ''

distance = 1050
spam score = 64
title = ''

distance = 1050
spam score = 52
title = ''

distance = 1074
spam score = 54
title = ''

distance = 1094
spam score = 44
title = ''

distance = 1098
spam score = 36
title = ''

distance = 1107
spam score = 41
title = ''

distance = 1151
spam score = 43
title = ''

distance = 1174
spam score = 63
title = ''

distance = 1214
spam score = 57
title = ''

distance = 1270
spam score = 51
title = ''

distance = 1311
spam score = 57
title = ''

distance = 614
spam score = 74
title = ''

distance = 618
spam score = 67
title = ''

distance = 620
spam score = 67
title = ''

distance = 620
spam score = 76
title = ''

distance = 633
spam score = 67
title = ''

distance = 633
spam score = 77
title = ''

distance = 633
spam score = 66
title = ''

distance = 640
spam score = 67
title = ''

distance = 641
spam score = 65
title = ''

distance = 641
spam score = 70
title = ''

distance = 648
spam score = 70
title = ''

distance = 665
spam score = 67
title = ''

distance = 666
spam score = 68
title = ''

distance = 666
spam score = 69
title = ''

distance = 669
spam score = 69
title = ''

distance = 671
spam score = 75
title = ''

distance = 674
spam score = 79
title = ''

distance = 674
spam score = 75
title = ''

distance = 675
spam score = 78
title = ''

distance = 676
spam score = 78
title = ''

distance = 680
spam score = 83
title = ''

distance = 682
spam score = 82
title = ''

distance = 714
spam score = 71
title = ''

distance = 716
spam score = 77
title = ''

distance = 716
spam score = 67
title = ''

distance = 717
spam score = 71
title = ''

distance = 717
spam score = 67
title = ''

distance = 719
spam score = 67
title = ''

distance = 753
spam score = 77
title = ''

distance = 754
spam score = 83
title = ''

distance = 754
spam score = 74
title = ''

distance = 754
spam score = 82
title = ''

distance = 756
spam score = 79
title = ''

distance = 769
spam score = 70
title = ''

distance = 773
spam score = 81
title = ''

distance = 775
spam score = 62
title = ''

distance = 801
spam score = 81
title = ''

distance = 884
spam score = 68
title = ''

distance = 887
spam score = 69
title = ''

distance = 887
spam score = 70
title = ''

distance = 887
spam score = 74
title = ''

distance = 920
spam score = 56
title = ''

distance = 920
spam score = 64
title = ''

distance = 1115
spam score = 43
title = ''

distance = 1243
spam score = 33
title = ''

distance = 1299
spam score = 49
title = ''

distance = 1303
spam score = 68
title = ''

distance = 1306
spam score = 51
title = ''

distance = 1308
spam score = 53
title = ''

distance = 1320
spam score = 55
title = ''

distance = 1321
spam score = 61
title = ''

distance = 1322
spam score = 64
title = ''

distance = 1323
spam score = 63
title = ''

distance = 1327
spam score = 54
title = ''

distance = 1327
spam score = 64
title = ''

distance = 1356
spam score = 29
title = ''

distance = 1369
spam score = 32
title = ''

distance = 1369
spam score = 31
title = ''

distance = 1371
spam score = 42
title = ''

distance = 1376
spam score = 58
title = ''

distance = 1381
spam score = 55
title = ''

distance = 1383
spam score = 50
title = ''

distance = 1430
spam score = 41
title = ''

distance = 1433
spam score = 44
title = ''

distance = 1438
spam score = 44
title = ''

distance = 1492
spam score = 81
title = ''

distance = 1655
spam score = 76
title = ''

distance = 1765
spam score = 24
title = ''

distance = 563
spam score = 96
title = '6th international conference on business process management arc network in enterprise information infrastructure'

distance = 564
spam score = 97
title = 'research programs arc network in enterprise information infrastructure'

distance = 567
spam score = 97
title = 'create content arc network in enterprise information infrastructure'

distance = 571
spam score = 97
title = 'participants arc network in enterprise information infrastructure'

distance = 575
spam score = 97
title = 'associated research papers why it research is not science and why it matters arc network in enterprise information infrastructure'

distance = 581
spam score = 96
title = 'cit2008 arc network in enterprise information infrastructure'

distance = 586
spam score = 97
title = 'presentation why it research is not science and why it matters arc network in enterprise information infrastructure'

distance = 588
spam score = 96
title = 'collecter iberoamerica 2008 arc network in enterprise information infrastructure'

distance = 588
spam score = 97
title = 'contact arc network in enterprise information infrastructure'

distance = 589
spam score = 97
title = 'annual report 2006 arc network in enterprise information infrastructure'

distance = 591
spam score = 97
title = 'seal08 call for papers arc network in enterprise information infrastructure'

distance = 591
spam score = 97
title = 'eii annual report 2007 arc network in enterprise information infrastructure'

distance = 595
spam score = 97
title = 'adcom 2008 call for papers arc network in enterprise information infrastructure'

distance = 600
spam score = 97
title = 'pdcat03908 arc network in enterprise information infrastructure'

distance = 604
spam score = 97
title = '6th international conference on service oriented computing icsoc03908 arc network in enterprise information infrastructure'

distance = 604
spam score = 97
title = 'scientific workflow management and applications arc network in enterprise information infrastructure'

distance = 605
spam score = 97
title = 'eii activities 2006 arc network in enterprise information infrastructure'

distance = 607
spam score = 95
title = 'survey 2008 winter school on data management amp data quality arc network in enterprise information infrastructure'

distance = 609
spam score = 95
title = 'vertical applications arc network in enterprise information infrastructure'

distance = 610
spam score = 96
title = '2007 winter school in mathematical amp computational biology arc network in enterprise information infrastructure'

distance = 617
spam score = 97
title = 'umc08 cfp arc network in enterprise information infrastructure'

distance = 618
spam score = 97
title = 'eii activities 2008 arc network in enterprise information infrastructure'

distance = 620
spam score = 97
title = 'cods 2008 arc network in enterprise information infrastructure'

distance = 621
spam score = 97
title = '6th acm int workshop on mobility management amp wireless access arc network in enterprise information infrastructure'

distance = 626
spam score = 97
title = 'cfp workshop on logics for intelligent agents and multiagent systems arc network in enterprise information infrastructure'

distance = 626
spam score = 97
title = '2008 international workshop on contextaware pervasive communities arc network in enterprise information infrastructure'

distance = 627
spam score = 96
title = '2008 ieee international workshop on cyberspace safety and security arc network in enterprise information infrastructure'

distance = 630
spam score = 98
title = 'seminar qut08 arc network in enterprise information infrastructure'

distance = 632
spam score = 96
title = 'odcsss online dublin computer science summer school arc network in enterprise information infrastructure'

distance = 634
spam score = 97
title = 'cfp 2008 pacific rim knowledge acquisition workshop arc network in enterprise information infrastructure'

distance = 638
spam score = 97
title = 'member proposed projects arc network in enterprise information infrastructure'

distance = 639
spam score = 97
title = 'call for chapter proposals machine learning for human motion analysis arc network in enterprise information infrastructure'

distance = 640
spam score = 96
title = 'uq database amp data mining research workshop arc network in enterprise information infrastructure'

distance = 642
spam score = 97
title = 'ieeewicacm workshop on agents and data mining interaction 2008 arc network in enterprise information infrastructure'

distance = 643
spam score = 99
title = 'technology adoption amp impact arc network in enterprise information infrastructure'

distance = 650
spam score = 98
title = 'eii activities 2007 arc network in enterprise information infrastructure'

distance = 654
spam score = 97
title = 'behavioral biometrics for human identification intelligent applications arc network in enterprise information infrastructure'

distance = 654
spam score = 97
title = 'postdoctoral fellow in industrial information security rmit arc network in enterprise information infrastructure'

distance = 661
spam score = 96
title = 'eiisap phd research visit program arc network in enterprise information infrastructure'

distance = 663
spam score = 95
title = 'understanding the semantics of data provenance sudha ram arc network in enterprise information infrastructure'

distance = 671
spam score = 96
title = 'eii bpm taskforce outcomes published on bp trends arc network in enterprise information infrastructure'

distance = 672
spam score = 97
title = 'research assistant position griffith university qld arc network in enterprise information infrastructure'

distance = 676
spam score = 98
title = 'special issue on video analysis and understanding for surveillance application vausa arc network in enterprise information infrastructure'

distance = 678
spam score = 98
title = 'computing platforms arc network in enterprise information infrastructure'

distance = 684
spam score = 96
title = 'eii phd fellowships 36 months arc network in enterprise information infrastructure'

distance = 688
spam score = 96
title = 'eiiusyd seminars 2006 arc network in enterprise information infrastructure'

distance = 689
spam score = 97
title = 'enterprisecentric computing arc network in enterprise information infrastructure'

distance = 697
spam score = 96
title = 'cfp eccv08 workshop on machine learning for visionbased motion analysis arc network in enterprise information infrastructure'

distance = 701
spam score = 96
title = 'joseph davis arc network in enterprise information infrastructure'

distance = 705
spam score = 98
title = 'about eii arc network in enterprise information infrastructure'

distance = 721
spam score = 96
title = 'seminar series 2005 the university of queensland arc network in enterprise information infrastructure'

distance = 723
spam score = 97
title = 'research position macquarie university arc network in enterprise information infrastructure'

distance = 731
spam score = 98
title = 'rmit apai scholarship pattern recognition arc network in enterprise information infrastructure'

distance = 736
spam score = 98
title = 'network management stucture arc network in enterprise information infrastructure'

distance = 737
spam score = 98
title = 'cfp ieee intelligent systems special issue on agents and data mining arc network in enterprise information infrastructure'

distance = 752
spam score = 97
title = 'cfp special issue of ieee computer on trust management in web service environments arc network in enterprise information infrastructure'

distance = 754
spam score = 98
title = 'workshop on webbased enterprise information systems arc network in enterprise information infrastructure'

distance = 755
spam score = 97
title = 'australiachina workshop on ict infrastructure for wholeofwatercycle approach to water resource management arc network in enterprise information infrastructure'

distance = 757
spam score = 99
title = 'workshop on rfid data processing and management arc network in enterprise information infrastructure'

distance = 757
spam score = 97
title = 'internet commerce security postgraduate research scholarship arc network in enterprise information infrastructure'

distance = 800
spam score = 98
title = 'trust in distributed information infrastructures arc network in enterprise information infrastructure'

distance = 813
spam score = 79
title = 'project proposal arc network in enterprise information infrastructure'

distance = 813
spam score = 98
title = 'uts position open for visiting scholar arc network in enterprise information infrastructure'

distance = 814
spam score = 98
title = 'data quality management arc network in enterprise information infrastructure'

distance = 817
spam score = 97
title = 'understanding and extracting value from information technology it investments arc network in enterprise information infrastructure'

distance = 819
spam score = 97
title = 'security privacy amp trust arc network in enterprise information infrastructure'

distance = 824
spam score = 88
title = 'events arc network in enterprise information infrastructure'

distance = 826
spam score = 94
title = 'querying large graph databases jeffrey xu yu arc network in enterprise information infrastructure'

distance = 843
spam score = 98
title = 'eii phd fellowships arc network in enterprise information infrastructure'

distance = 897
spam score = 99
title = 'strategic systems arc network in enterprise information infrastructure'

distance = 973
spam score = 98
title = 'wireless sensor networks enriches largescale information systems arc network in enterprise information infrastructure'

distance = 1038
spam score = 87
title = 'rfid data processing amp management arc network in enterprise information infrastructure'

distance = 1156
spam score = 85
title = 'mobility and accessing information infrastructures arc network in enterprise information infrastructure'

distance = 1411
spam score = 84
title = 'kpraxis topic research management information management and academic research'

distance = 1411
spam score = 70
title = 'prof dr ramesh jain'

distance = 1423
spam score = 99
title = 'department of computer science knowledge and data management'

distance = 1431
spam score = 99
title = 'department of computer science knowledge and data management'

distance = 1434
spam score = 95
title = 'cis u860 seminar in information systems research'

distance = 1460
spam score = 90
title = 'nsf biosurveillance systems amp case studies workshop'

distance = 1471
spam score = 89
title = 'careers intelligent systems and bioinformatics laboratory'

distance = 1483
spam score = 66
title = 'gscit research supervisors'

distance = 1484
spam score = 89
title = 'html 5 computer science graduate seminar colloquia information systems'

distance = 1495
spam score = 2
title = 'cle information technology law institute outsourcing data'

distance = 1504
spam score = 87
title = 'lehigh university cse research'

distance = 1510
spam score = 94
title = 'dlist subject data mining'

distance = 1512
spam score = 89
title = 'bibliomining bibliography data mining in libraries'

distance = 1512
spam score = 85
title = 'bibliomining bibliography data mining in libraries'

distance = 1513
spam score = 87
title = 'bibliomining bibliography data mining in libraries'

distance = 1558
spam score = 72
title = 'cse computational sciences and engineering'

distance = 1559
spam score = 58
title = 'context aware retrieval'

distance = 1590
spam score = 91
title = 'a semantic web approach for access control management in pervasive environments'

distance = 1617
spam score = 95
title = 'list of publications mdash ist world'

distance = 1637
spam score = 42
title = 'filip perich publication issues in data management for pervasive environments'

distance = 1640
spam score = 96
title = 'dvs news archive'

distance = 1651
spam score = 84
title = 'uniroma3it comlab research security'

distance = 1661
spam score = 88
title = 'artificial intelligence lab'

distance = 1665
spam score = 65
title = 'person bhavani thuraisingham'

distance = 1679
spam score = 98
title = 'itc linux clusters'

distance = 1781
spam score = 71
title = 'maine first robotics coalition'

distance = 1815
spam score = 49
title = 'studio medico dott antonio fimiani'

distance = 1018
spam score = 7
title = ''

distance = 315
spam score = 47
title = ''

distance = 325
spam score = 68
title = ''

distance = 325
spam score = 60
title = ''

distance = 325
spam score = 47
title = ''

distance = 325
spam score = 47
title = ''

distance = 327
spam score = 71
title = ''

distance = 359
spam score = 46
title = ''

distance = 648
spam score = 43
title = ''

distance = 1219
spam score = 52
title = ''

distance = 1221
spam score = 58
title = ''

distance = 1224
spam score = 39
title = ''

distance = 1240
spam score = 57
title = ''

distance = 1241
spam score = 49
title = ''

distance = 1284
spam score = 52
title = ''

distance = 1326
spam score = 38
title = ''

distance = 1461
spam score = 48
title = ''

distance = 1858
spam score = 5
title = ''

distance = 517
spam score = 50
title = ''

distance = 522
spam score = 49
title = ''

distance = 527
spam score = 50
title = ''

distance = 529
spam score = 52
title = ''

distance = 562
spam score = 55
title = ''

distance = 572
spam score = 50
title = ''

distance = 590
spam score = 52
title = ''

distance = 601
spam score = 53
title = ''

distance = 603
spam score = 50
title = ''

distance = 605
spam score = 54
title = ''

distance = 623
spam score = 52
title = ''

distance = 627
spam score = 53
title = ''

distance = 627
spam score = 51
title = ''

distance = 629
spam score = 51
title = ''

distance = 649
spam score = 50
title = ''

distance = 658
spam score = 50
title = ''

distance = 658
spam score = 52
title = ''

distance = 659
spam score = 51
title = ''

distance = 663
spam score = 51
title = ''

distance = 672
spam score = 57
title = ''

distance = 675
spam score = 55
title = ''

distance = 676
spam score = 54
title = ''

distance = 689
spam score = 54
title = ''

distance = 707
spam score = 51
title = ''

distance = 717
spam score = 63
title = ''

distance = 720
spam score = 62
title = ''

distance = 725
spam score = 56
title = ''

distance = 729
spam score = 60
title = ''

distance = 729
spam score = 55
title = ''

distance = 730
spam score = 55
title = ''

distance = 735
spam score = 50
title = ''

distance = 746
spam score = 55
title = ''

distance = 762
spam score = 53
title = ''

distance = 765
spam score = 53
title = ''

distance = 774
spam score = 52
title = ''

distance = 792
spam score = 51
title = ''

distance = 803
spam score = 57
title = ''

distance = 809
spam score = 57
title = ''

distance = 826
spam score = 65
title = ''

distance = 843
spam score = 53
title = ''

distance = 888
spam score = 55
title = ''

distance = 888
spam score = 57
title = ''

distance = 915
spam score = 54
title = ''

distance = 925
spam score = 54
title = ''

distance = 941
spam score = 56
title = ''

distance = 941
spam score = 57
title = ''

distance = 948
spam score = 68
title = ''

distance = 952
spam score = 60
title = ''

distance = 954
spam score = 58
title = ''

distance = 1228
spam score = 65
title = ''

distance = 1271
spam score = 82
title = ''

distance = 1573
spam score = 70
title = ''

distance = 1576
spam score = 61
title = ''

distance = 1578
spam score = 58
title = ''

distance = 1617
spam score = 97
title = ''

distance = 1621
spam score = 93
title = ''

distance = 1623
spam score = 63
title = ''

distance = 1625
spam score = 21
title = ''

distance = 1625
spam score = 20
title = ''

distance = 1688
spam score = 80
title = ''

distance = 1689
spam score = 62
title = ''

distance = 1708
spam score = 45
title = ''

distance = 1740
spam score = 35
title = ''

distance = 1743
spam score = 21
title = ''

distance = 1769
spam score = 22
title = ''

distance = 291
spam score = 99
title = 'ntds element d02'

distance = 303
spam score = 99
title = 'ntds element d03'

distance = 306
spam score = 99
title = 'ntds element d04'

distance = 318
spam score = 99
title = 'ntds element d12'

distance = 325
spam score = 99
title = 'ntds element i09'

distance = 328
spam score = 99
title = 'ntds element i11'

distance = 329
spam score = 99
title = 'ntds element i10'

distance = 339
spam score = 99
title = 'ntds element p07'

distance = 346
spam score = 98
title = 'ntds element i03'

distance = 349
spam score = 99
title = 'ntds element d10'

distance = 350
spam score = 99
title = 'ntds element i01'

distance = 351
spam score = 99
title = 'ntds element ed05'

distance = 362
spam score = 99
title = 'ntds element d11'

distance = 374
spam score = 99
title = 'ntds element d01'

distance = 381
spam score = 99
title = 'ntds element ed04'

distance = 386
spam score = 99
title = 'ntds element p08'

distance = 387
spam score = 99
title = 'ntds element d08'

distance = 388
spam score = 99
title = 'ntds element p12'

distance = 389
spam score = 99
title = 'ntds element i12'

distance = 389
spam score = 99
title = 'ntds acknowledgements'

distance = 420
spam score = 99
title = 'ntds national trauma data standard'

distance = 422
spam score = 99
title = 'ntds element i04'

distance = 422
spam score = 99
title = 'ntds element p09'

distance = 422
spam score = 99
title = 'ntds element i05'

distance = 425
spam score = 99
title = 'ntds element p14'

distance = 425
spam score = 99
title = 'ntds element ed12'

distance = 427
spam score = 99
title = 'ntds element p10'

distance = 430
spam score = 99
title = 'ntds element ed11'

distance = 431
spam score = 99
title = 'ntds data elements'

distance = 432
spam score = 98
title = 'ntds element i16'

distance = 439
spam score = 99
title = 'ntds element i08'

distance = 448
spam score = 98
title = 'ntds element i15'

distance = 458
spam score = 99
title = 'ntds element ed08'

distance = 463
spam score = 99
title = 'ntds element ed09'

distance = 466
spam score = 98
title = 'ntds element ed03'

distance = 473
spam score = 99
title = 'ntds element ed13'

distance = 475
spam score = 99
title = 'ntds element ed06'

distance = 481
spam score = 99
title = 'ntds element i06'

distance = 492
spam score = 99
title = 'ntds element ed07'

distance = 496
spam score = 99
title = 'ntds element ed14'

distance = 563
spam score = 99
title = 'ntds element i14'

distance = 580
spam score = 99
title = 'ntds ntdb participants'

distance = 588
spam score = 99
title = 'ntds element p01'

distance = 593
spam score = 99
title = 'ntds the ntds'

distance = 595
spam score = 99
title = 'ntds element ed01'

distance = 597
spam score = 99
title = 'ntds getting started'

distance = 621
spam score = 98
title = 'ntds element p02'

distance = 625
spam score = 99
title = 'ntds compliant software'

distance = 655
spam score = 99
title = 'ntds element ed02'

distance = 671
spam score = 99
title = 'ntds state information'

distance = 727
spam score = 98
title = 'ntds dataset schema xsds'

distance = 731
spam score = 98
title = 'ntds element p06'

distance = 737
spam score = 99
title = 'ntds user groups amp discusions'

distance = 754
spam score = 99
title = 'ntds additional information'

distance = 757
spam score = 98
title = 'ntds element p03'

distance = 759
spam score = 98
title = 'ntds element p04'

distance = 828
spam score = 99
title = 'ntds letter of support'

distance = 835
spam score = 99
title = 'ntds ntdb federal information processing standards fips'

distance = 858
spam score = 99
title = 'ntds dataset components amp requirements'

distance = 873
spam score = 99
title = 'ntds the ntds archive'

distance = 963
spam score = 99
title = 'ntds software compliance testing'

distance = 981
spam score = 99
title = 'ntds what is the ntdb national trauma data standard'

distance = 1057
spam score = 99
title = 'ntds change policy'

distance = 1116
spam score = 98
title = 'nemsis data reporting'

distance = 1154
spam score = 99
title = 'nemsis data center'

distance = 1161
spam score = 99
title = 'ntds needs amp benefits'

distance = 1183
spam score = 99
title = 'nemsis what is nemsis'

distance = 1213
spam score = 99
title = 'nemsis data elements'

distance = 1245
spam score = 98
title = 'nemsis dataset dictionaries'

distance = 1269
spam score = 99
title = 'nemsis the project'

distance = 1327
spam score = 99
title = 'nemsis goals amp objectives'

distance = 1353
spam score = 99
title = 'nemsis change policy'

distance = 1354
spam score = 99
title = 'nemsis history of nemsis'

distance = 1405
spam score = 53
title = 'eyasco information'

distance = 1434
spam score = 90
title = 'eyasco monitoring control and security'

distance = 1437
spam score = 70
title = 'eyasco monitoring control and security'

distance = 1439
spam score = 41
title = 'integrated technology worcester data loggers'

distance = 1440
spam score = 72
title = 'jdcmg agenda and minutes'

distance = 1453
spam score = 71
title = 'chelan county'

distance = 1468
spam score = 69
title = 'healthcare monitoring of mobile patients'

distance = 1500
spam score = 93
title = 'parish census and parishioner updates'

distance = 1517
spam score = 86
title = 'utr utah trauma data dictionary'

distance = 1527
spam score = 99
title = 'nemsis articles'

distance = 1543
spam score = 59
title = 'ideate llc conversion analysis'

distance = 1543
spam score = 78
title = 'utr the system'

distance = 1548
spam score = 73
title = 'pipeline'

distance = 1555
spam score = 37
title = 'ideate llc foxpro on the internet experts'

distance = 1556
spam score = 48
title = 'ideate llc foxpro on the internet experts'

distance = 1565
spam score = 68
title = 'geosteering rigcomms software realtime geology data streaming software and geosteering services for horizontal drilling rtocs realtime data link'

distance = 1568
spam score = 66
title = 'metrolist mls prospector member services quattro'

distance = 1586
spam score = 87
title = 'pdsi at cmu projects'

distance = 1589
spam score = 67
title = 'geosteering rigcomms software realtime geology data streaming software and geosteering services for horizontal drilling integrating log data'

distance = 1592
spam score = 63
title = 'high performance computing sandia trilab page'

distance = 1604
spam score = 71
title = 'lightwave new style version 10'

distance = 1608
spam score = 62
title = 'deploying pvii pop menu magic in an accessible web site'

distance = 1616
spam score = 88
title = 'suresync file replication amp synchronization software for data availability file sharing amp file distribution'

distance = 1622
spam score = 64
title = 'jdcmg agenda and minutes'

distance = 1626
spam score = 72
title = 'jdcmg agenda and minutes'

distance = 1629
spam score = 72
title = 'free workbench introduction'

distance = 1639
spam score = 58
title = 'sci com gmbh scientific communication medicine neuro motor dysfunction'

distance = 1664
spam score = 96
title = 'waste management'

distance = 1741
spam score = 75
title = 'jdcmg agenda and minutes'

distance = 908
spam score = 45
title = ''

distance = 909
spam score = 33
title = ''

distance = 930
spam score = 44
title = ''

distance = 1316
spam score = 63
title = ''

distance = 697
spam score = 60
title = ''

distance = 702
spam score = 59
title = ''

distance = 711
spam score = 58
title = ''

distance = 810
spam score = 47
title = ''

distance = 812
spam score = 57
title = ''

distance = 812
spam score = 57
title = ''

distance = 821
spam score = 71
title = ''

distance = 828
spam score = 52
title = ''

distance = 833
spam score = 49
title = ''

distance = 900
spam score = 47
title = ''

distance = 1015
spam score = 50
title = ''

distance = 1086
spam score = 35
title = ''

distance = 1250
spam score = 44
title = ''

distance = 1768
spam score = 54
title = ''

distance = 1806
spam score = 22
title = ''

distance = 656
spam score = 72
title = ''

distance = 658
spam score = 56
title = ''

distance = 661
spam score = 69
title = ''

distance = 668
spam score = 73
title = ''

distance = 679
spam score = 72
title = ''

distance = 692
spam score = 74
title = ''

distance = 701
spam score = 78
title = ''

distance = 704
spam score = 81
title = ''

distance = 712
spam score = 54
title = ''

distance = 716
spam score = 71
title = ''

distance = 718
spam score = 72
title = ''

distance = 719
spam score = 53
title = ''

distance = 733
spam score = 71
title = ''

distance = 740
spam score = 76
title = ''

distance = 747
spam score = 70
title = ''

distance = 974
spam score = 66
title = ''

distance = 1264
spam score = 44
title = ''

distance = 1362
spam score = 88
title = ''

distance = 1366
spam score = 81
title = ''

distance = 1475
spam score = 88
title = ''

distance = 1516
spam score = 86
title = ''

distance = 1518
spam score = 82
title = ''

distance = 1525
spam score = 91
title = ''

distance = 1547
spam score = 93
title = ''

distance = 1554
spam score = 81
title = ''

distance = 0
spam score = 6
title = ''

distance = 1490
spam score = 9
title = ''

distance = 590
spam score = 31
title = 'econpapers deleted'

distance = 650
spam score = 47
title = 'econpapers club convergence regional spillovers in east java'

distance = 675
spam score = 43
title = 'econpapers keeping economic statistics relevant through updating the system of national accounts'

distance = 678
spam score = 68
title = 'econpapers adverse selection money and barter'

distance = 679
spam score = 39
title = 'econpapers rd investment and financing constraints of small and mediumsized firm'

distance = 703
spam score = 59
title = 'econpapers labor bonding'

distance = 704
spam score = 59
title = 'econpapers when curiosity kills the profits an experimental examination'

distance = 720
spam score = 37
title = 'econpapers technology and work the 21st century and its challenges'

distance = 724
spam score = 39
title = 'econpapers kresel beyin gc'

distance = 727
spam score = 57
title = 'econpapers models for ranking european institutions of higher learning with an application to data from greece'

distance = 728
spam score = 42
title = 'econpapers customer servicea need for survival'

distance = 737
spam score = 46
title = 'econpapers why companies go private in emerging markets evidence from poland'

distance = 740
spam score = 63
title = 'econpapers trust relations'

distance = 758
spam score = 44
title = 'econpapers immigration growth and distribution'

distance = 761
spam score = 50
title = 'econpapers inflation scares and monetary policy'

distance = 761
spam score = 48
title = 'econpapers dinero electronico'

distance = 762
spam score = 71
title = 'econpapers building blocks in the economics of mandates'

distance = 764
spam score = 42
title = 'econpapers the channels of monetary policy evidence from firm level data in the us and the uk'

distance = 765
spam score = 55
title = 'econpapers high technology employment and university rd spillovers evidence from us cities'

distance = 769
spam score = 44
title = 'econpapers rootnconsistent semiparametric estimation of a dynamic panel data model'

distance = 939
spam score = 46
title = 'econpapers endogenous growth and entrepreneurial activity in cities'

distance = 940
spam score = 33
title = 'econpapers coordination of fiscal policies in a monetary union'

distance = 940
spam score = 48
title = 'econpapers do reservation wages really decline some international evidence on the determinants of reservation wages'

distance = 941
spam score = 42
title = 'econpapers union decline in britain'

distance = 941
spam score = 45
title = 'econpapers an axiomatic theory of a risk dominance measure for bipolar games with linear incentives'

distance = 942
spam score = 45
title = 'econpapers ranking sets of objects'

distance = 942
spam score = 57
title = 'econpapers distributional outcomes in canada during the 1990s'

distance = 942
spam score = 36
title = 'econpapers economic growth and investment in the arab world'

distance = 943
spam score = 61
title = 'econpapers crime induced poverty traps'

distance = 943
spam score = 41
title = 'econpapers is it economics and psychology the case of hyperbolic discounting'

distance = 982
spam score = 42
title = 'econpapers tax system and reforms in europe spain'

distance = 983
spam score = 44
title = 'econpapers maastricht politiche fiscali e trasparenza dei conti pubblici'

distance = 983
spam score = 32
title = 'econpapers multiple bank lending relationships in italy their determinants and the role of firms governance features'

distance = 983
spam score = 43
title = 'econpapers les comptes du canal de suez analyse dun investissement pharaonique 18591869'

distance = 984
spam score = 42
title = 'econpapers the impact of immigration on the wage structure spain 19952002'

distance = 984
spam score = 42
title = 'econpapers in what circumstances is investment in hsr worthwhile'

distance = 984
spam score = 41
title = 'econpapers stochastic volatility'

distance = 984
spam score = 38
title = 'econpapers relaciones de causalidad entre consumo y pib'

distance = 984
spam score = 36
title = 'econpapers exclusive dealing entry and mergers'

distance = 984
spam score = 62
title = 'econpapers impossibility of risk sharing in an economy with asymmetric information'

distance = 1017
spam score = 54
title = 'econpapers methods for extracting the implied distributions in option prices'

distance = 1017
spam score = 43
title = 'econpapers general to specific modelling of exchange rate volatility a forecast evaluation'

distance = 1017
spam score = 65
title = 'econpapers quantum games and programmable quantum systems'

distance = 1018
spam score = 53
title = 'econpapers federal reserve regulations and glossary of terms appendix'

distance = 1018
spam score = 51
title = 'econpapers a structural empirical model of firm growth learning and survival'

distance = 1020
spam score = 41
title = 'econpapers trend stability and structural change an extension to the m1 forecasting competition'

distance = 1020
spam score = 55
title = 'econpapers beggar thy thrifty neighbour the international spillover effects of pensions under population ageing'

distance = 1020
spam score = 43
title = 'econpapers qualitative answering surveys and soft computing'

distance = 1020
spam score = 42
title = 'econpapers federal securities regulations and stock market returns'

distance = 1021
spam score = 66
title = 'econpapers forecasting with real business cycle models'

distance = 1050
spam score = 42
title = 'econpapers on the effects of career choice matching efficiency of different occupations and education levels'

distance = 1050
spam score = 67
title = 'econpapers strategy competition and diversification in european and mexican banking'

distance = 1051
spam score = 44
title = 'econpapers simple formulas to option pricing and hedging in the black scholes model'

distance = 1051
spam score = 67
title = 'econpapers works councils in the production process'

distance = 1051
spam score = 52
title = 'econpapers works councils and the anatomy of wages'

distance = 1051
spam score = 61
title = 'econpapers modelling in innovation process'

distance = 1051
spam score = 59
title = 'econpapers will international rules on subsidies disrupt the world trading system'

distance = 1051
spam score = 38
title = 'econpapers altruism intergenerational transfers of time and bequests'

distance = 1052
spam score = 60
title = 'econpapers actualities in logistics and transport'

distance = 1052
spam score = 67
title = 'econpapers a longitudinal study of one organizations culture do values endure'

distance = 1083
spam score = 56
title = 'econpapers online data management system for onfarm trials'

distance = 1084
spam score = 35
title = 'econpapers modelling international bond markets with affine term structure models'

distance = 1084
spam score = 38
title = 'econpapers legal system efficiency information production and technological choice a banking model'

distance = 1084
spam score = 49
title = 'econpapers intergovernmental grants and bureaucratic power'

distance = 1084
spam score = 69
title = 'econpapers nonparametric estimation and symmetry tests for conditional density functions'

distance = 1084
spam score = 48
title = 'econpapers merging the purchasing power parity and the phillips curve literatures regional evidence from italy'

distance = 1084
spam score = 54
title = 'econpapers can information asymmetry cause agglomeration'

distance = 1085
spam score = 63
title = 'econpapers complementarities in information acquisition with shortterm trades'

distance = 1085
spam score = 48
title = 'econpapers asymptotics for random effects models with serial correlation'

distance = 1086
spam score = 64
title = 'econpapers changes and entails on romanian retail market'

distance = 1116
spam score = 45
title = 'econpapers how mandatory pensions affect labor supply decisions and human capital accumulation options to bridge the gap between economic theory and policy analysis'

distance = 1116
spam score = 37
title = 'econpapers courts delays and crime deterrence an application to crimes against property in italy'

distance = 1116
spam score = 59
title = 'econpapers metabolism of social system'

distance = 1116
spam score = 55
title = 'econpapers the political robustness in indonesia'

distance = 1117
spam score = 51
title = 'econpapers why are promotions less likely in nonprofit firms'

distance = 1117
spam score = 46
title = 'econpapers financial contagion evolutionary optimisation of a multinational agentbased model'

distance = 1118
spam score = 50
title = 'econpapers monetary policy by committeeconsensus chairman dominance or simple majority'

distance = 1118
spam score = 39
title = 'econpapers international crosslisting the effects of market fragmentation and information flows'

distance = 1119
spam score = 44
title = 'econpapers immigrants language skills the australian experience in a longitudinal survey'

distance = 1119
spam score = 42
title = 'econpapers statistics under the spotlight improving the consumer price index'

distance = 1149
spam score = 42
title = 'econpapers skillbiased technological change international trade and the wage structure'

distance = 1149
spam score = 53
title = 'econpapers who decides on public expenditures a political economy analysis of the budget process the case of argentina'

distance = 1150
spam score = 53
title = 'econpapers doam for evolutionary portfolio optimization a computational study'

distance = 1150
spam score = 54
title = 'econpapers can information asymmetry cause agglomeration'

distance = 1150
spam score = 48
title = 'econpapers senior jevons e walras a construo da ortodoxia econmica'

distance = 1150
spam score = 36
title = 'econpapers ethnicity and the immigration of highly skilled workers to the united states'

distance = 1152
spam score = 61
title = 'econpapers optimal combination forecasts for hierarchical time series'

distance = 1153
spam score = 59
title = 'econpapers testing the monetary policy implications of the accelerationist phillips curve'

distance = 1153
spam score = 36
title = 'econpapers merging the purchasing power parity and the phillips curve literatures regional evidence from italy'

distance = 1153
spam score = 67
title = 'econpapers solutions for test of suprem penetration ability of competitors on international markets'

distance = 1207
spam score = 72
title = 'econpapers rfid technnology new challenge for manufacturing and logistics centers'

distance = 1208
spam score = 36
title = 'econpapers inductive inference an axiomatic approach'

distance = 1208
spam score = 42
title = 'econpapers generalized dynamic factor model garch'

distance = 1208
spam score = 65
title = 'econpapers unit roots change and decision bounds'

distance = 1208
spam score = 41
title = 'econpapers firstprice auctions when the ranking of valuations'

distance = 1209
spam score = 66
title = 'econpapers exchange rate intervention market efficiency and asset market returns the greek experience'

distance = 1210
spam score = 41
title = 'econpapers fertility of turkish and moroccan women in the netherlands adjustment to native level within one generation'

distance = 1210
spam score = 41
title = 'econpapers sustainable preferences and damage abatementvalue judgments and implications for consumption streams'

distance = 1210
spam score = 47
title = 'econpapers avoiding liability for communicating information on managerial and professional employees'

distance = 1211
spam score = 46
title = 'econpapers putting your money where your mouth is a betting platform for better prediction'

distance = 1362
spam score = 35
title = 'econpapers monotone methods for equilibrium selection under perfect foresight dynamics'

distance = 1416
spam score = 38
title = 'econpapers actorii implicati in ciclul politicilor publice stakeholderi ai politicilor publice'

distance = 1423
spam score = 57
title = 'econpapers departmental working papers'

distance = 1429
spam score = 55
title = 'econpapers sifat statistika data ekonomi keuangan'

distance = 1502
spam score = 47
title = 'econpapers comparing an individualbased model of behaviour diffusion with its mean field aggregate approximation'

distance = 1539
spam score = 49
title = 'econpapers discussion papers'

distance = 653
spam score = 26
title = 'a006dll a s'

distance = 668
spam score = 20
title = 'a0067423exe a s'

distance = 669
spam score = 22
title = 'a0067428exe a s'

distance = 730
spam score = 21
title = 'a0011142exe a s'

distance = 756
spam score = 22
title = 'tdll t s'

distance = 756
spam score = 20
title = 'sdll s s'

distance = 785
spam score = 26
title = 'c7vdll c s'

distance = 794
spam score = 21
title = 'g181511astubexe g s'

distance = 813
spam score = 20
title = 'udll u s'

distance = 821
spam score = 22
title = 'x1exe x s'

distance = 824
spam score = 16
title = 'nexe n s'

distance = 826
spam score = 16
title = 's1p1ybadexe s s'

distance = 832
spam score = 25
title = 's1p1ybadexe s s'

distance = 835
spam score = 19
title = 'mtriplauncherexe m s'

distance = 840
spam score = 20
title = 'b2searchv17exe b s'

distance = 849
spam score = 21
title = 'k4eboy6exe k s'

distance = 850
spam score = 21
title = 'p2pnetworkingexe p s'

distance = 859
spam score = 22
title = 'maexe m s'

distance = 861
spam score = 17
title = 'backdoorprorat13exe b s'

distance = 862
spam score = 20
title = '009exe other s'

distance = 976
spam score = 17
title = '30exe other s'

distance = 976
spam score = 14
title = '202app13exe other s'

distance = 976
spam score = 13
title = 'bpcexe b s'

distance = 976
spam score = 21
title = 'marioexe m s'

distance = 977
spam score = 15
title = 'othbexe o s'

distance = 978
spam score = 15
title = 'binexe b s'

distance = 979
spam score = 14
title = 'hidrexe h s'

distance = 981
spam score = 13
title = 'mnew5winexe m s'

distance = 982
spam score = 22
title = 'dssagentexe d s'

distance = 984
spam score = 13
title = 'm2exe m s'

distance = 1009
spam score = 13
title = 'msiapidll m s'

distance = 1009
spam score = 14
title = 'scanregistryexe s s'

distance = 1010
spam score = 27
title = '180axexe other s'

distance = 1010
spam score = 16
title = 'ginst00112344201exe g s'

distance = 1010
spam score = 13
title = 'dvdplayexe d s'

distance = 1010
spam score = 13
title = 'hddtryuexe h s'

distance = 1010
spam score = 13
title = 'msmsgsisexe m s'

distance = 1010
spam score = 14
title = 'wapiitexe w s'

distance = 1011
spam score = 23
title = 'bbi8032exe b s'

distance = 1011
spam score = 18
title = 'wapiitexe w s'

distance = 1034
spam score = 18
title = 'safesearchexe s s'

distance = 1034
spam score = 21
title = 'uninscexe u s'

distance = 1034
spam score = 12
title = 'hbginadll h s'

distance = 1034
spam score = 13
title = 'mwinsyexe m s'

distance = 1035
spam score = 12
title = 'frundlllexe f s'

distance = 1035
spam score = 22
title = 'ncaseinstallerdll n s'

distance = 1035
spam score = 15
title = 'quickbooks q s'

distance = 1035
spam score = 19
title = 'fcexe f s'

distance = 1035
spam score = 11
title = 'kernels64exe k s'

distance = 1035
spam score = 18
title = 'scexe s s'

distance = 1054
spam score = 17
title = 'abrircartaoexe a s'

distance = 1055
spam score = 15
title = 'ecfmservexe e s'

distance = 1055
spam score = 15
title = 'ginstallerdll g s'

distance = 1055
spam score = 13
title = 'hgzserverexe h s'

distance = 1056
spam score = 16
title = 'lcdpop3exe l s'

distance = 1056
spam score = 19
title = 'hackerexe h s'

distance = 1056
spam score = 16
title = 'iexplorerexe i s'

distance = 1056
spam score = 18
title = 'keenvalueexe k s'

distance = 1056
spam score = 11
title = 'timecom t s'

distance = 1056
spam score = 16
title = 'hgzserverexe h s'

distance = 1075
spam score = 17
title = 'navappexe n s'

distance = 1075
spam score = 15
title = '2ndsrchdll other s'

distance = 1075
spam score = 12
title = 'ftpuexe f s'

distance = 1076
spam score = 15
title = 'alg32exe a s'

distance = 1076
spam score = 14
title = 'tthookdll t s'

distance = 1076
spam score = 14
title = 'qtzgacerexe q s'

distance = 1077
spam score = 12
title = 'lsassaexe l s'

distance = 1077
spam score = 18
title = 'taskgmrexe t s'

distance = 1077
spam score = 14
title = 'saveexe s s'

distance = 1078
spam score = 14
title = '2portalmonexe other s'

distance = 1110
spam score = 22
title = 'vaioupdtexe v s'

distance = 1110
spam score = 16
title = 'tvmupdaterexe t s'

distance = 1111
spam score = 22
title = 'nclaunchexe n s'

distance = 1112
spam score = 18
title = 'mainservexe m s'

distance = 1112
spam score = 13
title = 'ggviewerexe g s'

distance = 1112
spam score = 15
title = 'getrightexe g s'

distance = 1113
spam score = 18
title = 'ncltrayexe n s'

distance = 1113
spam score = 14
title = 'mcexe m s'

distance = 1114
spam score = 17
title = 'backweb137903exe b s'

distance = 1114
spam score = 14
title = 'bcresidentexe b s'

distance = 1142
spam score = 22
title = 'qbupdateexe q s'

distance = 1145
spam score = 17
title = 'ghoststartserviceexe g s'

distance = 1145
spam score = 14
title = 'hkcmdexe h s'

distance = 1146
spam score = 20
title = 'fbdirectexe f s'

distance = 1147
spam score = 12
title = 'camviewerexe c s'

distance = 1147
spam score = 17
title = 'htpatchexe h s'

distance = 1148
spam score = 13
title = 'ebrrexe e s'

distance = 1149
spam score = 14
title = 'mcdetectexe m s'

distance = 1149
spam score = 18
title = 'mainexe m s'

distance = 1149
spam score = 16
title = 'hdaudpropresdll h s'

distance = 1187
spam score = 13
title = 'acprfmgrsvcexe a s'

distance = 1189
spam score = 11
title = 'kenftpgwexe k s'

distance = 1191
spam score = 19
title = 'qconsvcexe q s'

distance = 1193
spam score = 21
title = 'launcherexe l s'

distance = 1193
spam score = 13
title = 'readericon45gexe r s'

distance = 1193
spam score = 21
title = 'jrunexe j s'

distance = 1193
spam score = 16
title = 'calmainexe c s'

distance = 1193
spam score = 10
title = 'neoexe n s'

distance = 1193
spam score = 19
title = 'qcleanexe q s'

distance = 1193
spam score = 14
title = 'saproxyexe s s'

distance = 1934
spam score = 63
title = 'cancal resources ltd'

distance = 617
spam score = 56
title = 'statistics finland statistics by topic regional and industrial statistics on services'

distance = 633
spam score = 50
title = 'statistics finland tilastot aiheittain inservice training statistics'

distance = 634
spam score = 76
title = 'statistics finland metadata contact information'

distance = 635
spam score = 51
title = 'statistics finland statistics by topic sterilisations'

distance = 645
spam score = 79
title = 'statistics finland metadata contact information'

distance = 645
spam score = 48
title = 'statistics finland other data collections'

distance = 649
spam score = 46
title = 'statistics finland statistics by topic deaths'

distance = 650
spam score = 54
title = 'statistics finland statistics by topic finnish enterprises'

distance = 655
spam score = 47
title = 'statistics finland statistics by topic deaths'

distance = 664
spam score = 53
title = 'tilastokeskus enterprises statistics on agriculture'

distance = 670
spam score = 50
title = 'tilastokeskus enterprises data collection on occupations'

distance = 670
spam score = 56
title = 'statistics finland statistics by topic waste statistics'

distance = 701
spam score = 52
title = 'statistics finland statistics by topic transit transport statistics'

distance = 703
spam score = 52
title = 'statistics finland statistics by topic polytechnic education'

distance = 705
spam score = 59
title = 'statistics finland statistics by topic telecommunications'

distance = 708
spam score = 53
title = 'statistics finland statistics by topic polytechnic education'

distance = 711
spam score = 61
title = 'statistics finland statistics by topic egg production statistics'

distance = 711
spam score = 55
title = 'tilastokeskus households use of information and communications technology'

distance = 711
spam score = 51
title = 'statistics finland statistics by topic use of information technology in enterprises'

distance = 712
spam score = 65
title = 'statistics finland statistics by topic research and development'

distance = 873
spam score = 58
title = 'tilastokeskus enterprises periodical survey of wholesale trade'

distance = 873
spam score = 60
title = 'statistics finland'

distance = 874
spam score = 56
title = 'statistics finland statistics by topic municipal elections'

distance = 874
spam score = 60
title = 'statistics finland'

distance = 874
spam score = 71
title = 'statistics finland tilastot aiheittain use of information and communications technology'

distance = 874
spam score = 73
title = 'statistics finland agriculture forestry and fishery agricultural enterprise and income statistics'

distance = 875
spam score = 69
title = 'statistics finland prices and costs cost index of rail transport'

distance = 875
spam score = 80
title = 'statistics finland agriculture forestry and fishery agricultural enterprise and income statistics'

distance = 876
spam score = 56
title = 'tilastokeskus enterprises environmental protection expenditure in industry'

distance = 877
spam score = 87
title = 'statistics finland the statistics act'

distance = 928
spam score = 44
title = 'statistics finland statistics by topic income and expenditure of foreign sea transport'

distance = 928
spam score = 79
title = 'statistics finland agriculture forestry and fishery number of pigs'

distance = 928
spam score = 51
title = 'tilastokeskus enterprises inquiry for industrial establishments t5'

distance = 928
spam score = 74
title = 'statistics finland social protection social assistance'

distance = 928
spam score = 64
title = 'statistics finland income and consumption income distribution statistics'

distance = 928
spam score = 64
title = 'statistics finland statistics by topic wood consumption'

distance = 928
spam score = 55
title = 'tilastokeskus households income and living conditions survey'

distance = 929
spam score = 72
title = 'statistics finland income and consumption income distribution statistics'

distance = 930
spam score = 66
title = 'statistics finland income and consumption income distribution statistics'

distance = 930
spam score = 66
title = 'statistics finland statistical legislation'

distance = 1001
spam score = 74
title = 'statistics finland mutual fund inquiry'

distance = 1001
spam score = 85
title = 'statistics finland statistical yearbook of finland online service'

distance = 1002
spam score = 77
title = 'statistics finland agriculture forestry and fishery stumpage price indexes'

distance = 1002
spam score = 57
title = 'statistics finland statistics by topic transition from school to further education and work'

distance = 1002
spam score = 58
title = 'tilastokeskus enterprises telecommunications inquiry'

distance = 1003
spam score = 73
title = 'statistics finland agriculture forestry and fishery stumpage price indexes'

distance = 1004
spam score = 84
title = 'statistics finland mutual fund inquiry'

distance = 1005
spam score = 65
title = 'statistics finland justice coercive measures'

distance = 1006
spam score = 60
title = 'statistics finland about statistics high technology foreign trade'

distance = 1006
spam score = 53
title = 'tilastokeskus enterprises the inquiry on financial accounts'

distance = 1057
spam score = 75
title = 'statistics finland wages salaries and labour costs index of wage and salary earnings'

distance = 1058
spam score = 72
title = 'statistics finland health health expenditure and financing'

distance = 1058
spam score = 72
title = 'statistics finland health health expenditure and financing'

distance = 1058
spam score = 76
title = 'statistics finland maintenance of appendix tables in excel format will be discontinued in the statistics describing turnover in construction'

distance = 1059
spam score = 71
title = 'statistics finland about statistics meat production by area'

distance = 1060
spam score = 59
title = 'statistikcentralen official statistics of finland osf'

distance = 1060
spam score = 77
title = 'statistics finland health alcoholic beverage consumption'

distance = 1061
spam score = 49
title = 'statistics finland tilastot aiheittain finnish travel'

distance = 1061
spam score = 71
title = 'statistics finland statistics by topic number of other livestock species'

distance = 1062
spam score = 71
title = 'statistics finland world in figures tables'

distance = 1102
spam score = 58
title = 'statistics finland about statistics utilised agricultural area'

distance = 1102
spam score = 67
title = 'statistics finland about statistics alcoholic beverage consumption'

distance = 1103
spam score = 74
title = 'statistics finland housing dwelling stock'

distance = 1104
spam score = 70
title = 'statistics finland income and expenditure of foreign sea transport'

distance = 1105
spam score = 77
title = 'statistics finland education special education'

distance = 1105
spam score = 56
title = 'statistics finland about statistics production of electricity and heat'

distance = 1106
spam score = 66
title = 'statistics finland housing dwelling stock'

distance = 1106
spam score = 82
title = 'statistics finland about statistics mass media'

distance = 1107
spam score = 73
title = 'statistics finland trade periodical survey of retail trade'

distance = 1107
spam score = 64
title = 'statistics finland education vocational education'

distance = 1153
spam score = 56
title = 'statistics finland about statistics public sector environmental protection expenditure'

distance = 1154
spam score = 70
title = 'statistics finland price list'

distance = 1155
spam score = 57
title = 'statistics finland about statistics energy use in manufacturing'

distance = 1155
spam score = 80
title = 'statistics finland online statistics course demography and population statistics basic demographic data'

distance = 1155
spam score = 63
title = 'statistics finland volume of goods transported by lorries grew'

distance = 1155
spam score = 75
title = 'statistics finland research services research laboratory of enterprise data introduction'

distance = 1155
spam score = 66
title = 'statistics finland about statistics building and dwelling production'

distance = 1159
spam score = 76
title = 'statistics finland russia and baltics database'

distance = 1160
spam score = 81
title = 'statistics finland online statistics course demography and population statistics basic demographic data'

distance = 1160
spam score = 47
title = 'statistics finland about statistics public legal aid'

distance = 1207
spam score = 65
title = 'statistics finland about statistics transition from school to further education and work'

distance = 1207
spam score = 72
title = 'statistics finland periodical survey of retail trade'

distance = 1207
spam score = 70
title = 'statistics finland reporting institutions'

distance = 1208
spam score = 75
title = 'statistics finland international official statistics'

distance = 1208
spam score = 86
title = 'statistics finland data collections obligation to provide data'

distance = 1208
spam score = 63
title = 'statistics finland periodical survey of wholesale trade'

distance = 1209
spam score = 58
title = 'statistics finland questionnaires and instructions'

distance = 1210
spam score = 52
title = 'statistics finland about statistics central government guarantees'

distance = 1210
spam score = 64
title = 'statistics finland national accounts trend indicator of output'

distance = 1210
spam score = 57
title = 'statistics finland about statistics index of wage and salary earnings'

distance = 1266
spam score = 80
title = 'statistics finland about statistics employment'

distance = 1267
spam score = 56
title = 'statistics finland about statistics financial statement statistics on business services'

distance = 1267
spam score = 58
title = 'statistics finland about statistics students and qualifications of educational institutions'

distance = 1268
spam score = 57
title = 'statistics finland about statistics financial statement statistics on transport'

distance = 1268
spam score = 59
title = 'statistics finland wages salaries and labour costs wage and salary indices'

distance = 1269
spam score = 63
title = 'statistics finland about statistics financial statement statistics on construction'

distance = 1271
spam score = 60
title = 'statistics finland about statistics financial statement statistics on transport'

distance = 1271
spam score = 64
title = 'statistics finland about statistics greenhouse gases'

distance = 1271
spam score = 71
title = 'statistics finland online statistics course demography and population statistics basic demographic data population registers'

distance = 1272
spam score = 67
title = 'statistics finland about statistics central government monthly salaries'

distance = 1751
spam score = 82
title = ''

distance = 1871
spam score = 9
title = 'freestyle skiing virginie costerg france results statistics and identity information'

distance = 1912
spam score = 9
title = 'freestyle skiing anais caradeux france results statistics and identity information'

distance = 571
spam score = 48
title = 'information system waikato linux users group'

distance = 588
spam score = 45
title = 'information system waikato linux users group'

distance = 636
spam score = 45
title = 'jfs waikato linux users group'

distance = 669
spam score = 52
title = 'secure coding review waikato linux users group'

distance = 671
spam score = 55
title = 'information systems waikato linux users group'

distance = 694
spam score = 65
title = 'yaml waikato linux users group'

distance = 704
spam score = 63
title = 'sine apps waikato linux users group'

distance = 725
spam score = 68
title = 'secure coding review waikato linux users group'

distance = 744
spam score = 68
title = 'hierarchical data base waikato linux users group'

distance = 747
spam score = 54
title = 'hierarchical data base waikato linux users group'

distance = 750
spam score = 47
title = 'eagain waikato linux users group'

distance = 763
spam score = 79
title = 'algorithm waikato linux users group'

distance = 772
spam score = 75
title = 'man page waikato linux users group'

distance = 803
spam score = 57
title = 'meta data waikato linux users group'

distance = 804
spam score = 50
title = 'middle ware waikato linux users group'

distance = 824
spam score = 48
title = 'perfect forward secrecy waikato linux users group'

distance = 830
spam score = 65
title = 'meta data waikato linux users group'

distance = 832
spam score = 50
title = 'networks5 waikato linux users group'

distance = 836
spam score = 43
title = 'runlevel8 waikato linux users group'

distance = 843
spam score = 50
title = 'snort waikato linux users group'

distance = 858
spam score = 43
title = 'net ware waikato linux users group'

distance = 862
spam score = 60
title = 'copy on write waikato linux users group'

distance = 874
spam score = 59
title = 'data base waikato linux users group'

distance = 879
spam score = 63
title = 'reiser fs waikato linux users group'

distance = 893
spam score = 53
title = 'copy on write waikato linux users group'

distance = 895
spam score = 56
title = 'dictionary of computing isbn0004343492 waikato linux users group'

distance = 896
spam score = 80
title = 'work force waikato linux users group'

distance = 896
spam score = 66
title = 'luser waikato linux users group'

distance = 897
spam score = 43
title = 'proc file system waikato linux users group'

distance = 903
spam score = 45
title = 'frame relay waikato linux users group'

distance = 914
spam score = 50
title = 'frame relay waikato linux users group'

distance = 915
spam score = 75
title = 'haskell waikato linux users group'

distance = 921
spam score = 57
title = 'knoppix notes waikato linux users group'

distance = 925
spam score = 48
title = 'proc file system waikato linux users group'

distance = 927
spam score = 65
title = 'modula 2 waikato linux users group'

distance = 929
spam score = 61
title = 'system administrator waikato linux users group'

distance = 930
spam score = 62
title = 'mega byte waikato linux users group'

distance = 931
spam score = 43
title = 'binary tree waikato linux users group'

distance = 932
spam score = 54
title = 'mo dem waikato linux users group'

distance = 933
spam score = 45
title = 'binary tree waikato linux users group'

distance = 936
spam score = 44
title = 'ldd1 waikato linux users group'

distance = 943
spam score = 38
title = 'vdsl waikato linux users group'

distance = 947
spam score = 36
title = '10 base 5 waikato linux users group'

distance = 958
spam score = 63
title = 'system administrator waikato linux users group'

distance = 962
spam score = 44
title = 'symmetric multi processing waikato linux users group'

distance = 963
spam score = 47
title = 'symmetric multi processing waikato linux users group'

distance = 985
spam score = 59
title = 'ethernet waikato linux users group'

distance = 990
spam score = 53
title = 'nss waikato linux users group'

distance = 991
spam score = 52
title = 'nss waikato linux users group'

distance = 999
spam score = 51
title = 'ethernet waikato linux users group'

distance = 1001
spam score = 50
title = 'interleaving waikato linux users group'

distance = 1008
spam score = 60
title = 'systems engineer waikato linux users group'

distance = 1013
spam score = 50
title = 'opportunistic encryption waikato linux users group'

distance = 1013
spam score = 55
title = 'tty4 waikato linux users group'

distance = 1014
spam score = 74
title = 'systems engineer waikato linux users group'

distance = 1014
spam score = 49
title = 'mrtg waikato linux users group'

distance = 1015
spam score = 57
title = 'serialisation waikato linux users group'

distance = 1016
spam score = 75
title = 'sub version waikato linux users group'

distance = 1017
spam score = 66
title = 'utp waikato linux users group'

distance = 1019
spam score = 65
title = 'sml waikato linux users group'

distance = 1019
spam score = 64
title = 'serialisation waikato linux users group'

distance = 1023
spam score = 52
title = 'irq waikato linux users group'

distance = 1025
spam score = 65
title = 'mrtg waikato linux users group'

distance = 1028
spam score = 56
title = 'tty4 waikato linux users group'

distance = 1030
spam score = 52
title = 'advanced security notes waikato linux users group'

distance = 1037
spam score = 47
title = 'qemu notes waikato linux users group'

distance = 1039
spam score = 67
title = 'interleaving waikato linux users group'

distance = 1054
spam score = 60
title = 'sys fs waikato linux users group'

distance = 1055
spam score = 64
title = 'dvd waikato linux users group'

distance = 1081
spam score = 64
title = 'xtra waikato linux users group'

distance = 1083
spam score = 69
title = 'cisco systems waikato linux users group'

distance = 1107
spam score = 79
title = 'active directory waikato linux users group'

distance = 1126
spam score = 80
title = 'active directory waikato linux users group'

distance = 1136
spam score = 74
title = 'amateur radio waikato linux users group'

distance = 1149
spam score = 51
title = 'hoiho acceptable use policy waikato linux users group'

distance = 1164
spam score = 60
title = 'public key encryption waikato linux users group'

distance = 1164
spam score = 70
title = 'hoiho acceptable use policy waikato linux users group'

distance = 1169
spam score = 65
title = 'bung game engine waikato linux users group'

distance = 1176
spam score = 64
title = 'meeting topics20060724 waikato linux users group'

distance = 1185
spam score = 83
title = 'ldap system administration review waikato linux users group'

distance = 1202
spam score = 60
title = 'process group waikato linux users group'

distance = 1207
spam score = 38
title = 'raid notes waikato linux users group'

distance = 1216
spam score = 59
title = 'shell waikato linux users group'

distance = 1226
spam score = 57
title = 'relational data base waikato linux users group'

distance = 1235
spam score = 60
title = 'cacti waikato linux users group'

distance = 1238
spam score = 71
title = 'cacti waikato linux users group'

distance = 1239
spam score = 53
title = 'relational data base waikato linux users group'

distance = 1245
spam score = 59
title = 'token ring waikato linux users group'

distance = 1246
spam score = 46
title = 'vmstat8 waikato linux users group'

distance = 1260
spam score = 80
title = 'linux netlink sockets waikato linux users group'

distance = 1402
spam score = 45
title = 'raid waikato linux users group'

distance = 1407
spam score = 45
title = 'wal waikato linux users group'

distance = 1411
spam score = 44
title = 'wal waikato linux users group'

distance = 1415
spam score = 32
title = 'mlockall2 waikato linux users group'

distance = 1455
spam score = 55
title = 'linux io scheduler waikato linux users group'

distance = 1463
spam score = 48
title = 'linux io scheduler waikato linux users group'

distance = 1537
spam score = 38
title = 'related local user groups'

distance = 1548
spam score = 46
title = 'open ldap access controls waikato linux users group'

distance = 1554
spam score = 48
title = 'open ldap access controls waikato linux users group'

distance = 1707
spam score = 38
title = 'openswan users openswan ip xfrm policy shows different datathan etcipsecconf'

distance = 1747
spam score = 22
title = ''

distance = 1811
spam score = 76
title = 'number of internet users reaches 1 billion'

distance = 352
spam score = 77
title = 'buoy data 41015'

distance = 354
spam score = 83
title = 'buoy data 46a47'

distance = 355
spam score = 78
title = 'buoy data 51026'

distance = 355
spam score = 78
title = 'buoy data 91204'

distance = 357
spam score = 83
title = 'buoy data 46069'

distance = 357
spam score = 76
title = 'buoy data 42011'

distance = 357
spam score = 77
title = 'buoy data 44028'

distance = 357
spam score = 78
title = 'buoy data 42054'

distance = 357
spam score = 78
title = 'buoy data 42014'

distance = 357
spam score = 80
title = 'buoy data 41016'

distance = 358
spam score = 78
title = 'buoy data 51027'

distance = 358
spam score = 80
title = 'buoy data 46b54'

distance = 358
spam score = 77
title = 'buoy data 51005'

distance = 358
spam score = 76
title = 'buoy data 42038'

distance = 358
spam score = 73
title = 'buoy data 46045'

distance = 359
spam score = 79
title = 'buoy data 41022'

distance = 359
spam score = 81
title = 'buoy data 46033'

distance = 359
spam score = 80
title = 'buoy data 42010'

distance = 360
spam score = 82
title = 'buoy data 42006'

distance = 360
spam score = 80
title = 'buoy data 44026'

distance = 386
spam score = 67
title = 'buoy data 46008'

distance = 386
spam score = 56
title = 'buoy data 44009'

distance = 387
spam score = 68
title = 'buoy data 42058'

distance = 387
spam score = 69
title = 'buoy data 46038'

distance = 388
spam score = 60
title = 'buoy data 46026'

distance = 388
spam score = 70
title = 'buoy data 46089'

distance = 388
spam score = 63
title = 'buoy data 46010'

distance = 389
spam score = 76
title = 'buoy data 46082'

distance = 389
spam score = 69
title = 'buoy data 46016'

distance = 389
spam score = 62
title = 'buoy data 42040'

distance = 409
spam score = 80
title = 'buoy data pagp2'

distance = 410
spam score = 77
title = 'buoy data eb15'

distance = 411
spam score = 82
title = 'buoy data eb44'

distance = 412
spam score = 80
title = 'buoy data kosp2'

distance = 412
spam score = 54
title = 'buoy data iosn3'

distance = 412
spam score = 78
title = 'buoy data eb34'

distance = 413
spam score = 80
title = 'buoy data eb63'

distance = 414
spam score = 54
title = 'buoy data venf1'

distance = 415
spam score = 53
title = 'buoy data chlv2'

distance = 415
spam score = 78
title = 'buoy data busl1'

distance = 428
spam score = 71
title = 'buoy data eb16'

distance = 428
spam score = 64
title = 'buoy data cdrf1'

distance = 428
spam score = 62
title = 'buoy data ptgc1'

distance = 428
spam score = 52
title = 'buoy data dsln7'

distance = 428
spam score = 59
title = 'buoy data pilm4'

distance = 429
spam score = 73
title = 'buoy data eb03'

distance = 429
spam score = 69
title = 'buoy data 41035'

distance = 429
spam score = 66
title = 'buoy data 46015'

distance = 430
spam score = 68
title = 'buoy data 41043'

distance = 430
spam score = 54
title = 'buoy data dbln6'

distance = 1241
spam score = 82
title = 'sections of the sea of okhotsk'

distance = 1241
spam score = 72
title = 'contour maps of temperature'

distance = 1242
spam score = 60
title = 'world ocean atlas 2001 online data'

distance = 1244
spam score = 72
title = 'buoy locations western alaska'

distance = 1244
spam score = 80
title = 'submit data now by calling nodc'

distance = 1250
spam score = 74
title = 'glossary of argo data assemby centers'

distance = 1251
spam score = 81
title = 'pacific region ocean data amp information portal'

distance = 1259
spam score = 76
title = 'buoy locations western gulf of mexico'

distance = 1261
spam score = 59
title = 'argo data explorer'

distance = 1266
spam score = 75
title = 'buoy locations mid atlantic'

distance = 1307
spam score = 89
title = 'interactive data access and retrieval system'

distance = 1308
spam score = 92
title = 'pacific region ocean data amp information portal'

distance = 1308
spam score = 71
title = 'biological atlas of the arctic seas 2000 plankton of the barents and kara seas'

distance = 1308
spam score = 71
title = 'prod ocean archive system institutions detail for institutionsid 1201'

distance = 1309
spam score = 76
title = '1degree square temperature data distribution maps'

distance = 1310
spam score = 65
title = 'submit data fgdc format'

distance = 1311
spam score = 80
title = 'prod ocean archive system search platforms'

distance = 1311
spam score = 91
title = 'interactive data access and retrieval system'

distance = 1313
spam score = 67
title = 'sections view'

distance = 1313
spam score = 88
title = 'nodc organizational chart'

distance = 1360
spam score = 79
title = 'nquery'

distance = 1362
spam score = 71
title = 'white sea atlas authors'

distance = 1364
spam score = 82
title = 'nquery'

distance = 1366
spam score = 61
title = 'world ocean atlas 2001 online data'

distance = 1369
spam score = 64
title = 'world ocean database 2005 comments on category changes'

distance = 1369
spam score = 60
title = 'biological atlas of the arctic seas 2000 plankton of the barents and kara seas'

distance = 1369
spam score = 85
title = 'prod ocean archive system search institutions'

distance = 1370
spam score = 61
title = 'map view nonjavascript version'

distance = 1371
spam score = 79
title = 'glossary of argo data assemby centers'

distance = 1371
spam score = 59
title = 'map view nonjavascript version'

distance = 1420
spam score = 76
title = 'world ocean atlas 2005 masks'

distance = 1421
spam score = 91
title = 'miscellaneous technical reports'

distance = 1421
spam score = 68
title = 'variable specific second header 19'

distance = 1421
spam score = 85
title = 'ocean archive sample searches'

distance = 1422
spam score = 79
title = 'okhotsk sea atlas documentation'

distance = 1422
spam score = 92
title = 'global temperaturesalinity profile program'

distance = 1424
spam score = 77
title = 'global argo data repository'

distance = 1427
spam score = 86
title = 'world ocean atlas 2005 netcdf version'

distance = 1427
spam score = 61
title = 'national oceanographic data center buoy data format f291'

distance = 1429
spam score = 95
title = 'global temperaturesalinity profile program'

distance = 1496
spam score = 83
title = 'hpd cdrom page'

distance = 1498
spam score = 82
title = 'tools for manipulating or displaying ocean data'

distance = 1498
spam score = 33
title = 'global argo data repository'

distance = 1499
spam score = 89
title = 'world ocean atlas select'

distance = 1499
spam score = 96
title = 'national weather service hydrology laboratory'

distance = 1500
spam score = 89
title = 'global temperaturesalinity profile program'

distance = 1508
spam score = 90
title = 'global argo data repository'

distance = 1512
spam score = 77
title = 'nodc pathfinder sst data'

distance = 1513
spam score = 79
title = 'blended in situczcs chlorophyll'

distance = 1514
spam score = 33
title = 'global argo data repository'

distance = 1729
spam score = 55
title = 'wod05 changes'

distance = 1729
spam score = 60
title = 'cdiac communications virtual newsletter'

distance = 1741
spam score = 52
title = 'how to get in touch with us'

distance = 1750
spam score = 34
title = ''

distance = 1766
spam score = 72
title = 'awips national datasets maintenance ndm'

distance = 1786
spam score = 33
title = 'erddap'

distance = 703
spam score = 57
title = ''

distance = 721
spam score = 59
title = ''

distance = 727
spam score = 62
title = ''

distance = 727
spam score = 51
title = ''

distance = 736
spam score = 59
title = ''

distance = 770
spam score = 68
title = ''

distance = 794
spam score = 55
title = ''

distance = 857
spam score = 58
title = ''

distance = 870
spam score = 59
title = ''

distance = 887
spam score = 67
title = ''

distance = 904
spam score = 60
title = ''

distance = 912
spam score = 54
title = ''

distance = 927
spam score = 75
title = ''

distance = 1253
spam score = 73
title = ''

distance = 1256
spam score = 78
title = ''

distance = 1264
spam score = 75
title = ''

distance = 1271
spam score = 69
title = ''

distance = 1271
spam score = 81
title = ''

distance = 1281
spam score = 62
title = ''

distance = 1289
spam score = 65
title = ''

distance = 1289
spam score = 66
title = ''

distance = 1298
spam score = 81
title = ''

distance = 1906
spam score = 24
title = ''

distance = 551
spam score = 92
title = 'ethernet data acquisition multifunction edas signal conditioning examples'

distance = 555
spam score = 94
title = 'ethernet data acquisition multifunction edas signal conditioning examples'

distance = 563
spam score = 85
title = 'ethernet data acquisition multifunction edas signal conditioning examples'

distance = 567
spam score = 84
title = 'ethernet data acquisition multifunction edas signal conditioning examples'

distance = 573
spam score = 91
title = 'ethernet data acquisition multifunction edas signal conditioning examples'

distance = 582
spam score = 94
title = 'ethernet data acquisition multifunction edas signal conditioning examples'

distance = 640
spam score = 85
title = 'intelligent instrumentation manuals'

distance = 641
spam score = 85
title = 'intelligent instrumentation manuals'

distance = 643
spam score = 85
title = 'intelligent instrumentation manuals'

distance = 644
spam score = 83
title = 'intelligent instrumentation manuals'

distance = 645
spam score = 84
title = 'ethernet data acquisition serial edas'

distance = 647
spam score = 87
title = 'intelligent instrumentation manuals'

distance = 648
spam score = 83
title = 'intelligent instrumentation manuals'

distance = 652
spam score = 83
title = 'ethernet data acquisition industrial edas'

distance = 653
spam score = 87
title = 'intelligent instrumentation manuals'

distance = 656
spam score = 79
title = 'ethernet data acquisition serial edas'

distance = 656
spam score = 86
title = 'ethernet data acquisition industrial edas'

distance = 656
spam score = 82
title = 'ethernet data acquisition serial edas'

distance = 656
spam score = 82
title = 'ethernet data acquisition serial edas'

distance = 656
spam score = 89
title = 'ethernet data acquisition serial edas'

distance = 833
spam score = 84
title = 'intelligent instrumentation 98c signal conditioning amp termination'

distance = 833
spam score = 93
title = 'ethernet io data acquisition edas mean time between failure rates'

distance = 833
spam score = 91
title = 'hmi operator interface terminals microterminal and serial data collection terminal selection guide'

distance = 834
spam score = 92
title = 'hmi operator interface terminals microterminal and serial data collection terminal selection guide'

distance = 834
spam score = 93
title = 'intelligent instrumentation ethernet data acquisition system'

distance = 835
spam score = 90
title = 'intelligent instrumentation signal conditioning amp termination'

distance = 835
spam score = 89
title = 'ethernet io data acquisition edas mean time between failure rates'

distance = 835
spam score = 93
title = 'hmi operator interface terminals microterminal and serial data collection terminal selection guide'

distance = 835
spam score = 93
title = 'ethernet io data acquisition edas mean time between failure rates'

distance = 836
spam score = 93
title = 'intelligent instrumentation ethernet data acquisition system'

distance = 894
spam score = 89
title = 'intelligent instrumentation features amp benefits'

distance = 895
spam score = 86
title = 'intelligent instrumentation pci20087w1a digital io board'

distance = 896
spam score = 82
title = 'intelligent instrumentation south africa designs unique'

distance = 896
spam score = 87
title = 'intelligent instrumentation features amp benefits'

distance = 897
spam score = 87
title = 'intelligent instrumentation pci20087w1a digital io board'

distance = 899
spam score = 86
title = 'intelligent instrumentation south korea korea intelligent system'

distance = 899
spam score = 74
title = 'intelligent instrumentation south korea id information systems'

distance = 899
spam score = 76
title = 'intelligent instrumentation south korea id information systems'

distance = 899
spam score = 73
title = 'intelligent instrumentation south korea id information systems'

distance = 900
spam score = 76
title = 'intelligent instrumentation south africa designs unique'

distance = 928
spam score = 83
title = 'intelligent instrumentation new zealand qtech data systems limited'

distance = 929
spam score = 91
title = 'intelligent instrumentation registered trademarks'

distance = 930
spam score = 83
title = 'intelligent instrumentation specifications'

distance = 930
spam score = 82
title = 'intelligent instrumentation specifications'

distance = 931
spam score = 88
title = 'intelligent instrumentation specifications'

distance = 931
spam score = 91
title = 'intelligent instrumentation registered trademarks'

distance = 932
spam score = 77
title = 'intelligent instrumentation specifications'

distance = 933
spam score = 77
title = 'intelligent instrumentation mexico barware'

distance = 934
spam score = 91
title = 'intelligent instrumentation registered trademarks'

distance = 935
spam score = 78
title = 'intelligent instrumentation canada waterloo information systems limited'

distance = 996
spam score = 78
title = 'intelligent instrumentation lanpoint 7 grafikbdeterminal'

distance = 996
spam score = 78
title = 'intelligent instrumentation lanpoint 7 grafikbdeterminal'

distance = 996
spam score = 87
title = 'ethernet data acquisition multifunction edas'

distance = 996
spam score = 79
title = 'intelligent instrumentation lanpoint 7 grafikbdeterminal'

distance = 997
spam score = 94
title = 'intelligent instrumentation news archive'

distance = 997
spam score = 77
title = 'intelligent instrumentation lanpoint 7 grafikbdeterminal'

distance = 997
spam score = 77
title = 'intelligent instrumentation lanpoint 7 grafikbdeterminal'

distance = 997
spam score = 96
title = 'intelligent instrumentation news archive'

distance = 998
spam score = 93
title = 'intelligent instrumentation news archive'

distance = 999
spam score = 75
title = 'intelligent instrumentation lanpoint 7 grafikbdeterminal'

distance = 1065
spam score = 69
title = 'intelligent instrumentation mexico scanmex'

distance = 1065
spam score = 72
title = 'intelligent instrumentation mexico scanmex'

distance = 1067
spam score = 85
title = 'intelligent instrumentation software'

distance = 1068
spam score = 87
title = 'intelligent instrumentation software'

distance = 1068
spam score = 84
title = 'intelligent instrumentation software'

distance = 1070
spam score = 71
title = 'intelligent instrumentation mexico scanmex'

distance = 1071
spam score = 85
title = 'intelligent instrumentation software'

distance = 1072
spam score = 87
title = 'intelligent instrumentation software'

distance = 1075
spam score = 84
title = 'intelligent instrumentation software'

distance = 1079
spam score = 94
title = 'ethernet io data acquisition software support webserver modbus opc'

distance = 1164
spam score = 45
title = 'intelligent instrumentation data collection terminal ethernet io data acquisition'

distance = 1164
spam score = 39
title = 'intelligent instrumentation data collection terminal ethernet io data acquisition'

distance = 1173
spam score = 63
title = 'data collection terminal lanpoint 7 vehiclemount'

distance = 1185
spam score = 90
title = 'intelligent instrumentation press release priceperformance improvements lanpoint cenet amp lanpoint 7'

distance = 1185
spam score = 90
title = 'intelligent instrumentation press release priceperformance improvements lanpoint cenet amp lanpoint 7'

distance = 1186
spam score = 88
title = 'intelligent instrumentation press release priceperformance improvements lanpoint cenet amp lanpoint 7'

distance = 1188
spam score = 90
title = 'intelligent instrumentation press release priceperformance improvements lanpoint cenet amp lanpoint 7'

distance = 1188
spam score = 87
title = 'ethernet io data acquisition 3rd pary software solutions'

distance = 1188
spam score = 86
title = 'ethernet io data acquisition 3rd pary software solutions'

distance = 1188
spam score = 95
title = 'ethernet io data acquisition 3rd pary software solutions'

distance = 1265
spam score = 87
title = 'intelligent instrumentation tm8600'

distance = 1266
spam score = 88
title = 'intelligent instrumentation tm8600'

distance = 1266
spam score = 85
title = 'intelligent instrumentation tm8600'

distance = 1266
spam score = 89
title = 'intelligent instrumentation tm8600'

distance = 1268
spam score = 73
title = 'ethernet data acquisition webenabled edas hmi m2m software'

distance = 1272
spam score = 77
title = 'intelligent instrumentation accurate data systems inc'

distance = 1288
spam score = 91
title = 'ethernet data acquisition ifactory process functions'

distance = 1289
spam score = 89
title = 'ethernet data acquisition ifactory process functions'

distance = 1292
spam score = 86
title = 'ethernet data acquisition ifactory process functions'

distance = 1293
spam score = 83
title = 'ethernet data acquisition ifactory process functions'

distance = 1389
spam score = 84
title = 'data collection terminal lanpoint 7 vehiclemount'

distance = 1395
spam score = 63
title = 'intelligent instrumentation tm8701'

distance = 1408
spam score = 78
title = 'ethernet data acquisition ifactory applets'

distance = 1413
spam score = 77
title = 'ethernet data acquisition ifactory applets'

distance = 1427
spam score = 75
title = 'ethernet data acquisition ifactory applets'

distance = 1428
spam score = 67
title = 'intelligent instrumentation tm8600'

distance = 1428
spam score = 77
title = 'ethernet data acquisition ifactory applets'

distance = 1433
spam score = 74
title = 'intelligent instrumentation tm8600'

distance = 1435
spam score = 78
title = 'intelligent instrumentation tm8600'

distance = 1435
spam score = 67
title = 'intelligent instrumentation tm8600'

distance = 1678
spam score = 83
title = 'fotofindersystems anwendungsbilder'

distance = 1679
spam score = 83
title = 'brabender measurement amp control systems brabender group'

distance = 1683
spam score = 11
title = 'windows process adapters accelerated ideas'

distance = 1685
spam score = 92
title = 'fotofindersystems accessories'

distance = 1691
spam score = 82
title = 'fotofindersystems application images'

distance = 1700
spam score = 83
title = 'fotofindersystems veinscope'

distance = 1783
spam score = 85
title = 'european no campaign kes me oleme'

distance = 804
spam score = 13
title = ''

distance = 810
spam score = 16
title = ''

distance = 831
spam score = 13
title = ''

distance = 832
spam score = 12
title = ''

distance = 857
spam score = 9
title = ''

distance = 858
spam score = 13
title = ''

distance = 864
spam score = 14
title = ''

distance = 867
spam score = 9
title = ''

distance = 876
spam score = 11
title = ''

distance = 880
spam score = 13
title = ''

distance = 886
spam score = 11
title = ''

distance = 889
spam score = 8
title = ''

distance = 900
spam score = 16
title = ''

distance = 915
spam score = 13
title = ''

distance = 948
spam score = 10
title = ''

distance = 950
spam score = 11
title = ''

distance = 952
spam score = 10
title = ''

distance = 963
spam score = 13
title = ''

distance = 990
spam score = 8
title = ''

distance = 1023
spam score = 9
title = ''

distance = 1091
spam score = 7
title = ''

distance = 1094
spam score = 9
title = ''

distance = 1617
spam score = 14
title = ''

distance = 1685
spam score = 10
title = ''

distance = 1784
spam score = 10
title = ''

distance = 1863
spam score = 19
title = ''

distance = 507
spam score = 77
title = ''

distance = 530
spam score = 75
title = ''

distance = 572
spam score = 76
title = ''

distance = 603
spam score = 75
title = ''

distance = 667
spam score = 76
title = ''

distance = 693
spam score = 80
title = ''

distance = 727
spam score = 73
title = ''

distance = 728
spam score = 79
title = ''

distance = 816
spam score = 92
title = ''

distance = 859
spam score = 76
title = ''

distance = 923
spam score = 76
title = ''

distance = 1147
spam score = 79
title = ''

distance = 1153
spam score = 83
title = ''

distance = 1183
spam score = 86
title = ''

distance = 1219
spam score = 98
title = ''

distance = 1222
spam score = 77
title = ''

distance = 1274
spam score = 89
title = ''

distance = 1310
spam score = 89
title = ''

distance = 1310
spam score = 90
title = ''

distance = 1316
spam score = 96
title = ''

distance = 1317
spam score = 94
title = ''

distance = 1340
spam score = 88
title = ''

distance = 1574
spam score = 78
title = ''

distance = 1753
spam score = 12
title = ''

distance = 260
spam score = 82
title = 'data mining survivor readtransactions file'

distance = 314
spam score = 83
title = 'data mining survivor multiplevariable parallel coordinates'

distance = 335
spam score = 87
title = 'data mining survivor loadingdata0 foreign formats'

distance = 343
spam score = 82
title = 'data mining survivor strings evaluating strings'

distance = 355
spam score = 82
title = 'data mining survivor datestimes0 simple time series'

distance = 363
spam score = 89
title = 'data mining survivor rescaledata scale 01'

distance = 366
spam score = 86
title = 'data mining survivor cleanup delete selected'

distance = 369
spam score = 85
title = 'data mining survivor understandingdata further resources'

distance = 389
spam score = 85
title = 'data mining survivor rlanguage basic programming in r'

distance = 389
spam score = 88
title = 'data mining survivor menusbuttons edit menu'

distance = 390
spam score = 82
title = 'data mining survivor generalmanipulation reverse a list'

distance = 421
spam score = 82
title = 'data mining survivor borgelt usage'

distance = 428
spam score = 85
title = 'data mining survivor gettingstarted where to now'

distance = 429
spam score = 86
title = 'data mining survivor borgelt usage'

distance = 431
spam score = 85
title = 'data mining survivor neuralnetworks overview'

distance = 441
spam score = 87
title = 'data mining survivor statistica further information'

distance = 460
spam score = 88
title = 'data mining survivor toolsmenu execute'

distance = 466
spam score = 87
title = 'data mining survivor treenet summary'

distance = 468
spam score = 81
title = 'data mining survivor loadingdata0 interactive responses'

distance = 474
spam score = 89
title = 'data mining survivor summarisingdata skewness'

distance = 544
spam score = 93
title = 'data mining survivor virtualpredict summary'

distance = 545
spam score = 86
title = 'data mining survivor otherdata r data'

distance = 546
spam score = 81
title = 'data mining survivor miscellaneousplots star plot'

distance = 547
spam score = 87
title = 'data mining survivor openproducts rattle and other data mining suites'

distance = 548
spam score = 88
title = 'data mining survivor movinginto projects'

distance = 553
spam score = 91
title = 'data mining survivor support vector machines classification'

distance = 562
spam score = 90
title = 'data mining survivor toolsmenu export'

distance = 563
spam score = 88
title = 'data mining survivor menusbuttons help'

distance = 585
spam score = 82
title = 'data mining survivor associationanalysis0 usage'

distance = 587
spam score = 81
title = 'data mining survivor basicprogramming internet'

distance = 622
spam score = 96
title = 'data mining survivor dmsurvivor'

distance = 625
spam score = 83
title = 'data mining survivor textualsummaries1 histogram'

distance = 632
spam score = 96
title = 'data mining survivor dmsurvivor'

distance = 633
spam score = 94
title = 'data mining survivor dmsurvivor'

distance = 637
spam score = 85
title = 'data mining survivor dmsurvivor open products'

distance = 655
spam score = 96
title = 'data mining survivor dmsurvivor'

distance = 663
spam score = 87
title = 'data mining survivor singlevariable0 trellis histogram'

distance = 664
spam score = 81
title = 'data mining survivor strings trim whitespace'

distance = 670
spam score = 90
title = 'data mining survivor miscellaneousplots multiple dot plots'

distance = 678
spam score = 88
title = 'data mining survivor r0 further information'

distance = 789
spam score = 84
title = 'data mining survivor graphicalperformance lift'

distance = 814
spam score = 91
title = 'data mining survivor borgelt data mining suite from university of magdeburg'

distance = 828
spam score = 82
title = 'data mining survivor examples0 predicting salary group'

distance = 855
spam score = 77
title = 'data mining survivor datatypes numbers'

distance = 858
spam score = 61
title = 'data mining survivor simpleprogramming system'

distance = 866
spam score = 87
title = 'data mining survivor miscellaneousplots alternative multiple dot plots'

distance = 877
spam score = 86
title = 'data mining survivor datatypes strings'

distance = 885
spam score = 82
title = 'data mining survivor datestimes0 plot time series with axis labels'

distance = 885
spam score = 88
title = 'data mining survivor data0 loading data'

distance = 887
spam score = 85
title = 'data mining survivor miscellaneousplots 3d plot'

distance = 954
spam score = 83
title = 'data mining survivor odbcdata access'

distance = 955
spam score = 97
title = 'data mining survivor introduction data mining'

distance = 955
spam score = 92
title = 'data mining survivor movinginto interacting with r'

distance = 965
spam score = 74
title = 'data mining survivor conditional trees classification'

distance = 972
spam score = 65
title = 'data mining survivor equbits foresight tool from equbits'

distance = 973
spam score = 64
title = 'data mining survivor treenet from salford systems'

distance = 992
spam score = 61
title = 'data mining survivor virtual predict from virtual genetics'

distance = 1000
spam score = 78
title = 'data mining survivor enterprise miner from sas'

distance = 1003
spam score = 70
title = 'data mining survivor enterpriseminer summary'

distance = 1019
spam score = 73
title = 'data mining survivor textmining text mining with r'

distance = 1061
spam score = 67
title = 'data mining survivor glossary o'

distance = 1070
spam score = 66
title = 'data mining survivor statistica data miner from statsoft'

distance = 1077
spam score = 64
title = 'data mining survivor dmsurvivor list of figures'

distance = 1084
spam score = 79
title = 'data mining survivor weka from university of waikato'

distance = 1092
spam score = 80
title = 'data mining survivor otherdata0 global positioning system'

distance = 1096
spam score = 68
title = 'data mining survivor dmsurvivor closed products'

distance = 1104
spam score = 64
title = 'data mining survivor enterpriseminer tips and tricks'

distance = 1104
spam score = 94
title = 'data mining survivor interactingwith0 what is rattle'

distance = 1112
spam score = 90
title = 'data mining survivor loadingdata0 csv data used in the book'

distance = 1113
spam score = 71
title = 'data mining survivor enterprise data mining desktop survival guide'

distance = 1161
spam score = 74
title = 'data mining survivor process data'

distance = 1174
spam score = 60
title = 'data mining survivor borgelt data mining suite from university of magdeburg'

distance = 1206
spam score = 75
title = 'data mining survivor neural networks classification and regression'

distance = 1239
spam score = 91
title = 'data mining survivor data loading data into rattle'

distance = 1243
spam score = 83
title = 'data mining survivor preface acknowledgements'

distance = 1366
spam score = 94
title = 'data mining survivor introduction pros and cons'

distance = 1379
spam score = 67
title = 'data mining survivor statistica sample applications'

distance = 1431
spam score = 97
title = 'data miners alliances'

distance = 1435
spam score = 75
title = 'contents'

distance = 1435
spam score = 74
title = 'contents'

distance = 1484
spam score = 52
title = 'the technical analyst conferences'

distance = 1498
spam score = 51
title = 'text mining'

distance = 1501
spam score = 42
title = ''

distance = 1506
spam score = 61
title = 'text mining'

distance = 1534
spam score = 71
title = 'text mining'

distance = 1543
spam score = 48
title = 'crpit 87193199 clustering and classification of maintenance logs using text data mining'

distance = 1545
spam score = 72
title = 'statistica data miner'

distance = 1547
spam score = 22
title = 'first quantum minerals mine models bwana lonshi kansanshi mufulira nkana'

distance = 1551
spam score = 23
title = 'former wmc resources mine models olympic dam kambalda leinster mt keith'

distance = 1553
spam score = 26
title = 'newcrest mine models boddington cadia ridgeway telfer'

distance = 1591
spam score = 39
title = 'download hotazel mamatwanwessels bhpbilliton manganese ore mine cost model from world mine cost data exchange'

distance = 1601
spam score = 19
title = 'phelps dodge mine models bagdad candelaria cerro verde chino el abra henderson miami morenci sierrita tyrone black mountain'

distance = 1606
spam score = 82
title = 'wior commercial'

distance = 1615
spam score = 24
title = 'newmont mine models batu hijau bronzewing boddington golden giant golden grove midas ken snyder mesquite mt leyshon tanami yanacocha'

distance = 1624
spam score = 56
title = ''

distance = 1626
spam score = 25
title = 'download gold mine cost models in spreadsheet form'

distance = 1626
spam score = 67
title = ''

distance = 1627
spam score = 23
title = 'breakwater resources mine models bouchardhebert bougrine el mochito el toqui langlois myra falls nanisivik'

distance = 1629
spam score = 26
title = 'inco mine models manitoba division thompson birchtree ontario division whistle gertrude copper cliff crean hill creighton frood levack stobie coleman mccreedy garson victor sudbury voiseys bay pt inco soroako'

distance = 1647
spam score = 26
title = 'cvrd iron ore mine models alegria azul brucutu carajas capanema caue conceicao fabrica fazendao feijao gongo soco tamandua capito do mayo vargem grande mutuca pico sossego timbopeba tubarao'

distance = 1721
spam score = 25
title = 'bhpbilliton mine models alegria alumbrera antamina cannington cerro colorado cerro matoso escondida hotazel goldsworthy groote eylandt kambalda leinster selbaie area c mt keith mt newman olympic dam pering tintaya yandi'

distance = 1733
spam score = 85
title = 'clustering and outlier detection using manifolds'

distance = 1747
spam score = 18
title = 'dblp christian borgelt'

distance = 1774
spam score = 27
title = 'dblp tsau young lin'

distance = 1775
spam score = 40
title = 'dblp tsau young lin'

distance = 1793
spam score = 21
title = 'dblp tsau young lin'

distance = 761
spam score = 89
title = ''

distance = 865
spam score = 90
title = ''

distance = 878
spam score = 91
title = ''

distance = 907
spam score = 90
title = ''

distance = 911
spam score = 82
title = ''

distance = 933
spam score = 89
title = ''

distance = 978
spam score = 86
title = ''

distance = 985
spam score = 78
title = ''

distance = 1012
spam score = 94
title = ''

distance = 1039
spam score = 73
title = ''

distance = 1062
spam score = 93
title = ''

distance = 1068
spam score = 68
title = ''

distance = 1103
spam score = 82
title = ''

distance = 1169
spam score = 97
title = ''

distance = 1179
spam score = 86
title = ''

distance = 1222
spam score = 81
title = ''

distance = 1603
spam score = 56
title = ''

distance = 1619
spam score = 97
title = ''

distance = 457
spam score = 84
title = 'cisco ons 15600 series general information cisco systems'

distance = 550
spam score = 81
title = 'cisco ons 15500 series general information cisco systems'

distance = 550
spam score = 86
title = 'cisco ons 15400 series general information cisco systems'

distance = 553
spam score = 81
title = 'cisco transport manager general information cisco systems'

distance = 566
spam score = 80
title = 'cisco aironet 1200 series general information cisco systems'

distance = 567
spam score = 74
title = 'cisco transport manager general information cisco systems'

distance = 569
spam score = 73
title = 'cisco transport manager general information cisco systems'

distance = 592
spam score = 91
title = 'cisco as5400 series u