tree path: root node -> c2f073560
clusters in node: 813
spam scores: The spammiest documents have a score of 0, and the least spammy have a score of 99. The spam score is the percentage of documents in the collection more spammy than this document. Cluster spam scores are averaged across all documents in a cluster.

clusterid = c2faed8b0
RMSE = 0
spam score = 15
documents = 1
clusterid = c2f59dc70
RMSE = 0
spam score = 91
documents = 1
clusterid = c2f122b40
RMSE = 0
spam score = 20
documents = 1
clusterid = c2ff20e10
RMSE = 0
spam score = 55
documents = 1
clusterid = c2f65d810
RMSE = 0
spam score = 55
documents = 1
clusterid = c2f2ed900
RMSE = 4.52769
spam score = 35
documents = 2
clusterid = c2f105870
RMSE = 20.025
spam score = 5.5
documents = 2
clusterid = c2f616a60
RMSE = 203.057
spam score = 38.9
documents = 140
clusterid = c2f49add0
RMSE = 205.306
spam score = 42.9941
documents = 1856
clusterid = c2f5baf40
RMSE = 217.741
spam score = 17.2381
documents = 21
clusterid = c2fa1d250
RMSE = 222.656
spam score = 88.2727
documents = 1203
clusterid = c2f529130
RMSE = 232.756
spam score = 13.9917
documents = 121
clusterid = c2f1c98c0
RMSE = 236.218
spam score = 22.24
documents = 25
clusterid = c2feac2d0
RMSE = 238.284
spam score = 6.75194
documents = 129
clusterid = c2f9bd480
RMSE = 238.81
spam score = 52.7203
documents = 143
clusterid = c2f982ee0
RMSE = 239.454
spam score = 10.9982
documents = 1130
clusterid = c2fa4f290
RMSE = 250.928
spam score = 78.6111
documents = 90
clusterid = c2f330400
RMSE = 253.676
spam score = 49.4545
documents = 11
clusterid = c2fb1f8f0
RMSE = 269.19
spam score = 82.4444
documents = 9
clusterid = c2fe334e0
RMSE = 275.588
spam score = 18.1377
documents = 661
clusterid = c2f3666f0
RMSE = 281.987
spam score = 92.7506
documents = 413
clusterid = c2fc0d220
RMSE = 288.753
spam score = 95.8276
documents = 406
clusterid = c2f29a340
RMSE = 296.041
spam score = 77.3404
documents = 47
clusterid = c2fc86010
RMSE = 299.057
spam score = 83.4272
documents = 426
clusterid = c2fe5cfc0
RMSE = 302.258
spam score = 34.3813
documents = 139
clusterid = c2fb8bed0
RMSE = 303.614
spam score = 77.0915
documents = 7642
clusterid = c2f823d00
RMSE = 307.732
spam score = 35.375
documents = 8
clusterid = c2fc6cff0
RMSE = 314.002
spam score = 52.8
documents = 40
clusterid = c2ff80be0
RMSE = 317.779
spam score = 97.7059
documents = 85
clusterid = c2f1d60d0
RMSE = 324.646
spam score = 15.7201
documents = 318
clusterid = c2f28dc50
RMSE = 342.224
spam score = 97.3114
documents = 729
clusterid = c2fbeff50
RMSE = 348.539
spam score = 56.9873
documents = 315
clusterid = c2fa10a40
RMSE = 350.881
spam score = 72.7765
documents = 255
clusterid = c2feb0580
RMSE = 353.565
spam score = 88.2667
documents = 60
clusterid = c2fb2c100
RMSE = 354.795
spam score = 45.1188
documents = 261
clusterid = c2f791ef0
RMSE = 354.926
spam score = 30.6893
documents = 177
clusterid = c2fcc8b10
RMSE = 361.563
spam score = 80.7282
documents = 839
clusterid = c2f6a45c0
RMSE = 362.819
spam score = 80.6707
documents = 246
clusterid = c2faf1b60
RMSE = 378.804
spam score = 56.908
documents = 87
clusterid = c2fdc2c50
RMSE = 382.617
spam score = 52.1569
documents = 153
clusterid = c2f47db00
RMSE = 385.625
spam score = 12.2574
documents = 101
clusterid = c2f479850
RMSE = 387.27
spam score = 61.1875
documents = 16
clusterid = c2f0e41d0
RMSE = 389.6
spam score = 88.9037
documents = 270
clusterid = c2fd30e40
RMSE = 402.813
spam score = 58.9979
documents = 473
clusterid = c2feb4830
RMSE = 407.725
spam score = 25.386
documents = 614
clusterid = c2f7856e0
RMSE = 414.269
spam score = 90.4959
documents = 121
clusterid = c2f67ed90
RMSE = 416.414
spam score = 77.778
documents = 545
clusterid = c2f2e10f0
RMSE = 417.359
spam score = 71.2174
documents = 207
clusterid = c2f6deb60
RMSE = 417.475
spam score = 41.5
documents = 10
clusterid = c2fd2cb90
RMSE = 419.265
spam score = 87.5714
documents = 105
clusterid = c2fd99170
RMSE = 421.399
spam score = 74.3247
documents = 77
clusterid = c2f5d8210
RMSE = 423.825
spam score = 90.3726
documents = 255
clusterid = c2f697db0
RMSE = 424.757
spam score = 17.1413
documents = 184
clusterid = c2f2c80d0
RMSE = 435.301
spam score = 5.08333
documents = 12
clusterid = c2f1e6b90
RMSE = 436.498
spam score = 84.2052
documents = 268
clusterid = c2f62b7d0
RMSE = 441.258
spam score = 84.8923
documents = 260
clusterid = c2f31f940
RMSE = 448.26
spam score = 80.8824
documents = 34
clusterid = c2f9403e0
RMSE = 448.857
spam score = 37.2488
documents = 217
clusterid = c2f79a450
RMSE = 449.232
spam score = 95.3175
documents = 252
clusterid = c2f92f920
RMSE = 451.164
spam score = 76.9889
documents = 90
clusterid = c2f6a0310
RMSE = 451.866
spam score = 54.7398
documents = 465
clusterid = c2ffd8450
RMSE = 453.446
spam score = 80.4235
documents = 85
clusterid = c2fe65520
RMSE = 457.854
spam score = 55.6767
documents = 433
clusterid = c2fc19a30
RMSE = 463.563
spam score = 93.2778
documents = 630
clusterid = c2fcea090
RMSE = 468.089
spam score = 10.3894
documents = 113
clusterid = c2fe3fcf0
RMSE = 469.093
spam score = 13.6062
documents = 325
clusterid = c2fa64000
RMSE = 471.692
spam score = 73.875
documents = 32
clusterid = c2f306920
RMSE = 473.047
spam score = 81.4413
documents = 562
clusterid = c2f1c1360
RMSE = 473.494
spam score = 87.8548
documents = 62
clusterid = c2f9d21f0
RMSE = 476.402
spam score = 74.4835
documents = 395
clusterid = c3002fcc0
RMSE = 477.209
spam score = 84.4816
documents = 515
clusterid = c2f492870
RMSE = 478.439
spam score = 36.5469
documents = 245
clusterid = c2f961960
RMSE = 483.879
spam score = 64.48
documents = 125
clusterid = c2fcd95d0
RMSE = 486.699
spam score = 16.6901
documents = 71
clusterid = c2fa084e0
RMSE = 488.155
spam score = 61.7475
documents = 305
clusterid = c2fab75c0
RMSE = 488.636
spam score = 59.9833
documents = 60
clusterid = c2f588f00
RMSE = 490.057
spam score = 9.73333
documents = 15
clusterid = c2fba91a0
RMSE = 491.09
spam score = 12.4785
documents = 395
clusterid = c2f1ef0f0
RMSE = 494.119
spam score = 12.3854
documents = 96
clusterid = c2ff9deb0
RMSE = 494.548
spam score = 62.3273
documents = 55
clusterid = c2fd67130
RMSE = 499.849
spam score = 14.3615
documents = 213
clusterid = c2f827fb0
RMSE = 500.725
spam score = 94.5227
documents = 44
clusterid = c2f0d79c0
RMSE = 500.948
spam score = 84.3299
documents = 876
clusterid = c2fd030b0
RMSE = 501.005
spam score = 53.7805
documents = 123
clusterid = c2fca7590
RMSE = 501.179
spam score = 29.2237
documents = 295
clusterid = c2f171e50
RMSE = 502.858
spam score = 58.9157
documents = 332
clusterid = c2f91abb0
RMSE = 503.481
spam score = 55.8965
documents = 338
clusterid = c2f19bb30
RMSE = 503.667
spam score = 41.618
documents = 89
clusterid = c2f61ad10
RMSE = 503.721
spam score = 60.0968
documents = 93
clusterid = c2f37b460
RMSE = 504.789
spam score = 97.5017
documents = 289
clusterid = c2fbebca0
RMSE = 509.091
spam score = 82.1756
documents = 262
clusterid = c2f327ea0
RMSE = 510.588
spam score = 80.051
documents = 98
clusterid = c2f71d3b0
RMSE = 511.802
spam score = 72.7094
documents = 117
clusterid = c2f916900
RMSE = 512.485
spam score = 63.6667
documents = 201
clusterid = c2f158e30
RMSE = 512.579
spam score = 56.4737
documents = 19
clusterid = c2f75feb0
RMSE = 513.147
spam score = 90.2178
documents = 101
clusterid = c2f22d940
RMSE = 513.739
spam score = 64.3704
documents = 351
clusterid = c2f8b1860
RMSE = 514.215
spam score = 93.3333
documents = 255
clusterid = c2f510110
RMSE = 514.893
spam score = 69.3333
documents = 51
clusterid = c2fcb3da0
RMSE = 515.692
spam score = 76.9367
documents = 79
clusterid = c2f693b00
RMSE = 521.284
spam score = 76.8816
documents = 152
clusterid = c2f6c9df0
RMSE = 521.76
spam score = 90.2092
documents = 459
clusterid = c2fee6870
RMSE = 521.954
spam score = 79.0843
documents = 415
clusterid = c2fcafaf0
RMSE = 523.155
spam score = 76.6055
documents = 365
clusterid = c2f43f2b0
RMSE = 525.984
spam score = 44.8455
documents = 466
clusterid = c2ff46640
RMSE = 526.626
spam score = 97.3
documents = 50
clusterid = c2fc92820
RMSE = 526.761
spam score = 90.9077
documents = 195
clusterid = c2f112080
RMSE = 529.054
spam score = 49.289
documents = 301
clusterid = c2f7536a0
RMSE = 529.809
spam score = 80.4179
documents = 347
clusterid = c2f2fe3c0
RMSE = 530.904
spam score = 84.8529
documents = 272
clusterid = c2f52d3e0
RMSE = 531.939
spam score = 7.72222
documents = 414
clusterid = c2f567980
RMSE = 532.4
spam score = 57.3469
documents = 49
clusterid = c2f338960
RMSE = 533.423
spam score = 82.3654
documents = 52
clusterid = c2ffcfef0
RMSE = 535.474
spam score = 49.5466
documents = 697
clusterid = c2f0ba670
RMSE = 536.17
spam score = 19.3286
documents = 420
clusterid = c2f849530
RMSE = 536.383
spam score = 89.6667
documents = 6
clusterid = c2fbb59b0
RMSE = 542.863
spam score = 60.3709
documents = 399
clusterid = c2fdba6f0
RMSE = 544.128
spam score = 96.2794
documents = 68
clusterid = c30027760
RMSE = 547.191
spam score = 80.2078
documents = 154
clusterid = c2f203e60
RMSE = 547.358
spam score = 95.76
documents = 275
clusterid = c2f937e80
RMSE = 547.844
spam score = 47.4472
documents = 872
clusterid = c2f3db230
RMSE = 548.482
spam score = 63.9667
documents = 150
clusterid = c2f23a150
RMSE = 550.642
spam score = 24.763
documents = 135
clusterid = c2fb17390
RMSE = 550.828
spam score = 50.3829
documents = 1170
clusterid = c2ff07df0
RMSE = 550.859
spam score = 49.0995
documents = 221
clusterid = c2fddbc70
RMSE = 551.044
spam score = 42.1581
documents = 411
clusterid = c2fd288e0
RMSE = 551.839
spam score = 45.3125
documents = 48
clusterid = c2fbe3740
RMSE = 551.842
spam score = 78.5648
documents = 193
clusterid = c2f1440c0
RMSE = 552.839
spam score = 50.5294
documents = 136
clusterid = c2f770970
RMSE = 557.245
spam score = 88.6936
documents = 62
clusterid = c2f6da8b0
RMSE = 559.589
spam score = 23.8085
documents = 47
clusterid = c2fb87c20
RMSE = 560.222
spam score = 92.3
documents = 110
clusterid = c2f7bb9d0
RMSE = 563.484
spam score = 49.4898
documents = 98
clusterid = c2f5cfcb0
RMSE = 564.261
spam score = 82.0714
documents = 294
clusterid = c2f8f9630
RMSE = 564.325
spam score = 79.8158
documents = 429
clusterid = c2f44bac0
RMSE = 565.94
spam score = 46
documents = 2
clusterid = c2fda9c30
RMSE = 566.304
spam score = 71.7992
documents = 249
clusterid = c2f651000
RMSE = 567.219
spam score = 1.3871
documents = 31
clusterid = c2f57c6f0
RMSE = 567.78
spam score = 72.8667
documents = 60
clusterid = c2fafa0c0
RMSE = 569.734
spam score = 52.4098
documents = 244
clusterid = c2fb77160
RMSE = 569.816
spam score = 89.7915
documents = 398
clusterid = c2f708640
RMSE = 570.503
spam score = 64.1633
documents = 98
clusterid = c2fc1dce0
RMSE = 570.824
spam score = 18.6682
documents = 639
clusterid = c2f556ec0
RMSE = 574.594
spam score = 82.3889
documents = 36
clusterid = c2f2a28a0
RMSE = 575.866
spam score = 13.187
documents = 123
clusterid = c2fd523c0
RMSE = 578.707
spam score = 38.705
documents = 200
clusterid = c2f2851b0
RMSE = 578.739
spam score = 78.625
documents = 8
clusterid = c2fae9600
RMSE = 579.965
spam score = 80.5752
documents = 977
clusterid = c2f372f00
RMSE = 582.471
spam score = 34.4648
documents = 142
clusterid = c2fd17e20
RMSE = 582.64
spam score = 21.1063
documents = 301
clusterid = c2f0fd1f0
RMSE = 583.302
spam score = 58.0556
documents = 180
clusterid = c2f546400
RMSE = 583.529
spam score = 88.9303
documents = 244
clusterid = c2f806a30
RMSE = 583.974
spam score = 62.5119
documents = 674
clusterid = c2f6d2350
RMSE = 584.32
spam score = 93.8739
documents = 341
clusterid = c2f53dea0
RMSE = 587.867
spam score = 18.3745
documents = 235
clusterid = c2fd1c0d0
RMSE = 590.138
spam score = 98.7068
documents = 573
clusterid = c2f25b6d0
RMSE = 590.337
spam score = 63.963
documents = 459
clusterid = c2fd886b0
RMSE = 590.353
spam score = 84.689
documents = 209
clusterid = c2f4a3b10
RMSE = 590.366
spam score = 62.76
documents = 125
clusterid = c2fe61270
RMSE = 591.997
spam score = 31.6652
documents = 457
clusterid = c2ff52e50
RMSE = 592.01
spam score = 26.1635
documents = 159
clusterid = c2fc43510
RMSE = 592.41
spam score = 33.8889
documents = 360
clusterid = c2f72de70
RMSE = 595.594
spam score = 33.5433
documents = 900
clusterid = c2f0cb1b0
RMSE = 600.545
spam score = 45.0855
documents = 550
clusterid = c2f176100
RMSE = 602.249
spam score = 6.0885
documents = 226
clusterid = c2f26c190
RMSE = 606.151
spam score = 15.7143
documents = 112
clusterid = c2fe48250
RMSE = 608.213
spam score = 21.0464
documents = 237
clusterid = c2f197880
RMSE = 608.685
spam score = 6.35749
documents = 207
clusterid = c2fb986e0
RMSE = 609.661
spam score = 75.4377
documents = 1019
clusterid = c2f82c260
RMSE = 612.166
spam score = 65.3962
documents = 53
clusterid = c2f7bfc80
RMSE = 612.182
spam score = 59.7677
documents = 155
clusterid = c2f0ec730
RMSE = 612.954
spam score = 28.8732
documents = 284
clusterid = c2f69c060
RMSE = 613.197
spam score = 17.9882
documents = 169
clusterid = c2f4b0340
RMSE = 613.248
spam score = 80.0762
documents = 105
clusterid = c2f3173e0
RMSE = 614.81
spam score = 11.6894
documents = 322
clusterid = c2f4c9360
RMSE = 615.297
spam score = 47.1053
documents = 19
clusterid = c2fae5350
RMSE = 615.648
spam score = 46.5435
documents = 46
clusterid = c2f208110
RMSE = 615.883
spam score = 70.4486
documents = 107
clusterid = c2f584c50
RMSE = 616.878
spam score = 12.3273
documents = 55
clusterid = c2f1eae40
RMSE = 617.327
spam score = 27.8293
documents = 123
clusterid = c2f601cf0
RMSE = 619.168
spam score = 83.973
documents = 148
clusterid = c2f4ea8e0
RMSE = 620.039
spam score = 37.183
documents = 399
clusterid = c2fa78d70
RMSE = 620.52
spam score = 11.9296
documents = 611
clusterid = c2f9a01b0
RMSE = 621.69
spam score = 55.0238
documents = 42
clusterid = c2faf5e10
RMSE = 623.113
spam score = 7.924
documents = 250
clusterid = c2fe827f0
RMSE = 623.733
spam score = 83.0391
documents = 179
clusterid = c2f1bd0b0
RMSE = 623.758
spam score = 98.6392
documents = 158
clusterid = c2f873010
RMSE = 623.892
spam score = 81.375
documents = 8
clusterid = c2fcfee00
RMSE = 623.899
spam score = 80.4724
documents = 127
clusterid = c2ff63910
RMSE = 624.579
spam score = 85.3721
documents = 43
clusterid = c2ff89140
RMSE = 625.889
spam score = 86.1102
documents = 127
clusterid = c2f9766d0
RMSE = 630.021
spam score = 50.743
documents = 249
clusterid = c2f91ee60
RMSE = 630.462
spam score = 69.4184
documents = 98
clusterid = c2f948940
RMSE = 633.091
spam score = 86.7933
documents = 237
clusterid = c2fb7f6c0
RMSE = 633.866
spam score = 44.2946
documents = 129
clusterid = c2f85e2a0
RMSE = 635.448
spam score = 13.3161
documents = 174
clusterid = c2f923110
RMSE = 635.537
spam score = 19.9911
documents = 226
clusterid = c2f778ed0
RMSE = 635.63
spam score = 52.1681
documents = 345
clusterid = c2fc26240
RMSE = 636.084
spam score = 10.3333
documents = 384
clusterid = c2fbdf490
RMSE = 637.549
spam score = 92.18
documents = 100
clusterid = c2f0a1650
RMSE = 637.93
spam score = 63.449
documents = 49
clusterid = c2ff78680
RMSE = 638.137
spam score = 70.8351
documents = 467
clusterid = c2f6ef620
RMSE = 639.318
spam score = 56.1913
documents = 439
clusterid = c2f8347c0
RMSE = 642.128
spam score = 71.5775
documents = 187
clusterid = c2fdfd1f0
RMSE = 646.407
spam score = 11.7911
documents = 292
clusterid = c2fdf4c90
RMSE = 647.399
spam score = 53.202
documents = 1470
clusterid = c2f2f1bb0
RMSE = 647.795
spam score = 54.9853
documents = 68
clusterid = c2f7000e0
RMSE = 648.364
spam score = 70.6829
documents = 205
clusterid = c2f574190
RMSE = 649.762
spam score = 87.2222
documents = 153
clusterid = c2f54e960
RMSE = 650.167
spam score = 88.7143
documents = 28
clusterid = c2f8e8b70
RMSE = 650.532
spam score = 59.8192
documents = 343
clusterid = c2feff890
RMSE = 652.82
spam score = 31.226
documents = 562
clusterid = c2f54a6b0
RMSE = 653.721
spam score = 26.4652
documents = 316
clusterid = c2ff3e0e0
RMSE = 655.942
spam score = 76.8896
documents = 163
clusterid = c2f3f4250
RMSE = 656.742
spam score = 58.7558
documents = 86
clusterid = c2f4d9e20
RMSE = 656.982
spam score = 97.4756
documents = 349
clusterid = c2ff57100
RMSE = 658.302
spam score = 49.7131
documents = 955
clusterid = c2f8c2320
RMSE = 659.478
spam score = 58.4696
documents = 181
clusterid = c2fabb870
RMSE = 659.894
spam score = 81.4618
documents = 314
clusterid = c2fd7bea0
RMSE = 661.213
spam score = 88
documents = 5
clusterid = c2f7eda10
RMSE = 661.216
spam score = 16.3217
documents = 802
clusterid = c2ffbf430
RMSE = 661.229
spam score = 6.12528
documents = 439
clusterid = c2f4e6630
RMSE = 662.674
spam score = 87.4146
documents = 41
clusterid = c2fd4e110
RMSE = 666.087
spam score = 25.7429
documents = 315
clusterid = c2f8ad5b0
RMSE = 666.525
spam score = 83.8261
documents = 23
clusterid = c2f1fb900
RMSE = 666.655
spam score = 66.2147
documents = 312
clusterid = c2fb5e140
RMSE = 669.007
spam score = 92.9425
documents = 174
clusterid = c2f676830
RMSE = 669.32
spam score = 68.252
documents = 254
clusterid = c2fa31fc0
RMSE = 669.704
spam score = 68.7895
documents = 152
clusterid = c2fbb1700
RMSE = 670.919
spam score = 77.4854
documents = 103
clusterid = c2fc15780
RMSE = 671.395
spam score = 53.5893
documents = 112
clusterid = c2f084300
RMSE = 673.758
spam score = 68.8721
documents = 86
clusterid = c2f17a3b0
RMSE = 676.581
spam score = 91.8958
documents = 576
clusterid = c2f862550
RMSE = 677.608
spam score = 92.8186
documents = 485
clusterid = c2f270440
RMSE = 681.453
spam score = 79.5
documents = 6
clusterid = c2f246960
RMSE = 682.438
spam score = 36.3827
documents = 277
clusterid = c2f1b08a0
RMSE = 684.127
spam score = 95.1121
documents = 223
clusterid = c2fb493d0
RMSE = 684.288
spam score = 85.025
documents = 160
clusterid = c2f9c9c90
RMSE = 684.914
spam score = 56.8605
documents = 43
clusterid = c2f1508d0
RMSE = 686.703
spam score = 72.494
documents = 83
clusterid = c2ff03b40
RMSE = 686.755
spam score = 87.4885
documents = 131
clusterid = c2fddff20
RMSE = 686.919
spam score = 56.9231
documents = 208
clusterid = c2f3c64c0
RMSE = 691.201
spam score = 89.7414
documents = 116
clusterid = c2fa3a520
RMSE = 691.352
spam score = 85.1679
documents = 131
clusterid = c2fa96040
RMSE = 695.021
spam score = 59.904
documents = 573
clusterid = c2f648aa0
RMSE = 695.303
spam score = 77.6667
documents = 3
clusterid = c2ff10350
RMSE = 695.537
spam score = 17.8444
documents = 816
clusterid = c2f764160
RMSE = 696.357
spam score = 40.0896
documents = 201
clusterid = c2fa0c790
RMSE = 697.17
spam score = 84
documents = 219
clusterid = c2fac8080
RMSE = 697.942
spam score = 38.1022
documents = 313
clusterid = c2f3ad4a0
RMSE = 698.794
spam score = 61.6491
documents = 285
clusterid = c2f2fa110
RMSE = 702.274
spam score = 52.2667
documents = 30
clusterid = c2fbf4200
RMSE = 708.136
spam score = 16.084
documents = 119
clusterid = c2fa18fa0
RMSE = 709.414
spam score = 22.2034
documents = 118
clusterid = c2f36ec50
RMSE = 711.31
spam score = 37.1053
documents = 95
clusterid = c2ffc7990
RMSE = 711.525
spam score = 28.1506
documents = 239
clusterid = c2f4fb3a0
RMSE = 712.686
spam score = 75.2333
documents = 120
clusterid = c2fac3dd0
RMSE = 716.194
spam score = 82.292
documents = 113
clusterid = c2fa04230
RMSE = 716.422
spam score = 47.6923
documents = 234
clusterid = c2fed1b00
RMSE = 717.725
spam score = 58.1538
documents = 13
clusterid = c2ffc36e0
RMSE = 717.836
spam score = 62
documents = 11
clusterid = c2f7af1c0
RMSE = 718.267
spam score = 88.4
documents = 25
clusterid = c2ffbb180
RMSE = 720.53
spam score = 87.3671
documents = 316
clusterid = c2f408fc0
RMSE = 720.771
spam score = 54.5892
documents = 241
clusterid = c2fff99d0
RMSE = 721.077
spam score = 74.8799
documents = 483
clusterid = c2fa6c560
RMSE = 721.654
spam score = 19.3312
documents = 474
clusterid = c2f6bd5e0
RMSE = 721.676
spam score = 65.5259
documents = 251
clusterid = c2f5a61d0
RMSE = 721.914
spam score = 47.5166
documents = 3500
clusterid = c2ff4eba0
RMSE = 722.816
spam score = 71.5162
documents = 709
clusterid = c2fcf68a0
RMSE = 723.363
spam score = 93.6643
documents = 140
clusterid = c2f6b9330
RMSE = 724.293
spam score = 34.3607
documents = 122
clusterid = c2f30abd0
RMSE = 724.507
spam score = 93.6732
documents = 355
clusterid = c2f9f3770
RMSE = 725.371
spam score = 82.8176
documents = 159
clusterid = c2fa682b0
RMSE = 725.753
spam score = 13.195
documents = 318
clusterid = c2ff5f660
RMSE = 726.02
spam score = 14.1846
documents = 130
clusterid = c30016ca0
RMSE = 726.257
spam score = 85.4098
documents = 61
clusterid = c2f359ee0
RMSE = 726.742
spam score = 21.2868
documents = 129
clusterid = c2faa2850
RMSE = 727.084
spam score = 92.4118
documents = 17
clusterid = c2faaadb0
RMSE = 728.173
spam score = 37.4583
documents = 48
clusterid = c2f6447f0
RMSE = 729.128
spam score = 24.5878
documents = 245
clusterid = c2f3bdf60
RMSE = 733.094
spam score = 66.9231
documents = 13
clusterid = c2f912650
RMSE = 733.459
spam score = 13.2533
documents = 300
clusterid = c2fad05e0
RMSE = 734.164
spam score = 70.8214
documents = 84
clusterid = c2fe932b0
RMSE = 735.045
spam score = 47.0352
documents = 199
clusterid = c300129f0
RMSE = 740
spam score = 20.5
documents = 2
clusterid = c2f8174f0
RMSE = 740.938
spam score = 39.2725
documents = 389
clusterid = c2fc21f90
RMSE = 744.852
spam score = 51.7709
documents = 227
clusterid = c2f4bcb50
RMSE = 746.508
spam score = 20.2953
documents = 386
clusterid = c2fea8020
RMSE = 747.059
spam score = 55.9242
documents = 910
clusterid = c2f5999c0
RMSE = 747.486
spam score = 22.9059
documents = 170
clusterid = c2f6f7b80
RMSE = 749.042
spam score = 5.75
documents = 8
clusterid = c2f3a4f40
RMSE = 751.469
spam score = 84.3462
documents = 1040
clusterid = c2fe9b810
RMSE = 752.542
spam score = 67.0027
documents = 371
clusterid = c2f62fa80
RMSE = 754.663
spam score = 67.8553
documents = 76
clusterid = c2f7f5f70
RMSE = 754.821
spam score = 69.3824
documents = 578
clusterid = c2f7d8ca0
RMSE = 756.297
spam score = 68.3189
documents = 577
clusterid = c2fc32a50
RMSE = 760.174
spam score = 21.1791
documents = 67
clusterid = c2f4f70f0
RMSE = 761.865
spam score = 51.3235
documents = 34
clusterid = c2fc36d00
RMSE = 762.115
spam score = 73.3974
documents = 151
clusterid = c2ffed1c0
RMSE = 762.521
spam score = 34.5401
documents = 474
clusterid = c2f6ce0a0
RMSE = 764.379
spam score = 97.7277
documents = 202
clusterid = c2fdbe9a0
RMSE = 764.591
spam score = 66.7308
documents = 52
clusterid = c2f78dc40
RMSE = 765.158
spam score = 3.7451
documents = 102
clusterid = c2f4c0e00
RMSE = 768.672
spam score = 38.1875
documents = 112
clusterid = c2f50be60
RMSE = 770.242
spam score = 56.2414
documents = 87
clusterid = c2f578440
RMSE = 771.15
spam score = 23.0357
documents = 56
clusterid = c2f161390
RMSE = 772.606
spam score = 71.4444
documents = 315
clusterid = c2f64cd50
RMSE = 773.459
spam score = 90.9669
documents = 151
clusterid = c2f6b5080
RMSE = 774.984
spam score = 75.051
documents = 196
clusterid = c2fabfb20
RMSE = 775.318
spam score = 59.1569
documents = 51
clusterid = c2fc9ad80
RMSE = 775.338
spam score = 15.2816
documents = 103
clusterid = c2f6eb370
RMSE = 776.995
spam score = 75.894
documents = 868
clusterid = c2fef7330
RMSE = 777.314
spam score = 71.0073
documents = 273
clusterid = c2f4157d0
RMSE = 777.668
spam score = 5.28
documents = 25
clusterid = c2f13fe10
RMSE = 777.919
spam score = 87.3521
documents = 142
clusterid = c2f447810
RMSE = 778.274
spam score = 43.9133
documents = 173
clusterid = c2fce5de0
RMSE = 779.727
spam score = 54.9077
documents = 65
clusterid = c2f92b670
RMSE = 779.795
spam score = 2.1125
documents = 160
clusterid = c2fec1040
RMSE = 779.917
spam score = 1.21519
documents = 1027
clusterid = c2f8f5380
RMSE = 780.953
spam score = 77.979
documents = 1095
clusterid = c2f5c7750
RMSE = 781.911
spam score = 61.0795
documents = 88
clusterid = c2f218bd0
RMSE = 784.006
spam score = 87.0345
documents = 174
clusterid = c2f67aae0
RMSE = 784.29
spam score = 20.1071
documents = 112
clusterid = c2f4ff650
RMSE = 788.888
spam score = 69.2222
documents = 9
clusterid = c2ff1cb60
RMSE = 788.937
spam score = 91.0588
documents = 34
clusterid = c2f955150
RMSE = 789.454
spam score = 41.744
documents = 293
clusterid = c2feb8ae0
RMSE = 790.414
spam score = 46.28
documents = 50
clusterid = c2f73a680
RMSE = 790.895
spam score = 74.5917
documents = 120
clusterid = c2f3b5a00
RMSE = 793.201
spam score = 82.4444
documents = 36
clusterid = c2f90a0f0
RMSE = 793.438
spam score = 9.75439
documents = 171
clusterid = c2fe697d0
RMSE = 795.541
spam score = 87.2041
documents = 98
clusterid = c2fad4890
RMSE = 796.29
spam score = 66.1408
documents = 71
clusterid = c2f9fbcd0
RMSE = 796.462
spam score = 46.6957
documents = 92
clusterid = c2f0dbc70
RMSE = 796.646
spam score = 76.1494
documents = 174
clusterid = c2f5d3f60
RMSE = 797.514
spam score = 7.36675
documents = 409
clusterid = c2f4e2380
RMSE = 797.745
spam score = 40.7318
documents = 220
clusterid = c2f883ad0
RMSE = 797.77
spam score = 71.0766
documents = 209
clusterid = c2ff0c0a0
RMSE = 798.176
spam score = 20.8458
documents = 201
clusterid = c2f789990
RMSE = 798.615
spam score = 38.9405
documents = 84
clusterid = c2f090b30
RMSE = 799.597
spam score = 69.2245
documents = 441
clusterid = c2f443560
RMSE = 800.827
spam score = 36.479
documents = 167
clusterid = c2f6552b0
RMSE = 803.539
spam score = 69.2882
documents = 170
clusterid = c2f29e5f0
RMSE = 804.424
spam score = 20.2381
documents = 42
clusterid = c2f302670
RMSE = 805.644
spam score = 64.4967
documents = 302
clusterid = c2fbd6f30
RMSE = 806.447
spam score = 46.381
documents = 273
clusterid = c2f55f420
RMSE = 809.637
spam score = 13
documents = 2
clusterid = c2ffe09b0
RMSE = 809.794
spam score = 12.1543
documents = 162
clusterid = c2f855d40
RMSE = 812.084
spam score = 25.0391
documents = 128
clusterid = c2f419a80
RMSE = 812.267
spam score = 53.5303
documents = 66
clusterid = c2f524e80
RMSE = 813.855
spam score = 27.8696
documents = 23
clusterid = c2f0fd310
RMSE = 815.506
spam score = 50.8492
documents = 126
clusterid = c2fc2a4f0
RMSE = 816.423
spam score = 15.9602
documents = 327
clusterid = c2fa21500
RMSE = 818.423
spam score = 68.1273
documents = 715
clusterid = c2fbce9d0
RMSE = 818.995
spam score = 62.1288
documents = 326
clusterid = c2f4a3330
RMSE = 824.695
spam score = 26.5455
documents = 88
clusterid = c2fc68d40
RMSE = 825.765
spam score = 72.1215
documents = 321
clusterid = c2f3346b0
RMSE = 826.209
spam score = 38.097
documents = 134
clusterid = c2ffb6ed0
RMSE = 827.376
spam score = 46.8287
documents = 321
clusterid = c2f454020
RMSE = 829.485
spam score = 77.2099
documents = 181
clusterid = c2f5809a0
RMSE = 831.085
spam score = 70.4149
documents = 282
clusterid = c2f1b4b50
RMSE = 832.263
spam score = 31.3202
documents = 356
clusterid = c2f1de630
RMSE = 833.257
spam score = 45.3657
documents = 134
clusterid = c2fa46d30
RMSE = 833.561
spam score = 25.3412
documents = 938
clusterid = c2ff39e30
RMSE = 833.732
spam score = 50.1579
documents = 1222
clusterid = c2fd77bf0
RMSE = 835.416
spam score = 55.8908
documents = 284
clusterid = c2f887d80
RMSE = 836.006
spam score = 71.1578
documents = 450
clusterid = c2f8b5b10
RMSE = 837.448
spam score = 76.6095
documents = 379
clusterid = c2f2cc380
RMSE = 840.031
spam score = 96.3688
documents = 263
clusterid = c2f3d6f80
RMSE = 840.782
spam score = 65.1149
documents = 174
clusterid = c2f4a3db0
RMSE = 844.974
spam score = 6.51161
documents = 1206
clusterid = c2f894590
RMSE = 845.022
spam score = 47.3274
documents = 168
clusterid = c2f20c3c0
RMSE = 847.025
spam score = 29.4609
documents = 115
clusterid = c2f2253e0
RMSE = 848.731
spam score = 75.5185
documents = 27
clusterid = c2f32c150
RMSE = 849.436
spam score = 18.3929
documents = 28
clusterid = c2f13bb60
RMSE = 849.849
spam score = 56.2
documents = 5
clusterid = c2fb59e90
RMSE = 850.075
spam score = 73.7857
documents = 224
clusterid = c2fcdd880
RMSE = 850.144
spam score = 91.4929
documents = 424
clusterid = c2f746e90
RMSE = 850.93
spam score = 68.0746
documents = 67
clusterid = c2f5a1f20
RMSE = 853.809
spam score = 62.6122
documents = 361
clusterid = c2f58d1b0
RMSE = 856.106
spam score = 68.682
documents = 739
clusterid = c2f9273c0
RMSE = 856.391
spam score = 85.3441
documents = 340
clusterid = c2f2c3e20
RMSE = 857.325
spam score = 52.3333
documents = 168
clusterid = c2fae10a0
RMSE = 859.549
spam score = 80.4669
documents = 242
clusterid = c2f289460
RMSE = 860.387
spam score = 64.3269
documents = 208
clusterid = c2f7dcf50
RMSE = 861.803
spam score = 25.375
documents = 224
clusterid = c2f6127b0
RMSE = 863.2
spam score = 51.3614
documents = 606
clusterid = c2f6b0dd0
RMSE = 863.539
spam score = 67.7422
documents = 287
clusterid = c2f3ebcf0
RMSE = 866.385
spam score = 58.1649
documents = 188
clusterid = c2fd6b3e0
RMSE = 866.425
spam score = 42.1399
documents = 336
clusterid = c2f9c1730
RMSE = 867.024
spam score = 53.955
documents = 111
clusterid = c2f126df0
RMSE = 868.135
spam score = 5.90761
documents = 184
clusterid = c2f627520
RMSE = 868.552
spam score = 29.5547
documents = 247
clusterid = c2f7c3f30
RMSE = 868.926
spam score = 74.241
documents = 390
clusterid = c2f79e700
RMSE = 869.472
spam score = 20.555
documents = 191
clusterid = c2fd49e60
RMSE = 869.99
spam score = 83.5728
documents = 522
clusterid = c30044a30
RMSE = 870.603
spam score = 94.84
documents = 25
clusterid = c2f14c620
RMSE = 871.477
spam score = 39.5486
documents = 494
clusterid = c2f0ade60
RMSE = 872.725
spam score = 62.5433
documents = 889
clusterid = c2f4b88a0
RMSE = 874.266
spam score = 47.0654
documents = 489
clusterid = c2f93c130
RMSE = 875.332
spam score = 12.5318
documents = 4609
clusterid = c2f5f1230
RMSE = 875.788
spam score = 9.0794
documents = 466
clusterid = c2f28d9b0
RMSE = 876.35
spam score = 50.1226
documents = 106
clusterid = c2fe11f60
RMSE = 876.624
spam score = 26.2172
documents = 221
clusterid = c2f345170
RMSE = 877.171
spam score = 26.7022
documents = 554
clusterid = c2f0d3710
RMSE = 878.615
spam score = 22.3867
documents = 662
clusterid = c2f5b29e0
RMSE = 880.644
spam score = 75.828
documents = 343
clusterid = c2ffae970
RMSE = 881.317
spam score = 74.4118
documents = 17
clusterid = c2f859ff0
RMSE = 883
spam score = 51
documents = 1
clusterid = c2ff70120
RMSE = 883.719
spam score = 74.9429
documents = 70
clusterid = c2fc75550
RMSE = 884.307
spam score = 90.4118
documents = 34
clusterid = c2fec52f0
RMSE = 884.522
spam score = 43.7641
documents = 195
clusterid = c2ff188b0
RMSE = 885.86
spam score = 3.2866
documents = 1291
clusterid = c2f838a70
RMSE = 887.651
spam score = 25.8962
documents = 395
clusterid = c2f5dc4c0
RMSE = 888.858
spam score = 57.5385
documents = 13
clusterid = c2fb6a950
RMSE = 892.935
spam score = 56.0338
documents = 592
clusterid = c2f323bf0
RMSE = 893.67
spam score = 62.9868
documents = 380
clusterid = c2f496b20
RMSE = 893.795
spam score = 79.5391
documents = 703
clusterid = c2fc3f260
RMSE = 894.289
spam score = 11.0882
documents = 34
clusterid = c2f5bf1f0
RMSE = 894.618
spam score = 27.81
documents = 100
clusterid = c2f742be0
RMSE = 894.678
spam score = 25.707
documents = 215
clusterid = c2f1698f0
RMSE = 896.75
spam score = 80.12
documents = 25
clusterid = c2ff8d3f0
RMSE = 903.019
spam score = 82.7676
documents = 241
clusterid = c2f5143c0
RMSE = 907.215
spam score = 86.8374
documents = 123
clusterid = c2fe05750
RMSE = 907.756
spam score = 46.6128
documents = 594
clusterid = c2f866800
RMSE = 910.76
spam score = 94.4
documents = 5
clusterid = c2f10ddd0
RMSE = 911.65
spam score = 70.4701
documents = 117
clusterid = c2fbbdf10
RMSE = 913.615
spam score = 58.1095
documents = 1096
clusterid = c2fbb9c60
RMSE = 914.106
spam score = 4.74061
documents = 586
clusterid = c2fce1b30
RMSE = 914.259
spam score = 31.627
documents = 244
clusterid = c2f133600
RMSE = 916.377
spam score = 30.3662
documents = 355
clusterid = c2f595710
RMSE = 917.321
spam score = 18.0395
documents = 456
clusterid = c2f39c9e0
RMSE = 919.141
spam score = 23.615
documents = 865
clusterid = c2ffe8f10
RMSE = 919.444
spam score = 49.7097
documents = 217
clusterid = c2ff5b3b0
RMSE = 919.837
spam score = 40.8333
documents = 192
clusterid = c2fca32e0
RMSE = 920.386
spam score = 90.5
documents = 206
clusterid = c2f094de0
RMSE = 920.724
spam score = 52.3537
documents = 735
clusterid = c2f481db0
RMSE = 921.734
spam score = 11.5036
documents = 278
clusterid = c2f080050
RMSE = 923.907
spam score = 74.5833
documents = 12
clusterid = c2f704390
RMSE = 924
spam score = 35
documents = 1
clusterid = c2f2f5e60
RMSE = 924.68
spam score = 78.7247
documents = 247
clusterid = c2fe1a4c0
RMSE = 924.808
spam score = 88.0028
documents = 354
clusterid = c2f42e7f0
RMSE = 926.077
spam score = 28
documents = 2
clusterid = c2f0a5900
RMSE = 926.784
spam score = 6.0931
documents = 870
clusterid = c2f9d64a0
RMSE = 927.989
spam score = 96.1664
documents = 1106
clusterid = c2f3771b0
RMSE = 928.332
spam score = 81.5455
documents = 44
clusterid = c2f6872f0
RMSE = 929.588
spam score = 18.0282
documents = 248
clusterid = c2f1d1e20
RMSE = 930.197
spam score = 21.3623
documents = 69
clusterid = c2f75bc00
RMSE = 930.644
spam score = 29.4164
documents = 293
clusterid = c2f221130
RMSE = 930.999
spam score = 83.8076
documents = 629
clusterid = c2fe9fac0
RMSE = 933.089
spam score = 94.3073
documents = 192
clusterid = c2f63c290
RMSE = 933.501
spam score = 54.8333
documents = 6
clusterid = c2f5c34a0
RMSE = 934.24
spam score = 11.9688
documents = 32
clusterid = c2f214920
RMSE = 934.811
spam score = 46.3092
documents = 304
clusterid = c2f3901d0
RMSE = 935.976
spam score = 30.0336
documents = 744
clusterid = c2fe3ba40
RMSE = 936.085
spam score = 22.3943
documents = 2371
clusterid = c2febcd90
RMSE = 936.779
spam score = 91.6544
documents = 191
clusterid = c2f6e70c0
RMSE = 939.077
spam score = 63.4793
documents = 580
clusterid = c2f7d49f0
RMSE = 940.686
spam score = 32.7977
documents = 1389
clusterid = c2fe507b0
RMSE = 940.699
spam score = 47.7688
documents = 186
clusterid = c2fa29a60
RMSE = 941.916
spam score = 53.125
documents = 16
clusterid = c2f7b7720
RMSE = 941.992
spam score = 79.9784
documents = 278
clusterid = c2f81fa50
RMSE = 942.24
spam score = 14.5465
documents = 355
clusterid = c2f37f710
RMSE = 946.196
spam score = 17.75
documents = 4
clusterid = c2fb23ba0
RMSE = 947.766
spam score = 1.05263
documents = 19
clusterid = c2f073810
RMSE = 949.825
spam score = 76.0832
documents = 685
clusterid = c2f3d2cd0
RMSE = 951.065
spam score = 56.7632
documents = 38
clusterid = c2f1a4090
RMSE = 954.628
spam score = 67.6797
documents = 637
clusterid = c2fef3080
RMSE = 957.662
spam score = 60.6157
documents = 229
clusterid = c300234b0
RMSE = 960.21
spam score = 92.2044
documents = 225
clusterid = c2f182c40
RMSE = 961.031
spam score = 69.9667
documents = 120
clusterid = c2f7c81e0
RMSE = 961.518
spam score = 73.2442
documents = 954
clusterid = c2fc4ba70
RMSE = 963.862
spam score = 5.70844
documents = 391
clusterid = c2f969ec0
RMSE = 963.913
spam score = 22.9448
documents = 1087
clusterid = c2fb94430
RMSE = 965.151
spam score = 81.468
documents = 203
clusterid = c2fa85580
RMSE = 965.582
spam score = 91.3902
documents = 123
clusterid = c2f263c30
RMSE = 966.493
spam score = 76.0252
documents = 238
clusterid = c2f1935d0
RMSE = 966.979
spam score = 17.162
documents = 358
clusterid = c3001f200
RMSE = 967.634
spam score = 26.9702
documents = 403
clusterid = c2f3b9cb0
RMSE = 967.799
spam score = 34.3846
documents = 13
clusterid = c2f253170
RMSE = 970.849
spam score = 77.65
documents = 20
clusterid = c2f1b8e00
RMSE = 971.635
spam score = 78.7895
documents = 19
clusterid = c2fc9f030
RMSE = 972.618
spam score = 84.2667
documents = 30
clusterid = c2faaf060
RMSE = 974.631
spam score = 79.9345
documents = 412
clusterid = c2f605fa0
RMSE = 974.659
spam score = 25.8571
documents = 21
clusterid = c2f3e3790
RMSE = 975.184
spam score = 72.4895
documents = 1328
clusterid = c2fde41d0
RMSE = 976.192
spam score = 73.1438
documents = 459
clusterid = c2f0fd3a0
RMSE = 977.491
spam score = 24.381
documents = 84
clusterid = c2f56bc30
RMSE = 979.241
spam score = 60.7176
documents = 1406
clusterid = c2f3e7a40
RMSE = 981.912
spam score = 32.349
documents = 1258
clusterid = c2f4d18c0
RMSE = 982.658
spam score = 11.5079
documents = 63
clusterid = c2f6a8870
RMSE = 983.809
spam score = 33.6507
documents = 667
clusterid = c2f77d180
RMSE = 983.934
spam score = 33.16
documents = 25
clusterid = c2f8a5050
RMSE = 984.417
spam score = 31.76
documents = 300
clusterid = c2f48e5c0
RMSE = 984.788
spam score = 39.848
documents = 204
clusterid = c2f60a250
RMSE = 985.773
spam score = 3.95802
documents = 405
clusterid = c2ffa2160
RMSE = 985.975
spam score = 26.7026
documents = 380
clusterid = c2f486060
RMSE = 986.828
spam score = 19.7077
documents = 520
clusterid = c2fb3cbc0
RMSE = 987.197
spam score = 51.6931
documents = 720
clusterid = c2f781430
RMSE = 987.363
spam score = 53.5894
documents = 1264
clusterid = c2f520bd0
RMSE = 988.041
spam score = 9
documents = 4
clusterid = c2ff318d0
RMSE = 988.587
spam score = 51.5494
documents = 273
clusterid = c2fc2e7a0
RMSE = 989.087
spam score = 53.553
documents = 604
clusterid = c2f0885d0
RMSE = 990.116
spam score = 67.75
documents = 24
clusterid = c2fb6ec00
RMSE = 993.453
spam score = 5.80994
documents = 342
clusterid = c2f9ef4c0
RMSE = 993.649
spam score = 56.5798
documents = 714
clusterid = c2fba4ef0
RMSE = 994.803
spam score = 17.5828
documents = 453
clusterid = c2fe75fe0
RMSE = 998.622
spam score = 59.6185
documents = 325
clusterid = c2fe0dcb0
RMSE = 1000.01
spam score = 55.6817
documents = 421
clusterid = c2ff29370
RMSE = 1002.37
spam score = 74.8943
documents = 227
clusterid = c2f3fc7b0
RMSE = 1003.21
spam score = 23.5
documents = 76
clusterid = c2f4a35d0
RMSE = 1003.35
spam score = 64.7281
documents = 228
clusterid = c2f0f4c90
RMSE = 1003.82
spam score = 88.4912
documents = 285
clusterid = c2f11e890
RMSE = 1004.56
spam score = 58.0833
documents = 12
clusterid = c2f1da380
RMSE = 1008.09
spam score = 51.8429
documents = 70
clusterid = c2fc04cc0
RMSE = 1009
spam score = 66.3662
documents = 385
clusterid = c2f987190
RMSE = 1010.68
spam score = 37.9663
documents = 2493
clusterid = c2feda060
RMSE = 1014.75
spam score = 41.157
documents = 242
clusterid = c3000a490
RMSE = 1014.95
spam score = 49.9577
documents = 307
clusterid = c2f959400
RMSE = 1015.22
spam score = 72.5642
documents = 491
clusterid = c2fd24630
RMSE = 1016
spam score = 2.89398
documents = 698
clusterid = c2f66a020
RMSE = 1016.43
spam score = 22.0488
documents = 860
clusterid = c2ff6be70
RMSE = 1016.96
spam score = 93.8486
documents = 317
clusterid = c2f355c30
RMSE = 1018.03
spam score = 3.88889
documents = 9
clusterid = c2ff14600
RMSE = 1018.34
spam score = 19.5423
documents = 319
clusterid = c2fbe79f0
RMSE = 1018.45
spam score = 58.5806
documents = 124
clusterid = c2f73e930
RMSE = 1023.69
spam score = 75.199
documents = 603
clusterid = c2f16dba0
RMSE = 1024.26
spam score = 20.2763
documents = 456
clusterid = c2fa9e5a0
RMSE = 1024.6
spam score = 42.199
documents = 417
clusterid = c2fdb2190
RMSE = 1026.95
spam score = 19.7411
documents = 224
clusterid = c2f61efc0
RMSE = 1029.34
spam score = 54.5006
documents = 819
clusterid = c2f2e53a0
RMSE = 1029.37
spam score = 69.0758
documents = 66
clusterid = c2f2bb8c0
RMSE = 1029.39
spam score = 5.19417
documents = 103
clusterid = c2f7a29b0
RMSE = 1032.09
spam score = 29.7554
documents = 327
clusterid = c2f099120
RMSE = 1033.37
spam score = 15.0949
documents = 1971
clusterid = c2f426290
RMSE = 1033.85
spam score = 56.8
documents = 10
clusterid = c2f48a310
RMSE = 1034.28
spam score = 83.0985
documents = 822
clusterid = c2fe58d10
RMSE = 1035.38
spam score = 70.1118
documents = 1494
clusterid = c2f5e4a20
RMSE = 1035.59
spam score = 86.292
documents = 2007
clusterid = c2f2d8b90
RMSE = 1035.74
spam score = 97.0714
documents = 14
clusterid = c2f3c2210
RMSE = 1038.69
spam score = 43.4227
documents = 388
clusterid = c2f851a90
RMSE = 1038.72
spam score = 69.1988
documents = 327
clusterid = c2f7aaf10
RMSE = 1038.85
spam score = 30.6115
documents = 278
clusterid = c2f35e190
RMSE = 1039.75
spam score = 87.2745
documents = 102
clusterid = c2fe16210
RMSE = 1041.33
spam score = 53.6733
documents = 401
clusterid = c2fe6da80
RMSE = 1042
spam score = 36
documents = 1
clusterid = c2fadcdf0
RMSE = 1043.15
spam score = 28.6422
documents = 218
clusterid = c2f76c6c0
RMSE = 1044.63
spam score = 88.2857
documents = 21
clusterid = c2fa2dd10
RMSE = 1047.76
spam score = 49.0189
documents = 264
clusterid = c2fa42a80
RMSE = 1047.76
spam score = 42.9414
documents = 870
clusterid = c2f460830
RMSE = 1047.99
spam score = 51.7451
documents = 51
clusterid = c2f154b80
RMSE = 1052.01
spam score = 33.3256
documents = 344
clusterid = c2fc8a2c0
RMSE = 1052.17
spam score = 51.3638
documents = 1729
clusterid = c2f4cd610
RMSE = 1052.89
spam score = 38.6365
documents = 2861
clusterid = c2f714e50
RMSE = 1054.66
spam score = 49.0023
documents = 440
clusterid = c2fb51930
RMSE = 1054.82
spam score = 30.6655
documents = 553
clusterid = c2fc00a10
RMSE = 1054.82
spam score = 57.8
documents = 5
clusterid = c2fc58280
RMSE = 1055.12
spam score = 78.4474
documents = 76
clusterid = c2f9da750
RMSE = 1057.89
spam score = 55.6804
documents = 6302
clusterid = c2fb40e70
RMSE = 1058.91
spam score = 63.1856
documents = 792
clusterid = c2fab3310
RMSE = 1060.27
spam score = 42.1571
documents = 140
clusterid = c2fb623f0
RMSE = 1063.2
spam score = 26.7057
documents = 1060
clusterid = c3000e740
RMSE = 1063.45
spam score = 13.9243
documents = 185
clusterid = c2f349420
RMSE = 1064.2
spam score = 17
documents = 2
clusterid = c2fb38910
RMSE = 1064.53
spam score = 31.0803
documents = 249
clusterid = c2fffdc80
RMSE = 1066.55
spam score = 21.5606
documents = 1156
clusterid = c2fc712a0
RMSE = 1067.87
spam score = 30.0403
documents = 869
clusterid = c2f4f2e40
RMSE = 1068.62
spam score = 72.6511
documents = 364
clusterid = c2fa14cf0
RMSE = 1068.64
spam score = 34.8701
documents = 762
clusterid = c30040780
RMSE = 1070.82
spam score = 22.2876
documents = 685
clusterid = c2f3ca770
RMSE = 1071.91
spam score = 31.3333
documents = 198
clusterid = c2f2dce40
RMSE = 1072.15
spam score = 45.1832
documents = 191
clusterid = c2f2aae00
RMSE = 1072.57
spam score = 62.8077
documents = 78
clusterid = c2f468d90
RMSE = 1074.69
spam score = 84.3333
documents = 123
clusterid = c30051240
RMSE = 1077.88
spam score = 72.2021
documents = 653
clusterid = c2f7d0740
RMSE = 1078.14
spam score = 27.2732
documents = 194
clusterid = c2f313130
RMSE = 1079.5
spam score = 21.7561
documents = 123
clusterid = c2fc8e570
RMSE = 1079.54
spam score = 35.3776
documents = 196
clusterid = c2fdadee0
RMSE = 1080.92
spam score = 78.9423
documents = 104
clusterid = c2fdd79c0
RMSE = 1081.8
spam score = 60.1447
documents = 152
clusterid = c2fdd3710
RMSE = 1082.35
spam score = 25.5538
documents = 251
clusterid = c2f362440
RMSE = 1082.85
spam score = 43.4615
documents = 26
clusterid = c2f4de0d0
RMSE = 1084.31
spam score = 59.6358
documents = 2438
clusterid = c2f4d5b70
RMSE = 1084.31
spam score = 41.1419
documents = 155
clusterid = c2fcd5320
RMSE = 1086.64
spam score = 41.375
documents = 24
clusterid = c2fd94ec0
RMSE = 1089.96
spam score = 20.8678
documents = 885
clusterid = c2f4712f0
RMSE = 1090.18
spam score = 24.0825
documents = 206
clusterid = c2f1a8340
RMSE = 1091.19
spam score = 28.3235
documents = 102
clusterid = c2fbdb1e0
RMSE = 1097.89
spam score = 22.75
documents = 44
clusterid = c2ff67bc0
RMSE = 1098.84
spam score = 31.8564
documents = 564
clusterid = c2f9a8710
RMSE = 1099.01
spam score = 62.5
documents = 4
clusterid = c2f710ba0
RMSE = 1099.98
spam score = 7.80172
documents = 116
clusterid = c2ffd41a0
RMSE = 1100.67
spam score = 31.5828
documents = 163
clusterid = c2f672580
RMSE = 1100.97
spam score = 28.0698
documents = 516
clusterid = c2f257420
RMSE = 1102.9
spam score = 77.0667
documents = 30
clusterid = c2fcc4860
RMSE = 1103.59
spam score = 51.205
documents = 322
clusterid = c2f25f980
RMSE = 1104.74
spam score = 74.7641
documents = 284
clusterid = c2f398730
RMSE = 1106.62
spam score = 7.03866
documents = 388
clusterid = c2f34d6d0
RMSE = 1106.78
spam score = 68.1981
documents = 106
clusterid = c2fa9a2f0
RMSE = 1108.91
spam score = 31.4032
documents = 558
clusterid = c2f0b63c0
RMSE = 1113.33
spam score = 69.9136
documents = 220
clusterid = c2f8b9dc0
RMSE = 1113.33
spam score = 13.0605
documents = 694
clusterid = c2fb45120
RMSE = 1115.52
spam score = 65.5
documents = 26
clusterid = c2f9ac9c0
RMSE = 1115.63
spam score = 86.3667
documents = 120
clusterid = c2fc81d60
RMSE = 1115.73
spam score = 55.0673
documents = 535
clusterid = c2feeedd0
RMSE = 1116.27
spam score = 22.619
documents = 2559
clusterid = c2fa7d020
RMSE = 1117.29
spam score = 30.2327
documents = 954
clusterid = c2fe26cd0
RMSE = 1119.14
spam score = 78.1879
documents = 1384
clusterid = c2f7a6c60
RMSE = 1119.86
spam score = 50.1448
documents = 746
clusterid = c2f74f3f0
RMSE = 1120.87
spam score = 64.0542
documents = 480
clusterid = c300061e0
RMSE = 1124.62
spam score = 13.1118
documents = 170
clusterid = c2f2a6b50
RMSE = 1128.35
spam score = 33.5684
documents = 1140
clusterid = c2ffa6410
RMSE = 1129.72
spam score = 32.21
documents = 100
clusterid = c2f11a5e0
RMSE = 1130.76
spam score = 95
documents = 7
clusterid = c2ffaa6c0
RMSE = 1131.37
spam score = 68.8462
documents = 351
clusterid = c2f7e54b0
RMSE = 1131.7
spam score = 61.125
documents = 8
clusterid = c2f9cdf40
RMSE = 1131.79
spam score = 73.5908
documents = 1669
clusterid = c2f36a9a0
RMSE = 1133.63
spam score = 42.8702
documents = 416
clusterid = c2f6d6600
RMSE = 1135.06
spam score = 85.0385
documents = 52
clusterid = c2f12f350
RMSE = 1135.71
spam score = 65.9438
documents = 89
clusterid = c2f944690
RMSE = 1137.83
spam score = 68.5932
documents = 1293
clusterid = c30038220
RMSE = 1138.66
spam score = 82.4214
documents = 159
clusterid = c2f9e2cb0
RMSE = 1140.21
spam score = 11.0981
documents = 1243
clusterid = c2fbc21c0
RMSE = 1140.81
spam score = 79.0109
documents = 276
clusterid = c2f552c10
RMSE = 1142.47
spam score = 58.012
documents = 166
clusterid = c2f68b5a0
RMSE = 1143.53
spam score = 51.2108
documents = 835
clusterid = c2f7cc490
RMSE = 1144.07
spam score = 41.2137
documents = 248
clusterid = c2f464ae0
RMSE = 1144.08
spam score = 68.3955
documents = 665
clusterid = c2f2b7610
RMSE = 1144.63
spam score = 65.2
documents = 5
clusterid = c2f4755a0
RMSE = 1145.81
spam score = 74.3
documents = 20
clusterid = c2fc08f70
RMSE = 1147.13
spam score = 37.298
documents = 1359
clusterid = c2f49f080
RMSE = 1147.36
spam score = 36.4385
documents = 187
clusterid = c2f531690
RMSE = 1147.89
spam score = 25.1438
documents = 153
clusterid = c2fa91d90
RMSE = 1149.62
spam score = 55.5834
documents = 12796
clusterid = c2f535940
RMSE = 1150.79
spam score = 75.0934
documents = 396
clusterid = c2f400a60
RMSE = 1151.38
spam score = 37.8012
documents = 2711
clusterid = c2f07bd70
RMSE = 1151.76
spam score = 27.5461
documents = 1626
clusterid = c2f9e6f60
RMSE = 1153.98
spam score = 42.6546
documents = 996
clusterid = c2f950ea0
RMSE = 1154.22
spam score = 79.0103
documents = 195
clusterid = c30001f30
RMSE = 1154.85
spam score = 86.0556
documents = 36
clusterid = c2fc607e0
RMSE = 1156.86
spam score = 62.4201
documents = 488
clusterid = c2f55b170
RMSE = 1157.67
spam score = 58.8948
documents = 675
clusterid = c2f0cf460
RMSE = 1158.5
spam score = 9.87053
documents = 811
clusterid = c2f340ec0
RMSE = 1159.31
spam score = 15.3134
documents = 67
clusterid = c2f732120
RMSE = 1160.28
spam score = 74.9931
documents = 1873
clusterid = c2fb130e0
RMSE = 1160.36
spam score = 60.5827
documents = 139
clusterid = c2f436d50
RMSE = 1162.13
spam score = 64.4754
documents = 61
clusterid = c2fd5a920
RMSE = 1163.25
spam score = 67.3234
documents = 167
clusterid = c2f56fee0
RMSE = 1163.92
spam score = 60.0589
documents = 1121
clusterid = c2f5f54e0
RMSE = 1164.88
spam score = 39.0826
documents = 1562
clusterid = c2f0ba700
RMSE = 1167.92
spam score = 5.0303
documents = 33
clusterid = c2f46d040
RMSE = 1171.16
spam score = 36.0064
documents = 157
clusterid = c2f757950
RMSE = 1171.78
spam score = 77.9266
documents = 327
clusterid = c2fd5ebd0
RMSE = 1176.72
spam score = 61.4536
documents = 302
clusterid = c2fe37790
RMSE = 1176.79
spam score = 35.2547
documents = 212
clusterid = c2fe8ad50
RMSE = 1177.17
spam score = 68.5789
documents = 19
clusterid = c2fafe370
RMSE = 1177.56
spam score = 7.80208
documents = 96
clusterid = c2f1f33a0
RMSE = 1178.14
spam score = 31.0941
documents = 85
clusterid = c2f8fd8e0
RMSE = 1178.95
spam score = 45.1983
documents = 701
clusterid = c2f148370
RMSE = 1180.94
spam score = 25.9013
documents = 223
clusterid = c2fdf09e0
RMSE = 1181.51
spam score = 53.5803
documents = 11666
clusterid = c2fdcb1b0
RMSE = 1181.86
spam score = 16.947
documents = 302
clusterid = c2f33cc10
RMSE = 1182.6
spam score = 48.8049
documents = 287
clusterid = c2fbad450
RMSE = 1182.72
spam score = 68.5
documents = 2
clusterid = c2f659560
RMSE = 1184.58
spam score = 45.369
documents = 756
clusterid = c2fe8f000
RMSE = 1185.32
spam score = 58.7045
documents = 5478
clusterid = c30048ce0
RMSE = 1187.84
spam score = 50.362
documents = 1765
clusterid = c2ff250c0
RMSE = 1189.04
spam score = 70.2324
documents = 5194
clusterid = c2f7363d0
RMSE = 1189.22
spam score = 25.1265
documents = 253
clusterid = c2f9939a0
RMSE = 1189.31
spam score = 53.356
documents = 191
clusterid = c2f719100
RMSE = 1190.25
spam score = 62.0893
documents = 1098
clusterid = c2facc330
RMSE = 1192.39
spam score = 29.1333
documents = 135
clusterid = c2f6fbe30
RMSE = 1193.6
spam score = 35.5447
documents = 1153
clusterid = c2f8a9300
RMSE = 1194.15
spam score = 72.1937
documents = 2282
clusterid = c2fb0ee30
RMSE = 1200.92
spam score = 28.2
documents = 5
clusterid = c2fd350f0
RMSE = 1201.26
spam score = 67.8857
documents = 35
clusterid = c2ffe4c60
RMSE = 1201.83
spam score = 58.7638
documents = 398
clusterid = c2fe7e540
RMSE = 1206.44
spam score = 65.9037
documents = 1838
clusterid = c2f1ac5f0
RMSE = 1210.12
spam score = 22.415
documents = 2778
clusterid = c3002ba10
RMSE = 1213.11
spam score = 44.2166
documents = 217
clusterid = c2f768410
RMSE = 1213.91
spam score = 68.5959
documents = 678
clusterid = c2f3a91f0
RMSE = 1215.5
spam score = 49.4506
documents = 1205
clusterid = c2fe54a60
RMSE = 1216.1
spam score = 78.3333
documents = 3
clusterid = c2fc4fd20
RMSE = 1217.26
spam score = 50.7755
documents = 7580
clusterid = c2f965c10
RMSE = 1217.69
spam score = 52.3109
documents = 402
clusterid = c2f7fe4d0
RMSE = 1219.26
spam score = 56.2901
documents = 131
clusterid = c2fa4afe0
RMSE = 1220.99
spam score = 62.0411
documents = 219
clusterid = c2fa36270
RMSE = 1221.85
spam score = 46.1827
documents = 1921
clusterid = c2fb9c990
RMSE = 1224
spam score = 59.0606
documents = 9400
clusterid = c2f51c920
RMSE = 1225.03
spam score = 27.0123
documents = 163
clusterid = c2fe86aa0
RMSE = 1226.38
spam score = 48.5516
documents = 1280
clusterid = c2fb72eb0
RMSE = 1226.93
spam score = 43.6785
documents = 706
clusterid = c2f1e28e0
RMSE = 1231.03
spam score = 29.0347
documents = 173
clusterid = c2fd73940
RMSE = 1231.14
spam score = 51.881
documents = 10257
clusterid = c2f8902e0
RMSE = 1232.41
spam score = 58.7693
documents = 6173
clusterid = c2f840fd0
RMSE = 1233.67
spam score = 46.0222
documents = 270
clusterid = c2fc79800
RMSE = 1234.77
spam score = 79.7059
documents = 51
clusterid = c2fede310
RMSE = 1235.22
spam score = 86.9453
documents = 8962
clusterid = c2f6c5b40
RMSE = 1235.78
spam score = 8.88889
documents = 9
clusterid = c2fed5db0
RMSE = 1241.95
spam score = 66.1096
documents = 1742
clusterid = c2f87f820
RMSE = 1245.32
spam score = 94.25
documents = 4
clusterid = c30033f70
RMSE = 1246.26
spam score = 66.1852
documents = 27
clusterid = c2fe09a00
RMSE = 1247.75
spam score = 44.5054
documents = 3831
clusterid = c2feeab20
RMSE = 1248.42
spam score = 51.24
documents = 1696
clusterid = c2f2746f0
RMSE = 1253.54
spam score = 16.3038
documents = 474
clusterid = c2fcd1070
RMSE = 1254.04
spam score = 53.2311
documents = 9792
clusterid = c2fa812d0
RMSE = 1254.38
spam score = 88.5993
documents = 297
clusterid = c2f2af0b0
RMSE = 1255.8
spam score = 73.3
documents = 10
clusterid = c2fad8b40
RMSE = 1256.01
spam score = 66.1755
documents = 9270
clusterid = c2fc477c0
RMSE = 1258
spam score = 68.2901
documents = 3568
clusterid = c2f9fff80
RMSE = 1258.87
spam score = 53.4733
documents = 5641
clusterid = c2f116330
RMSE = 1260.67
spam score = 43.3141
documents = 156
clusterid = c2f845280
RMSE = 1261.7
spam score = 59.8535
documents = 6485
clusterid = c2f5b6c90
RMSE = 1266.54
spam score = 24.9625
documents = 80
clusterid = c2fbc6470
RMSE = 1269.75
spam score = 57.215
documents = 126801
clusterid = c2fbca720
RMSE = 1270.85
spam score = 44.8986
documents = 69
clusterid = c2fcee340
RMSE = 1271.11
spam score = 47.4483
documents = 6079
clusterid = c2fa577f0
RMSE = 1272.29
spam score = 67.2877
documents = 6503
clusterid = c2fa70810
RMSE = 1272.94
spam score = 41.1727
documents = 2634
clusterid = c2fcc05b0
RMSE = 1273.68
spam score = 45.2806
documents = 5488
clusterid = c2f84d7e0
RMSE = 1273.83
spam score = 27.3049
documents = 551
clusterid = c2f0be9a0
RMSE = 1273.97
spam score = 65.5398
documents = 176
clusterid = c2fb83970
RMSE = 1274.09
spam score = 37.1085
documents = 129
clusterid = c2fe014a0
RMSE = 1274.43
spam score = 43.378
documents = 2233
clusterid = c2ffcbc40
RMSE = 1275.06
spam score = 39.5632
documents = 1124
clusterid = c2fdcf460
RMSE = 1275.48
spam score = 24.0952
documents = 147
clusterid = c2ffb2c20
RMSE = 1276.17
spam score = 21.6505
documents = 1834
clusterid = c2f5cba00
RMSE = 1276.23
spam score = 29.6739
documents = 46
clusterid = c2f901b90
RMSE = 1280.29
spam score = 62.3259
documents = 1516
clusterid = c2fff5720
RMSE = 1283.74
spam score = 58.326
documents = 54570
clusterid = c2f280f00
RMSE = 1284.76
spam score = 62.5618
documents = 938
clusterid = c2fcf25f0
RMSE = 1286.39
spam score = 58.4343
documents = 1812
clusterid = c2fa53540
RMSE = 1286.59
spam score = 46.2805
documents = 4585
clusterid = c2f86aab0
RMSE = 1288.82
spam score = 16.9167
documents = 12
clusterid = c2fefb5e0
RMSE = 1292.9
spam score = 42.4638
documents = 69
clusterid = c2fba0c40
RMSE = 1301.3
spam score = 22.6057
documents = 2024
clusterid = c2f43b000
RMSE = 1301.72
spam score = 56.5215
documents = 418
clusterid = c2f997c50
RMSE = 1302.44
spam score = 11.1912
documents = 68
clusterid = c3003c4d0
RMSE = 1305.94
spam score = 49.2916
documents = 3248
clusterid = c2f08c880
RMSE = 1307.74
spam score = 83.6879
documents = 173
clusterid = c2fa8dae0
RMSE = 1309.69
spam score = 9.39623
documents = 689
clusterid = c2f89caf0
RMSE = 1309.83
spam score = 60.5852
documents = 904
clusterid = c2f7b3470
RMSE = 1315.26
spam score = 45.3597
documents = 481
clusterid = c2f623270
RMSE = 1316.08
spam score = 48.8736
documents = 182
clusterid = c2f99bf00
RMSE = 1317.53
spam score = 57.7969
documents = 2802
clusterid = c2fc53fd0
RMSE = 1319.55
spam score = 56.318
documents = 1352
clusterid = c2f933bd0
RMSE = 1320.42
spam score = 85.3981
documents = 108
clusterid = c2f503900
RMSE = 1322.07
spam score = 60.3551
documents = 107
clusterid = c2f30ee80
RMSE = 1322.78
spam score = 33.3213
documents = 859
clusterid = c2fe2af80
RMSE = 1325.54
spam score = 52.3123
documents = 8590
clusterid = c2f109b20
RMSE = 1327.64
spam score = 54.4467
documents = 338
clusterid = c2f90e3a0
RMSE = 1327.77
spam score = 61.6268
documents = 3162
clusterid = c2fd62e80
RMSE = 1328.34
spam score = 41.6737
documents = 95
clusterid = c2fda5980
RMSE = 1331.55
spam score = 55.3096
documents = 4878
clusterid = c2fb90180
RMSE = 1331.91
spam score = 62.9742
documents = 6748
clusterid = c2f0b2110
RMSE = 1333.72
spam score = 88.2553
documents = 47
clusterid = c2fd0b610
RMSE = 1333.95
spam score = 54.1272
documents = 6798
clusterid = c2fc5c530
RMSE = 1335.48
spam score = 44.8128
documents = 1442
clusterid = c2ff95950
RMSE = 1336.02
spam score = 58.0773
documents = 5305
clusterid = c2fb4d680
RMSE = 1339.21
spam score = 72.4685
documents = 222
clusterid = c2f09d3a0
RMSE = 1339.96
spam score = 36.9978
documents = 890
clusterid = c2ff743d0
RMSE = 1340.68
spam score = 60.75
documents = 36
clusterid = c2fd41900
RMSE = 1341.3
spam score = 19.9877
documents = 732
clusterid = c2f077ac0
RMSE = 1345.84
spam score = 79.125
documents = 8
clusterid = c2f2d48e0
RMSE = 1348.1
spam score = 17.8716
documents = 732
clusterid = c2fd9d420
RMSE = 1348.3
spam score = 50
documents = 10
clusterid = c2f7e1200
RMSE = 1350
spam score = 85.4769
documents = 65
clusterid = c2f1cdb70
RMSE = 1353.4
spam score = 56
documents = 13
clusterid = c2fd8c960
RMSE = 1355.31
spam score = 70.1842
documents = 152
clusterid = c2fdf8f40
RMSE = 1355.39
spam score = 53.2803
documents = 3717
clusterid = c2f3a0c90
RMSE = 1357.04
spam score = 55.1273
documents = 55
clusterid = c2fe2f230
RMSE = 1358.81
spam score = 47.4761
documents = 1254
clusterid = c2fcccdc0
RMSE = 1360.8
spam score = 40.4373
documents = 1802
clusterid = c2f7e9760
RMSE = 1362.2
spam score = 28.3781
documents = 402
clusterid = c2fde8480
RMSE = 1362.39
spam score = 51.4268
documents = 8564
clusterid = c2f267ee0
RMSE = 1364.68
spam score = 45.0333
documents = 481
clusterid = c2f9b91d0
RMSE = 1368.14
spam score = 63.153
documents = 1366
clusterid = c2fd80150
RMSE = 1371.67
spam score = 62.9159
documents = 15000
clusterid = c2f9dea00
RMSE = 1372.12
spam score = 58.0767
documents = 3979
clusterid = c2f802780
RMSE = 1373.85
spam score = 47.0991
documents = 11256
clusterid = c2f42a540
RMSE = 1374.85
spam score = 34.6887
documents = 742
clusterid = c2f351980
RMSE = 1379.72
spam score = 47.2683
documents = 41
clusterid = c2f17e660
RMSE = 1383.17
spam score = 58.3132
documents = 562
clusterid = c2f4c50b0
RMSE = 1388.98
spam score = 52.1232
documents = 5164
clusterid = c2f21ce80
RMSE = 1395.62
spam score = 48.5672
documents = 67
clusterid = c2ff99c00
RMSE = 1397.42
spam score = 39.6851
documents = 2334
clusterid = c2f98b440
RMSE = 1408.91
spam score = 45.928
documents = 2318
clusterid = c2fdc6f00
RMSE = 1416.89
spam score = 57.5047
documents = 2990
clusterid = c2f9c59e0
RMSE = 1421.62
spam score = 60.2168
documents = 1093
clusterid = c2f68f850
RMSE = 1425.12
spam score = 40.625
documents = 8
clusterid = c2f182bb0
RMSE = 1427.78
spam score = 22.0577
documents = 364
clusterid = c2f2d0630
RMSE = 1429.31
spam score = 80.5
documents = 10
clusterid = c2f640540
RMSE = 1430.08
spam score = 12.76
documents = 25
clusterid = c2f8a0da0
RMSE = 1431.74
spam score = 55.1809
documents = 7673
clusterid = c2f387c70
RMSE = 1455.75
spam score = 50.4058
documents = 69
clusterid = c2f665d70
RMSE = 1459.44
spam score = 44.1
documents = 70
clusterid = c2f507bb0
RMSE = 1466.04
spam score = 26.8095
documents = 21
clusterid = c2fdb6440
RMSE = 1466.64
spam score = 55.5672
documents = 3094
clusterid = c2fda16d0
RMSE = 1477.61
spam score = 42.7857
documents = 14
clusterid = c2f721660
RMSE = 1485.22
spam score = 42.0444
documents = 180
clusterid = c2fe22a20
RMSE = 1488.77
spam score = 72.2376
documents = 808
clusterid = c2f633d30
RMSE = 1500.55
spam score = 35.9189
documents = 37
clusterid = c2fb666a0
RMSE = 1501.59
spam score = 19.0667
documents = 15
clusterid = c2fcfab50
RMSE = 1529.69
spam score = 62.5451
documents = 233
clusterid = c2f725910
RMSE = 1529.81
spam score = 29.375
documents = 8
clusterid = c2f5e0770
RMSE = 1538.36
spam score = 38.2152
documents = 79
clusterid = c2f231bf0
RMSE = 1553.62
spam score = 48.3542
documents = 48
clusterid = c2f0c2c50
RMSE = 1565.14
spam score = 44
documents = 3
clusterid = c2f0c6f00
RMSE = 1565.62
spam score = 63.5
documents = 2
clusterid = c2fe71d30
RMSE = 1568.69
spam score = 14.8455
documents = 110
clusterid = c2f394480
RMSE = 1653
spam score = 13
documents = 1
clusterid = c2fd13b70
RMSE = 1711.34
spam score = 56.8462
documents = 13
clusterid = c2f80ace0
RMSE = 1818
spam score = 14
documents = 1
clusterid = c2f8f10d0
RMSE = 1932
spam score = 59
documents = 1
distance = 0
spam score = 15
title = ''

distance = 0
spam score = 91
title = ''

distance = 0
spam score = 20
title = ''

distance = 0
spam score = 55
title = ''

distance = 0
spam score = 55
title = ''

distance = 4
spam score = 33
title = ''

distance = 5
spam score = 37
title = ''

distance = 19
spam score = 5
title = ''

distance = 21
spam score = 6
title = ''

distance = 3
spam score = 35
title = 'makeup bag raquo on the go raquo email'

distance = 9
spam score = 47
title = 'makeup bag raquo best of 2006 raquo email'

distance = 17
spam score = 44
title = 'makeup bag raquo party time raquo email'

distance = 24
spam score = 40
title = 'makeup bag raquo how green is your makeup raquo email'

distance = 32
spam score = 39
title = 'makeup bag raquo speaking of beauty8230 raquo email'

distance = 33
spam score = 42
title = 'makeup bag raquo a perfect 10 raquo email'

distance = 33
spam score = 43
title = 'makeup bag raquo party time part ii raquo email'

distance = 39
spam score = 48
title = 'makeup bag raquo new idealist raquo email'

distance = 39
spam score = 44
title = 'makeup bag raquo it8217s megan raquo email'

distance = 40
spam score = 40
title = 'makeup bag raquo ps kiss raquo email'

distance = 41
spam score = 45
title = 'makeup bag raquo party time part iii raquo email'

distance = 43
spam score = 41
title = 'makeup bag raquo mac in 3d raquo email'

distance = 47
spam score = 32
title = 'makeup bag raquo goodbye raquo email'

distance = 50
spam score = 42
title = 'makeup bag raquo how not to look old raquo email'

distance = 51
spam score = 30
title = 'makeup bag raquo 8220help me choose8221 raquo email'

distance = 52
spam score = 35
title = 'makeup bag raquo ask me anything raquo email'

distance = 56
spam score = 52
title = 'makeup bag raquo our lucky number raquo email'

distance = 56
spam score = 40
title = 'makeup bag raquo finally a product body review raquo email'

distance = 59
spam score = 33
title = 'makeup bag raquo taking a hint raquo email'

distance = 59
spam score = 35
title = 'makeup bag raquo because sometimes it8217s all about the easy raquo email'

distance = 80
spam score = 39
title = 'makeup bag raquo what8217s in my shower september edition raquo email'

distance = 80
spam score = 36
title = 'makeup bag raquo exciting stuff people raquo email'

distance = 81
spam score = 27
title = 'makeup bag raquo beauty editors8217 top picks from 2008 raquo email'

distance = 81
spam score = 43
title = 'makeup bag raquo whipped cream for the eyes raquo email'

distance = 83
spam score = 41
title = 'makeup bag raquo princess kate raquo email'

distance = 84
spam score = 41
title = 'makeup bag raquo moisture where it counts raquo email'

distance = 85
spam score = 38
title = 'makeup bag raquo make up amp go collection raquo email'

distance = 87
spam score = 42
title = 'makeup bag raquo bailey8217s 400 giveaway raquo email'

distance = 91
spam score = 38
title = 'makeup bag raquo we8217ll always have paris raquo email'

distance = 91
spam score = 37
title = 'makeup bag raquo bliss the big orange raquo email'

distance = 98
spam score = 44
title = 'makeup bag raquo mac painterly raquo email'

distance = 101
spam score = 42
title = 'makeup bag raquo 7 days of holiday looks day 4 raquo email'

distance = 104
spam score = 41
title = 'makeup bag raquo lab series skincare for men raquo email'

distance = 104
spam score = 39
title = 'makeup bag raquo reason 5267 why my kids get everything they want raquo email'

distance = 107
spam score = 28
title = 'makeup bag raquo halloween fun with bree raquo email'

distance = 107
spam score = 41
title = 'makeup bag raquo pink raspberry part ii raquo email'

distance = 109
spam score = 49
title = 'makeup bag raquo mac flashtronic raquo email'

distance = 109
spam score = 37
title = 'makeup bag raquo teen corner beating the heat raquo email'

distance = 110
spam score = 42
title = 'makeup bag raquo bobbi brown friends and family event raquo email'

distance = 110
spam score = 41
title = 'makeup bag raquo summer makeup bag contest marie8217s makeup bag raquo email'

distance = 122
spam score = 38
title = 'makeup bag raquo mac mineralize no longer limited edition raquo email'

distance = 122
spam score = 33
title = 'makeup bag raquo for days when 8220pretty8221 seems further away than the horizon raquo email'

distance = 124
spam score = 37
title = 'makeup bag raquo corliss dress from anthropologie raquo email'

distance = 125
spam score = 41
title = 'makeup bag raquo kenzo friends and family event raquo email'

distance = 125
spam score = 46
title = 'makeup bag raquo smashbox holiday 2007 beyond beauty raquo email'

distance = 126
spam score = 41
title = 'makeup bag raquo mac fall 2009 style black collection raquo email'

distance = 127
spam score = 36
title = 'makeup bag raquo philosophy exclusives at sephora raquo email'

distance = 129
spam score = 46
title = 'makeup bag raquo clinique rsvp to colour raquo email'

distance = 131
spam score = 45
title = 'makeup bag raquo guerlain parure raquo email'

distance = 132
spam score = 44
title = 'makeup bag raquo irving rice illuminated mirror raquo email'

distance = 140
spam score = 36
title = 'makeup bag raquo ed westwick in teen vogue raquo email'

distance = 140
spam score = 36
title = 'makeup bag raquo viva la juicy raquo email'

distance = 141
spam score = 41
title = 'makeup bag raquo johnson8217s baby oil body wash raquo email'

distance = 141
spam score = 49
title = 'makeup bag raquo bobbi brown violet collection for spring raquo email'

distance = 143
spam score = 48
title = 'makeup bag raquo givenchy holiday 2007 collection raquo email'

distance = 145
spam score = 39
title = 'makeup bag raquo becca spring 2008 paradise lost raquo email'

distance = 145
spam score = 30
title = 'makeup bag raquo get the look jennifer hudson at the superbowl raquo email'

distance = 146
spam score = 38
title = 'makeup bag raquo daily style david yurman ring raquo email'

distance = 146
spam score = 34
title = 'makeup bag raquo essie summer 2011 braziliant raquo email'

distance = 151
spam score = 31
title = 'makeup bag raquo teen corner lauren conrad makeup raquo email'

distance = 154
spam score = 40
title = 'makeup bag raquo urban decay friends and family sale raquo email'

distance = 155
spam score = 37
title = 'makeup bag raquo mac spring 2011 makeup collection quite cute raquo email'

distance = 156
spam score = 44
title = 'makeup bag raquo new cargo color eyeshadow palette raquo email'

distance = 156
spam score = 43
title = 'makeup bag raquo new ad mac viva glam vi raquo email'

distance = 156
spam score = 43
title = 'makeup bag raquo bobbi brown cocoa mauve collection raquo email'

distance = 158
spam score = 39
title = 'makeup bag raquo get glowing skin kai body glow raquo email'

distance = 158
spam score = 24
title = 'makeup bag raquo clinique holiday cards and comfort on call raquo email'

distance = 159
spam score = 44
title = 'makeup bag raquo summer makeup bag contest sezin8217s makeup bag raquo email'

distance = 160
spam score = 42
title = 'makeup bag raquo daily style red furla bag raquo email'

distance = 160
spam score = 40
title = 'makeup bag raquo daily style ice castle ring from anthropologie raquo email'

distance = 168
spam score = 36
title = 'makeup bag raquo taylor lautner on the october cover of teen vogue raquo email'

distance = 169
spam score = 33
title = 'makeup bag raquo teen corner audrina patridge makeup raquo email'

distance = 172
spam score = 37
title = 'makeup bag raquo sephora brand smoky eye kit raquo email'

distance = 174
spam score = 38
title = 'makeup bag raquo get the look fergie8217s fab 408242s updo raquo email'

distance = 175
spam score = 38
title = 'makeup bag raquo senior prom with flirt cosmetics raquo email'

distance = 176
spam score = 39
title = 'makeup bag raquo holiday travel tips with stephanie johnson raquo email'

distance = 178
spam score = 43
title = 'makeup bag raquo daily style monogrammed square soap set raquo email'

distance = 178
spam score = 41
title = 'makeup bag raquo clarins spa in neuilly france raquo email'

distance = 178
spam score = 34
title = 'makeup bag raquo the body shop nutriganics smoothing mask raquo email'

distance = 179
spam score = 34
title = 'makeup bag raquo daily style banana republic jewel flower ring raquo email'

distance = 192
spam score = 39
title = 'makeup bag raquo chanel gloss fluo de chanel raquo email'

distance = 196
spam score = 41
title = 'makeup bag raquo coco mademoiselle starring keira knightley raquo email'

distance = 197
spam score = 46
title = 'makeup bag raquo wherein we raid the cabinets of another beautyobsessedproductjunkie raquo email'

distance = 198
spam score = 33
title = 'makeup bag raquo kevyn aucoin celestial powder raquo email'

distance = 199
spam score = 39
title = 'makeup bag raquo tweezerman for benefit slant tweezer raquo email'

distance = 199
spam score = 47
title = 'makeup bag raquo givenchy springsummer 2009 maharani collection raquo email'

distance = 203
spam score = 41
title = 'makeup bag raquo shu uemura spring mode collection rebirth raquo email'

distance = 205
spam score = 41
title = 'makeup bag raquo pama liqueur offers free essie polish raquo email'

distance = 215
spam score = 42
title = 'makeup bag raquo eva mendes is the new face of angel by thierry mugler raquo email'

distance = 217
spam score = 35
title = 'makeup bag raquo daily style fendi chef zucca tote raquo email'

distance = 269
spam score = 36
title = 'makeup bag raquo daily style fentonfallon for j crew carrington crystal bow necklace raquo email'

distance = 272
spam score = 37
title = 'makeup bag raquo lancme scillation powerfoundation microvibrating polishing mineral makeup raquo email'

distance = 278
spam score = 38
title = 'makeup bag raquo molton brown celestial maracuja eau de parfum raquo email'

distance = 283
spam score = 41
title = 'makeup bag raquo estee lauder renutriv ultimate youth creme raquo email'

distance = 283
spam score = 37
title = 'makeup bag raquo bourjois dose de nacres mini loose powder eye shadow raquo email'

distance = 301
spam score = 40
title = 'makeup bag raquo sparkles amp rubies raquo email'

distance = 309
spam score = 45
title = 'makeup bag raquo bath amp body works orange sapphire shower gel raquo email'

distance = 309
spam score = 36
title = 'makeup bag raquo daily style bcbg max azria strapless printed chiffon dress raquo email'

distance = 316
spam score = 36
title = 'makeup bag raquo lavender and vanilla what more could a girl want raquo email'

distance = 322
spam score = 42
title = 'makeup bag raquo votre vu duette luxe lip balm amp hand crme raquo email'

distance = 31
spam score = 51
title = 'before the fame final 1mp3 hulk share music distribution platform'

distance = 35
spam score = 46
title = 'kill your selfmp3 hulk share music distribution platform'

distance = 36
spam score = 37
title = 'when i make itmp3 hulk share music distribution platform'

distance = 36
spam score = 46
title = 'my timemp3 hulk share music distribution platform'

distance = 36
spam score = 37
title = '5lickmp3 hulk share music distribution platform'

distance = 40
spam score = 41
title = 'on the low finalmp3 hulk share music distribution platform'

distance = 40
spam score = 47
title = '04 track 4mp3 hulk share music distribution platform'

distance = 42
spam score = 51
title = '01 fire girlmp3 hulk share music distribution platform'

distance = 42
spam score = 44
title = 'cupmp3 hulk share music distribution platform'

distance = 43
spam score = 44
title = 'love of the gamemp3 hulk share music distribution platform'

distance = 43
spam score = 42
title = 'brown eyesmp3 hulk share music distribution platform'

distance = 43
spam score = 50
title = 'game time cinemamp3 hulk share music distribution platform'

distance = 44
spam score = 43
title = 'escapemp3 hulk share music distribution platform'

distance = 44
spam score = 44
title = '01 gcodemp3 hulk share music distribution platform'

distance = 45
spam score = 39
title = 'all summermp3 hulk share music distribution platform'

distance = 47
spam score = 47
title = 'earthmp3 hulk share music distribution platform'

distance = 47
spam score = 54
title = 'living lifemp3 hulk share music distribution platform'

distance = 47
spam score = 37
title = 'body languagemp3 hulk share music distribution platform'

distance = 48
spam score = 39
title = '03 sounds of my citymp3 hulk share music distribution platform'

distance = 50
spam score = 32
title = '01 if i ruled the worldmp3 hulk share music distribution platform'

distance = 90
spam score = 51
title = 'chop citymp3 hulk share music distribution platform'

distance = 90
spam score = 36
title = 'paidzgot me in my zone chopped skr3wdmp3 hulk share music distribution platform'

distance = 90
spam score = 44
title = 'antifreeze mastermp3 hulk share music distribution platform'

distance = 90
spam score = 46
title = 'my joy roughmp3 hulk share music distribution platform'

distance = 91
spam score = 52
title = 'consequencekumatemp3 hulk share music distribution platform'

distance = 91
spam score = 43
title = 't monkeymp3 hulk share music distribution platform'

distance = 91
spam score = 47
title = 'goes awaymp3 hulk share music distribution platform'

distance = 91
spam score = 51
title = 'freewaylovemp3 hulk share music distribution platform'

distance = 91
spam score = 40
title = 'henny purplemp3 hulk share music distribution platform'

distance = 91
spam score = 46
title = 'wghwelcome to the gate of housepako mike dubmp3 hulk share music distribution platform'

distance = 105
spam score = 34
title = 'dont know me prod by ditwenimp3 hulk share music distribution platform'

distance = 105
spam score = 42
title = 'magicmp3 hulk share music distribution platform'

distance = 105
spam score = 48
title = 'ronny ronny citymp3 hulk share music distribution platform'

distance = 105
spam score = 30
title = 'sarkodie6 feetmp3 hulk share music distribution platform'

distance = 105
spam score = 39
title = 'ric wetin u domp3 hulk share music distribution platform'

distance = 105
spam score = 49
title = 'little secret fireman ft passion pit and lil waynemp3 hulk share music distribution platform'

distance = 105
spam score = 51
title = 'hypnotized ft jilexmp3 hulk share music distribution platform'

distance = 105
spam score = 39
title = 'wilhelms scream remixmp3 hulk share music distribution platform'

distance = 106
spam score = 46
title = 'j cole freestyle in atlantic city house of bluesmp3 hulk share music distribution platform'

distance = 106
spam score = 42
title = 'letthebeatridemp3 hulk share music distribution platform'

distance = 119
spam score = 45
title = 'camron bottom of the pussy holemp3 hulk share music distribution platform'

distance = 119
spam score = 42
title = 'teaser mix 2 summer editionmp3 hulk share music distribution platform'

distance = 119
spam score = 45
title = 'pyrexpimpmp3 hulk share music distribution platform'

distance = 119
spam score = 39
title = 'igottajobforyou mixmp3 hulk share music distribution platform'

distance = 119
spam score = 46
title = 'down lowforbs ft sugarcreptunesmp3 hulk share music distribution platform'

distance = 120
spam score = 47
title = 'want it all prod by triple jmp3 hulk share music distribution platform'

distance = 120
spam score = 42
title = 'the rainmp3 hulk share music distribution platform'

distance = 120
spam score = 38
title = '01 gushy pussym4a hulk share music distribution platform'

distance = 120
spam score = 40
title = '2 chainz feat jadakiss one day at a time no tagsmp3 hulk share music distribution platform'

distance = 120
spam score = 44
title = 'tiredofschool l waun splashrobmp3 hulk share music distribution platform'

distance = 134
spam score = 37
title = 'i love you guapmp3 hulk share music distribution platform'

distance = 134
spam score = 40
title = 'lil chris 911mp3 hulk share music distribution platform'

distance = 134
spam score = 36
title = 'ashunwith you prod by ctea kayso cray muzikmp3 hulk share music distribution platform'

distance = 134
spam score = 46
title = 'truey donatello countdown valentines day freestylemp3 hulk share music distribution platform'

distance = 134
spam score = 40
title = 'popsy babymy adidasmp3 hulk share music distribution platform'

distance = 134
spam score = 50
title = 'uhc mikelboat lil pope samsoul im a boss gh versionmp3 hulk share music distribution platform'

distance = 134
spam score = 44
title = 'pusha tpeso freestylemp3 hulk share music distribution platform'

distance = 134
spam score = 51
title = 'im a boss remakemp3 hulk share music distribution platform'

distance = 134
spam score = 46
title = 'product clock workmp3 hulk share music distribution platform'

distance = 134
spam score = 36
title = 'somebody that i used to know gotye x mikill panemp3 hulk share music distribution platform'

distance = 151
spam score = 48
title = 'iam african fif ft kwaku manump3 hulk share music distribution platform'

distance = 151
spam score = 47
title = 'back it on upmp3 hulk share music distribution platform'

distance = 151
spam score = 47
title = 'greenteam somebody prodby mikedotredmp3 hulk share music distribution platform'

distance = 151
spam score = 37
title = 'rc1 god put a smile upon your facemp3 hulk share music distribution platform'

distance = 151
spam score = 39
title = 'billoniare remix by benel prod by tysax mp3 hulk share music distribution platform'

distance = 151
spam score = 43
title = 'im a boss freestylemp3 hulk share music distribution platform'

distance = 151
spam score = 45
title = 'hirelearningeldermp3 hulk share music distribution platform'

distance = 151
spam score = 44
title = '6158demilovatogiftofafriendmp3 hulk share music distribution platform'

distance = 151
spam score = 44
title = 'chap the jedi 2mp3 hulk share music distribution platform'

distance = 151
spam score = 42
title = 'creep serk remixmp3 hulk share music distribution platform'

distance = 178
spam score = 42
title = 'youngsosaftdannypuntorojohappyhappydembowremixprodbyromymp3 hulk share music distribution platform'

distance = 178
spam score = 48
title = 'cory moaint nobody trippin remix feat ugk david bannermp3 hulk share music distribution platform'

distance = 179
spam score = 36
title = 'tears of joym4a hulk share music distribution platform'

distance = 179
spam score = 43
title = 'hush crooked stilo ft jan jmp3 hulk share music distribution platform'

distance = 179
spam score = 45
title = 'tunde ednut buga wonmp3 hulk share music distribution platform'

distance = 179
spam score = 46
title = '100 hunnit freestyle the boul taymp3 hulk share music distribution platform'

distance = 180
spam score = 41
title = 'bo hands on the wheel remake ft jayred and lawlessmp3 hulk share music distribution platform'

distance = 180
spam score = 34
title = 'dj oktay ft strome alors on dansemp3 hulk share music distribution platform'

distance = 180
spam score = 45
title = 'dag we raw studio 69zip hulk share music distribution platform'

distance = 181
spam score = 46
title = '16 call it quits remix feat joell ortiz prod yfamemp3 hulk share music distribution platform'

distance = 225
spam score = 43
title = 'bnp2servicepackzip hulk share music distribution platform'

distance = 225
spam score = 41
title = 'djiamvdaymixmp3 hulk share music distribution platform'

distance = 225
spam score = 35
title = 'my mind driftsmp3 hulk share music distribution platform'

distance = 226
spam score = 46
title = 'ayouowemeftlabrinthmp3 hulk share music distribution platform'

distance = 227
spam score = 44
title = 'latocha feat missy elliott nobodys perfect radio clean mp3 hulk share music distribution platform'

distance = 227
spam score = 44
title = 'the temper trap axwell dirty south tim mason the sweet moment ben rose house injection edit wwwmusic4youhump3 hulk share music distribution platform'

distance = 227
spam score = 35
title = 'luxury sport ft sir michael rocksmp3 hulk share music distribution platform'

distance = 227
spam score = 42
title = 'lo keys feat fred the godson young gliss livesosa pop off prod by zone beatsmp3 hulk share music distribution platform'

distance = 227
spam score = 43
title = 'em royce juan ep 2mp3 hulk share music distribution platform'

distance = 227
spam score = 50
title = 'ti talks about his motivation for creating fck the city upmp3 hulk share music distribution platform'

distance = 271
spam score = 52
title = 'slim deja vu ft rick ross playnskillzmp3 hulk share music distribution platform'

distance = 272
spam score = 43
title = 'cory gunz outta my mindmp3 hulk share music distribution platform'

distance = 273
spam score = 31
title = 'yaw siki ft chase one more flow downloadxclusive only on africas 1 premier promo wwwsvpromzcom bbm pin 239eeca9mp3 hulk share music distribution platform'

distance = 273
spam score = 39
title = 'norescared money feat pusha t meek millmp3 hulk share music distribution platform'

distance = 273
spam score = 39
title = 'michael jackson the way you make me feel persis remixtaggedmp3 hulk share music distribution platform'

distance = 273
spam score = 37
title = 'domo genesis cashmeremp3 hulk share music distribution platform'

distance = 273
spam score = 42
title = '23 big leto already nowmp3 hulk share music distribution platform'

distance = 273
spam score = 46
title = 'l bronze ft inna oye hands up innatvcommp3 hulk share music distribution platform'

distance = 273
spam score = 43
title = 'srh have a good eveningmp3 hulk share music distribution platform'

distance = 274
spam score = 52
title = 'lay lanskey feat boaz 600 spliffs remixmp3 hulk share music distribution platform'

distance = 783
spam score = 47
title = 'hulk share music distribution platform'

distance = 1218
spam score = 7
title = 'digi me ayi jalebi bai naacht dekh jalebi bairajasthanibrazil house mix djchannu 7737339125mp3 hulk share music distribution platform'

distance = 1777
spam score = 54
title = 'artist luciano cacciavillani proudmusiclibrarycom 1'

distance = 1793
spam score = 10
title = 'tribal tech mixes and tribal tech tracks by dj39s who mix tribal tech page 1'

distance = 1798
spam score = 13
title = 'download latest tech house dj mixes stream the most recent tech house dj mixes free page 2'

distance = 1819
spam score = 10
title = 'deep tech house mixes and deep tech house tracks by dj39s who mix deep tech house page 1'

distance = 68
spam score = 18
title = ''

distance = 68
spam score = 16
title = ''

distance = 75
spam score = 18
title = ''

distance = 75
spam score = 16
title = ''

distance = 80
spam score = 17
title = ''

distance = 80
spam score = 15
title = ''

distance = 84
spam score = 16
title = ''

distance = 116
spam score = 16
title = ''

distance = 120
spam score = 19
title = ''

distance = 134
spam score = 17
title = ''

distance = 142
spam score = 18
title = ''

distance = 143
spam score = 18
title = ''

distance = 146
spam score = 18
title = ''

distance = 199
spam score = 16
title = ''

distance = 217
spam score = 17
title = ''

distance = 225
spam score = 18
title = ''

distance = 273
spam score = 18
title = ''

distance = 292
spam score = 18
title = ''

distance = 294
spam score = 18
title = ''

distance = 328
spam score = 17
title = ''

distance = 597
spam score = 18
title = ''

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 87
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 20
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 45
spam score = 87
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 52
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 89
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 89
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 89
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 68
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 89
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 89
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 71
spam score = 89
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 87
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 88
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 88
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 88
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 88
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 89
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 89
spam score = 91
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 90
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 90
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 90
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 111
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 112
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 112
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 112
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 112
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 112
spam score = 89
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 113
spam score = 88
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 113
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 114
spam score = 91
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 115
spam score = 90
title = 'keysdan live entertainment disc jockeys karaoke jams'

distance = 328
spam score = 91
title = 'keysdan belly dance by renee'

distance = 329
spam score = 87
title = 'keysdan acorn arkansas disc jockey dj karaoke jams djs dj deejays disk jockeys radio broadcaster'

distance = 357
spam score = 89
title = 'keysdan services voice imaging'

distance = 373
spam score = 86
title = 'keysdan wedding'

distance = 373
spam score = 87
title = 'keysdan birthday'

distance = 376
spam score = 87
title = 'keysdan anniversary'

distance = 378
spam score = 87
title = 'keysdan engagement'

distance = 378
spam score = 86
title = 'keysdan bachelor'

distance = 378
spam score = 89
title = 'keysdan bachelor'

distance = 380
spam score = 89
title = 'keysdan theme parties'

distance = 1633
spam score = 91
title = 'welcome to swissmar'

distance = 1826
spam score = 58
title = 'gt'

distance = 1826
spam score = 57
title = 'gt'

distance = 29
spam score = 14
title = 'kandinsky all around art printnbspnbspwassily kandinsky'

distance = 59
spam score = 12
title = 'balancement art printnbspnbspwassily kandinsky'

distance = 73
spam score = 13
title = 'the bridge art printnbspnbspwassily kandinsky'

distance = 79
spam score = 14
title = 'improvisation no 35 art print by kandinskynbspnbspwassily kandinsky'

distance = 87
spam score = 13
title = 'kandinsky art prints black frame art printnbspnbspwassily kandinsky'

distance = 89
spam score = 13
title = 'diagonale art print by kandinskynbspnbspwassily kandinsky'

distance = 94
spam score = 12
title = 'improvisation no 6 art printnbspnbspwassily kandinsky'

distance = 95
spam score = 14
title = 'komposition x c1939 art printnbspnbspwassily kandinsky'

distance = 101
spam score = 15
title = 'circles in a circle art printnbspnbspwassily kandinsky'

distance = 103
spam score = 13
title = 'form art printnbspnbspwassily kandinsky'

distance = 104
spam score = 15
title = 'dusk art print by kandinskynbspnbspwassily kandinsky'

distance = 107
spam score = 14
title = 'merry structure art printnbspnbspwassily kandinsky'

distance = 108
spam score = 14
title = 'color studies art printnbspnbspwassily kandinsky'

distance = 108
spam score = 14
title = 'lunch art printnbspnbspwassily kandinsky'

distance = 112
spam score = 13
title = 'two black spots art print by kandinskynbspnbspwassily kandinsky'

distance = 112
spam score = 14
title = 'man on a horse art printnbspnbspwassily kandinsky'

distance = 113
spam score = 14
title = 'blue art printnbspnbspwassily kandinsky'

distance = 113
spam score = 14
title = 'kandinsky art white dot art printnbspnbspwassily kandinsky'

distance = 121
spam score = 14
title = 'succession c1935 art printnbspnbspwassily kandinsky'

distance = 121
spam score = 14
title = 'aufleuchten art printnbspnbspwassily kandinsky'

distance = 128
spam score = 12
title = 'kandinsky8217s late period the arrow 1943 art printnbspnbspwassily kandinsky'

distance = 135
spam score = 15
title = 'study for murnau ii art print by kandinskynbspnbspwassily kandinsky'

distance = 139
spam score = 13
title = 'diagonal 1930 art printnbspnbspwassily kandinsky'

distance = 142
spam score = 13
title = 'composition storm art print by kandinskynbspnbspwassily kandinsky'

distance = 142
spam score = 13
title = 'la forme rouge 1938 art printnbspnbspwassily kandinsky'

distance = 143
spam score = 13
title = 'spitzen in bogen c1927 art printnbspnbspwassily kandinsky'

distance = 143
spam score = 14
title = 'yellow red and blue c1925 art printnbspnbspwassily kandinsky'

distance = 144
spam score = 13
title = 'structure angulaire art print by kandinskynbspnbspwassily kandinsky'

distance = 145
spam score = 14
title = 'summer landscape by wassily kandinsky art printnbspnbspwassily kandinsky'

distance = 147
spam score = 14
title = 'color studies art printnbspnbspwassily kandinsky'

distance = 153
spam score = 14
title = 'komposition vii art printnbspnbspwassily kandinsky'

distance = 153
spam score = 13
title = 'green composition 1923 art printnbspnbspwassily kandinsky'

distance = 154
spam score = 13
title = 'aquarelle gastebuch 1925 art printnbspnbspwassily kandinsky'

distance = 155
spam score = 14
title = 'milieu accompagne art printnbspnbspwassily kandinsky'

distance = 155
spam score = 12
title = 'trente 1937 serigraph by kandinskynbspnbspwassily kandinsky'

distance = 156
spam score = 14
title = 'two green points art printnbspnbspwassily kandinsky'

distance = 156
spam score = 13
title = 'im blau c1925 art printnbspnbspwassily kandinsky'

distance = 158
spam score = 11
title = 'spitzen in bogen c1927 art printnbspnbspwassily kandinsky'

distance = 160
spam score = 12
title = 'tribute to grohmann art printnbspnbspwassily kandinsky'

distance = 160
spam score = 14
title = 'kleine freuden 1913 art printnbspnbspwassily kandinsky'

distance = 161
spam score = 13
title = 'im blau 1925 art print by kandinskynbspnbspwassily kandinsky'

distance = 163
spam score = 12
title = 'kandinsky art milder vorgang 1928 art printnbspnbspwassily kandinsky'

distance = 163
spam score = 12
title = 'autumn river art print by kandinskynbspnbspwassily kandinsky'

distance = 163
spam score = 14
title = 'dame in krinolinen art printnbspnbspwassily kandinsky'

distance = 164
spam score = 14
title = 'heavy red art printnbspnbspwassily kandinsky'

distance = 164
spam score = 13
title = 'dominant curve c1936 art printnbspnbspwassily kandinsky'

distance = 166
spam score = 13
title = 'impression iii concert art printnbspnbspwassily kandinsky'

distance = 167
spam score = 12
title = 'improvisation no 31 sea battle c1913 art printnbspnbspwassily kandinsky'

distance = 167
spam score = 13
title = 'improvisation giclee printnbspnbspwassily kandinsky'

distance = 167
spam score = 12
title = 'kandinsky color study of squares giclee printnbspnbspwassily kandinsky'

distance = 171
spam score = 14
title = 'solid green art printnbspnbspwassily kandinsky'

distance = 172
spam score = 14
title = 'aquarelle sans titre art printnbspnbspwassily kandinsky'

distance = 173
spam score = 14
title = 'kandinsky art aquarelle aus dem 1922 art printnbspnbspwassily kandinsky'

distance = 174
spam score = 13
title = 'black lines c 1913 art printnbspnbspwassily kandinsky'

distance = 179
spam score = 15
title = 'yellow red blue art printnbspnbspwassily kandinsky'

distance = 179
spam score = 14
title = 'kandinsky art les trois ovales art printnbspnbspwassily kandinsky'

distance = 180
spam score = 12
title = 'reciprocal agreement art printnbspnbspwassily kandinsky'

distance = 182
spam score = 13
title = 'multicolored resonance c1928 art printnbspnbspwassily kandinsky'

distance = 186
spam score = 14
title = 'improvisation no 31 sea battle art printnbspnbspwassily kandinsky'

distance = 190
spam score = 14
title = 'kandinsky art one center art printnbspnbspwassily kandinsky'

distance = 193
spam score = 12
title = 'akzent in rosa art printnbspnbspwassily kandinsky'

distance = 198
spam score = 14
title = 'farbstudie quadrate c1913 art printnbspnbspwassily kandinsky'

distance = 199
spam score = 13
title = 'la grande piazza a kiev art printnbspnbspwassily kandinsky'

distance = 199
spam score = 13
title = 'hommage to grohmann art printnbspnbspwassily kandinsky'

distance = 203
spam score = 13
title = 'impression iii concert 1911 art printnbspnbspwassily kandinsky'

distance = 203
spam score = 14
title = 'schweres rot heavy red 1924 art printnbspnbspwassily kandinsky'

distance = 204
spam score = 14
title = 'kandinsky three allies 1936 art printnbspnbspwassily kandinsky'

distance = 209
spam score = 14
title = 'mit und gegen c1929 art printnbspnbspwassily kandinsky'

distance = 210
spam score = 14
title = 'st george 1 art print by wassily kandinskynbspnbspwassily kandinsky'

distance = 210
spam score = 14
title = 'homage to grohmann art printnbspnbspwassily kandinsky'

distance = 215
spam score = 14
title = 'murnau 1909 art printnbspnbspwassily kandinsky'

distance = 216
spam score = 13
title = 'hommage to grohmann art printnbspnbspwassily kandinsky'

distance = 216
spam score = 12
title = 'quiet harmony art printnbspnbspwassily kandinsky'

distance = 221
spam score = 13
title = 'kandinsky art righe di segni art printnbspnbspwassily kandinsky'

distance = 223
spam score = 14
title = 'heavy red art printnbspnbspwassily kandinsky'

distance = 223
spam score = 16
title = 'kandinsky balancement giclee printnbspnbspwassily kandinsky'

distance = 226
spam score = 13
title = 'bustling aquarelle c1923 art printnbspnbspwassily kandinsky'

distance = 227
spam score = 14
title = 'gravitation art printnbspnbspwassily kandinsky'

distance = 230
spam score = 17
title = 'maintaning art print by kandinskynbspnbspwassily kandinsky'

distance = 232
spam score = 14
title = 'hommage a grohmann art printnbspnbspwassily kandinsky'

distance = 241
spam score = 13
title = 'farbstudie quadrate c1913 posternbspnbspwassily kandinsky'

distance = 244
spam score = 16
title = 'kandinsky art la tension double 1938 art printnbspnbspwassily kandinsky'

distance = 244
spam score = 12
title = 'counter gravitation art poster by kandinskynbspnbspwassily kandinsky'

distance = 245
spam score = 13
title = 'batonnets d8217appui art printnbspnbspwassily kandinsky'

distance = 252
spam score = 13
title = 'mit und gegen posternbspnbspwassily kandinsky'

distance = 259
spam score = 15
title = 'kandinsky art etoiles lithographnbspnbspwassily kandinsky'

distance = 259
spam score = 14
title = 'mit und gegen art printnbspnbspwassily kandinsky'

distance = 266
spam score = 4
title = 'art prints storenbspnbspwassily kandinsky'

distance = 270
spam score = 4
title = 'abstract art storenbspnbspwassily kandinsky'

distance = 272
spam score = 14
title = 'kandinsky beruhigt serigraphnbspnbspwassily kandinsky'

distance = 282
spam score = 14
title = 'komposition mit schachbrettstreifen 1922 art printnbspnbspwassily kandinsky'

distance = 288
spam score = 9
title = 'contact usnbspnbspwassily kandinsky'

distance = 316
spam score = 15
title = 'trame noire 1922 art print by wassily kandinskynbspnbspwassily kandinsky'

distance = 343
spam score = 17
title = 'kandinsky8217s life beginning in moscow 18661896nbspnbspwassily kandinsky'

distance = 344
spam score = 15
title = 'gelb rot blau art print by kandinskynbspnbspwassily kandinsky'

distance = 442
spam score = 20
title = 'kandinsky heavy red stretched canvas printnbspnbspwassily kandinsky'

distance = 450
spam score = 18
title = 'kandinsky8217s life metamorphosis munich 18961911nbspnbspwassily kandinsky'

distance = 480
spam score = 24
title = 'kandinsky8217s life returning to russia 1914 8211 1921nbspnbspwassily kandinsky'

distance = 504
spam score = 29
title = 'abstract expressionismnbspnbspwassily kandinsky'

distance = 521
spam score = 51
title = 'kandinsky8217s life blue rider 1911 8211 1914nbspnbspwassily kandinsky'

distance = 815
spam score = 6
title = 'kandinsky timelinenbspnbspwassily kandinsky'

distance = 109
spam score = 12
title = ''

distance = 110
spam score = 13
title = ''

distance = 113
spam score = 19
title = ''

distance = 129
spam score = 21
title = ''

distance = 130
spam score = 17
title = ''

distance = 130
spam score = 20
title = ''

distance = 152
spam score = 23
title = ''

distance = 153
spam score = 24
title = ''

distance = 178
spam score = 23
title = ''

distance = 188
spam score = 31
title = ''

distance = 200
spam score = 26
title = ''

distance = 208
spam score = 19
title = ''

distance = 208
spam score = 18
title = ''

distance = 216
spam score = 21
title = ''

distance = 216
spam score = 21
title = ''

distance = 226
spam score = 21
title = ''

distance = 227
spam score = 18
title = ''

distance = 256
spam score = 29
title = ''

distance = 275
spam score = 15
title = ''

distance = 296
spam score = 22
title = ''

distance = 298
spam score = 33
title = ''

distance = 299
spam score = 34
title = ''

distance = 362
spam score = 20
title = ''

distance = 366
spam score = 18
title = ''

distance = 447
spam score = 38
title = ''

distance = 27
spam score = 7
title = 'commentslivecom comment me pictures images graphics comments'

distance = 34
spam score = 6
title = 'commentslivecom i need you pictures images graphics comments'

distance = 36
spam score = 6
title = 'commentslivecom i believe pictures images graphics comments'

distance = 42
spam score = 5
title = 'commentslivecom happy new year pictures images graphics comments'

distance = 48
spam score = 6
title = 'commentslivecom celebrity pictures images graphics comments'

distance = 49
spam score = 6
title = 'commentslivecom i love you pictures images graphics comments'

distance = 49
spam score = 7
title = 'commentslivecom i miss you pictures images graphics comments'

distance = 50
spam score = 5
title = 'commentslivecom get well pictures images graphics comments'

distance = 52
spam score = 7
title = 'commentslivecom patriot day pictures images graphics comments'

distance = 53
spam score = 5
title = 'commentslivecom you are special pictures images graphics comments'

distance = 54
spam score = 6
title = 'commentslivecom inspirational pictures images graphics comments'

distance = 55
spam score = 6
title = 'commentslivecom thinking of you pictures images graphics comments'

distance = 56
spam score = 6
title = 'commentslivecom new baby pictures images graphics comments'

distance = 56
spam score = 7
title = 'commentslivecom christian pictures images graphics comments'

distance = 57
spam score = 5
title = 'commentslivecom mobster pictures images graphics comments'

distance = 58
spam score = 6
title = 'commentslivecom flag day pictures images graphics comments'

distance = 58
spam score = 7
title = 'commentslivecom concerned pictures images graphics comments'

distance = 59
spam score = 5
title = 'commentslivecom spring pictures images graphics comments'

distance = 59
spam score = 6
title = 'commentslivecom good night pictures images graphics comments'

distance = 60
spam score = 5
title = 'commentslivecom summer pictures images graphics comments'

distance = 61
spam score = 7
title = 'commentslivecom fathers day pictures images graphics comments'

distance = 63
spam score = 5
title = 'commentslivecom military pictures images graphics comments'

distance = 64
spam score = 6
title = 'commentslivecom sarcastic pictures images graphics comments'

distance = 65
spam score = 5
title = 'commentslivecom fall pictures images graphics comments'

distance = 66
spam score = 6
title = 'commentslivecom thanksgiving pictures images graphics comments'

distance = 66
spam score = 7
title = 'commentslivecom anniversary pictures images graphics comments'

distance = 66
spam score = 6
title = 'commentslivecom zodiac pictures images graphics comments'

distance = 67
spam score = 6
title = 'commentslivecom winter pictures images graphics comments'

distance = 67
spam score = 5
title = 'commentslivecom 4th of july pictures images graphics comments'

distance = 68
spam score = 7
title = 'commentslivecom wiccan pictures images graphics comments'

distance = 69
spam score = 7
title = 'commentslivecom nice day pictures images graphics comments'

distance = 69
spam score = 6
title = 'commentslivecom quotes pictures images graphics comments'

distance = 69
spam score = 8
title = 'commentslivecom happy holidays pictures images graphics comments'

distance = 70
spam score = 5
title = 'commentslivecom sexy pictures images graphics comments'

distance = 70
spam score = 7
title = 'commentslivecom christian pictures images graphics comments'

distance = 70
spam score = 7
title = 'commentslivecom flower pictures images graphics comments'

distance = 70
spam score = 7
title = 'commentslivecom flower pictures images graphics comments'

distance = 70
spam score = 7
title = 'commentslivecom angels pictures images graphics comments'

distance = 72
spam score = 6
title = 'commentslivecom welcome pictures images graphics comments'

distance = 72
spam score = 6
title = 'commentslivecom congrats pictures images graphics comments'

distance = 74
spam score = 6
title = 'commentslivecom merry christmas pictures images graphics comments'

distance = 76
spam score = 5
title = 'commentslivecom halloween pictures images graphics comments'

distance = 76
spam score = 6
title = 'commentslivecom oldies pictures images graphics comments'

distance = 76
spam score = 5
title = 'commentslivecom flirty pictures images graphics comments'

distance = 77
spam score = 7
title = 'commentslivecom fathers day pictures images graphics comments'

distance = 79
spam score = 7
title = 'commentslivecom groundhog day pictures images graphics comments'

distance = 79
spam score = 6
title = 'commentslivecom good luck pictures images graphics comments'

distance = 79
spam score = 6
title = 'commentslivecom hugs pictures images graphics comments'

distance = 79
spam score = 6
title = 'commentslivecom hugs pictures images graphics comments'

distance = 80
spam score = 6
title = 'commentslivecom saturday pictures images graphics comments'

distance = 82
spam score = 6
title = 'commentslivecom easter pictures images graphics comments'

distance = 83
spam score = 7
title = 'commentslivecom good morning pictures images graphics comments'

distance = 83
spam score = 5
title = 'commentslivecom happy birthday pictures images graphics comments'

distance = 84
spam score = 6
title = 'commentslivecom memorial day pictures images graphics comments'

distance = 85
spam score = 6
title = 'commentslivecom sexy pictures images graphics comments'

distance = 85
spam score = 5
title = 'commentslivecom mothers day pictures images graphics comments'

distance = 86
spam score = 6
title = 'commentslivecom monday pictures images graphics comments'

distance = 86
spam score = 6
title = 'commentslivecom complimentary pictures images graphics comments'

distance = 87
spam score = 8
title = 'commentslivecom native american pictures images graphics comments'

distance = 87
spam score = 6
title = 'commentslivecom hello pictures images graphics comments'

distance = 88
spam score = 6
title = 'commentslivecom christmas card pictures images graphics comments'

distance = 88
spam score = 6
title = 'commentslivecom sunday pictures images graphics comments'

distance = 88
spam score = 5
title = 'commentslivecom friday pictures images graphics comments'

distance = 88
spam score = 5
title = 'commentslivecom friday pictures images graphics comments'

distance = 89
spam score = 6
title = 'commentslivecom thursday pictures images graphics comments'

distance = 89
spam score = 6
title = 'commentslivecom thursday pictures images graphics comments'

distance = 90
spam score = 6
title = 'commentslivecom merry christmas pictures images graphics comments'

distance = 92
spam score = 6
title = 'commentslivecom st patricks day pictures images graphics comments'

distance = 92
spam score = 6
title = 'commentslivecom seasons greetings pictures images graphics comments'

distance = 93
spam score = 6
title = 'commentslivecom christmas ornament pictures images graphics comments'

distance = 97
spam score = 7
title = 'commentslivecom thank you pictures images graphics comments'

distance = 98
spam score = 5
title = 'commentslivecom happy birthday pictures images graphics comments'

distance = 102
spam score = 7
title = 'commentslivecom hello pictures images graphics comments'

distance = 104
spam score = 6
title = 'commentslivecom nice week pictures images graphics comments'

distance = 105
spam score = 6
title = 'commentslivecom big beautiful women pictures images graphics comments'

distance = 106
spam score = 6
title = 'commentslivecom friday the 13th pictures images graphics comments'

distance = 106
spam score = 7
title = 'commentslivecom i am sorry pictures images graphics comments'

distance = 109
spam score = 5
title = 'commentslivecom showing love pictures images graphics comments'

distance = 109
spam score = 5
title = 'commentslivecom showing love pictures images graphics comments'

distance = 114
spam score = 5
title = 'commentslivecom april fools day pictures images graphics comments'

distance = 132
spam score = 6
title = 'commentslivecom nice weekend pictures images graphics comments'

distance = 132
spam score = 6
title = 'commentslivecom nice weekend pictures images graphics comments'

distance = 156
spam score = 5
title = 'commentslivecom family pictures images graphics comments'

distance = 159
spam score = 7
title = 'commentslivecom breast cancer awareness pictures images graphics comments'

distance = 169
spam score = 5
title = 'commentslivecom father pictures images graphics comments'

distance = 170
spam score = 4
title = 'commentslivecom mother pictures images graphics comments'

distance = 173
spam score = 5
title = 'commentslivecom son pictures images graphics comments'

distance = 175
spam score = 7
title = 'commentslivecom cinco de mayo pictures images graphics comments'

distance = 182
spam score = 4
title = 'commentslivecom sister pictures images graphics comments'

distance = 185
spam score = 6
title = 'commentslivecom brother pictures images graphics comments'

distance = 188
spam score = 5
title = 'commentslivecom daughter pictures images graphics comments'

distance = 193
spam score = 7
title = 'commentslivecom spanish monday pictures images graphics comments'

distance = 195
spam score = 7
title = 'commentslivecom spanish tuesday pictures images graphics comments'

distance = 196
spam score = 7
title = 'commentslivecom spanish saturday pictures images graphics comments'

distance = 196
spam score = 6
title = 'commentslivecom niece pictures images graphics comments'

distance = 198
spam score = 7
title = 'commentslivecom nephew pictures images graphics comments'

distance = 199
spam score = 7
title = 'commentslivecom spanish sunday pictures images graphics comments'

distance = 203
spam score = 7
title = 'commentslivecom spanish week pictures images graphics comments'

distance = 204
spam score = 5
title = 'commentslivecom cousin pictures images graphics comments'

distance = 205
spam score = 7
title = 'commentslivecom spanish thursday pictures images graphics comments'

distance = 214
spam score = 7
title = 'commentslivecom spanish wednesday pictures images graphics comments'

distance = 219
spam score = 6
title = 'commentslivecom spanish friendship pictures images graphics comments'

distance = 296
spam score = 8
title = 'commentslivecom contact'

distance = 318
spam score = 6
title = 'commentslivecom spanish profile pictures images graphics comments'

distance = 318
spam score = 9
title = 'commentslivecom week day comments for myspace and more'

distance = 380
spam score = 12
title = 'commentslivecom profile pictures images graphics comments page 2'

distance = 431
spam score = 11
title = 'commentslivecom profile pictures images graphics comments'

distance = 1437
spam score = 15
title = 'holiday clip art free holiday graphics'

distance = 1774
spam score = 78
title = 'harvest features'

distance = 62
spam score = 44
title = 'townhomes jarmin amp jones'

distance = 65
spam score = 58
title = 'condos amp lofts jarmin amp jones'

distance = 66
spam score = 61
title = 'delicious jarmin amp jones'

distance = 84
spam score = 65
title = 'home 8211 slider jarmin amp jones'

distance = 86
spam score = 65
title = 'testimonials jarmin amp jones'

distance = 89
spam score = 32
title = 'all dunwoody condos for sale jarmin amp jones'

distance = 98
spam score = 34
title = 'all midtown atlanta lofts jarmin amp jones'

distance = 104
spam score = 42
title = 'all downtown atlanta lofts jarmin amp jones'

distance = 106
spam score = 45
title = 'all downtown atlanta condos jarmin amp jones'

distance = 107
spam score = 50
title = 'all chamblee townhomes jarmin amp jones'

distance = 111
spam score = 42
title = 'all sandy springs condos jarmin amp jones'

distance = 113
spam score = 61
title = '700 piedmont condos jarmin amp jones'

distance = 121
spam score = 62
title = 'all downtown atlanta townhomes jarmin amp jones'

distance = 124
spam score = 28
title = 'all dunwoody townhomes jarmin amp jones'

distance = 134
spam score = 36
title = 'all brookhaven condos jarmin amp jones'

distance = 135
spam score = 43
title = 'dunwoody condos for sale jarmin amp jones'

distance = 142
spam score = 67
title = 'element midtown condos jarmin amp jones'

distance = 142
spam score = 66
title = 'townsend place townhomes jarmin amp jones'

distance = 144
spam score = 59
title = 'la france street townhomes for sale jarmin amp jones'

distance = 146
spam score = 74
title = 'new website for jarmin amp jones jarmin amp jones'

distance = 173
spam score = 52
title = 'the park at ashford condos for sale jarmin amp jones'

distance = 173
spam score = 63
title = '401 tenth townhomes for sale jarmin amp jones'

distance = 173
spam score = 63
title = 'blue stone lofts jarmin amp jones'

distance = 175
spam score = 70
title = 'dunwoody jarmin amp jones'

distance = 175
spam score = 65
title = 'delta place townhomes for sale jarmin amp jones'

distance = 176
spam score = 71
title = 'centennial house lofts jarmin amp jones'

distance = 181
spam score = 65
title = 'greenwood lofts jarmin amp jones'

distance = 181
spam score = 42
title = 'smyrna vinings condos and townhomes jarmin amp jones'

distance = 183
spam score = 72
title = 'mystic ridge condos jarmin amp jones'

distance = 184
spam score = 44
title = 'downtown atlanta jarmin amp jones'

distance = 188
spam score = 40
title = 'east atlanta village jarmin amp jones'

distance = 190
spam score = 68
title = 'alpharetta jarmin amp jones'

distance = 191
spam score = 64
title = 'city space townhomes for sale jarmin amp jones'

distance = 191
spam score = 55
title = 'smyrna vinings jarmin amp jones'

distance = 192
spam score = 55
title = '700 piedmont townhomes for sale jarmin amp jones'

distance = 193
spam score = 25
title = 'all brookhaven townhomes jarmin amp jones'

distance = 193
spam score = 62
title = 'liberty park townhomes for sale jarmin amp jones'

distance = 196
spam score = 62
title = 'the windsor over peachtree condos jarmin amp jones'

distance = 199
spam score = 29
title = 'all roswell townhomes jarmin amp jones'

distance = 200
spam score = 58
title = 'brookwood place townhomes for sale jarmin amp jones'

distance = 208
spam score = 61
title = 'cedar chase townhomes for sale jarmin amp jones'

distance = 219
spam score = 51
title = 'surrey park townhomes for sale jarmin amp jones'

distance = 222
spam score = 53
title = 'smyrna market village townhomes for sale jarmin amp jones'

distance = 224
spam score = 63
title = 'lavista walk townhomes for sale jarmin amp jones'

distance = 226
spam score = 53
title = 'park towers condos for sale jarmin amp jones'

distance = 227
spam score = 52
title = 'chadsworth townhomes for sale jarmin amp jones'

distance = 228
spam score = 53
title = 'paces point townhomes for sale jarmin amp jones'

distance = 233
spam score = 34
title = 'sandy springs condos for sale jarmin amp jones'

distance = 235
spam score = 35
title = 'downtown atlanta condos for sale jarmin amp jones'

distance = 235
spam score = 44
title = 'greystone at vinings townhomes for sale jarmin amp jones'

distance = 242
spam score = 55
title = 'westbury at vinings townhomes for sale jarmin amp jones'

distance = 243
spam score = 55
title = 'concord hall townhomes for sale jarmin amp jones'

distance = 244
spam score = 54
title = 'west village townhomes for sale jarmin amp jones'

distance = 244
spam score = 56
title = 'mosaic at vinings townhomes for sale jarmin amp jones'

distance = 246
spam score = 57
title = 'vinings ridge townhomes for sale jarmin amp jones'

distance = 246
spam score = 24
title = 'all marietta townhomes jarmin amp jones'

distance = 246
spam score = 56
title = 'circle 75 townhomes for sale jarmin amp jones'

distance = 249
spam score = 45
title = 'brookhaven condos for sale jarmin amp jones'

distance = 249
spam score = 47
title = 'longleaf in vinings townhomes for sale jarmin amp jones'

distance = 250
spam score = 49
title = 'spring street village townhomes for sale jarmin amp jones'

distance = 252
spam score = 70
title = 'morningside lenox park jarmin amp jones'

distance = 254
spam score = 50
title = 'one ivy walk townhomes for sale jarmin amp jones'

distance = 256
spam score = 60
title = 'morningside terrace townhomes for sale jarmin amp jones'

distance = 256
spam score = 57
title = 'creatwood at vinings townhomes for sale jarmin amp jones'

distance = 256
spam score = 64
title = 'little five points jarmin amp jones'

distance = 257
spam score = 49
title = 'kensington green townhomes for sale jarmin amp jones'

distance = 258
spam score = 71
title = 'sandy springs jarmin amp jones'

distance = 259
spam score = 23
title = 'all sandy springs townhomes jarmin amp jones'

distance = 260
spam score = 49
title = 'views at park avenue townhomes for sale jarmin amp jones'

distance = 260
spam score = 50
title = 'vintage square townhomes for sale jarmin amp jones'

distance = 262
spam score = 49
title = 'laurel hill townhomes for sale jarmin amp jones'

distance = 267
spam score = 54
title = 'laurel creek townhomes for sale jarmin amp jones'

distance = 269
spam score = 29
title = 'all midtown atlanta townhomes jarmin amp jones'

distance = 269
spam score = 77
title = 'marietta jarmin amp jones'

distance = 270
spam score = 47
title = '123 luckie street lofts for sale jarmin amp jones'

distance = 273
spam score = 61
title = 'ansley parkside townhomes for sale jarmin amp jones'

distance = 273
spam score = 52
title = 'olde ivy at vinings townhomes for sale jarmin amp jones'

distance = 275
spam score = 62
title = 'cabbagetown jarmin amp jones'

distance = 277
spam score = 70
title = 'chamblee jarmin amp jones'

distance = 278
spam score = 52
title = 'paces walk townhomes for sale jarmin amp jones'

distance = 280
spam score = 56
title = 'carriages at barnes mill townhomes for sale jarmin amp jones'

distance = 283
spam score = 76
title = 'midtown jarmin amp jones'

distance = 283
spam score = 70
title = 'ansley park jarmin amp jones'

distance = 284
spam score = 52
title = 'paces avenue townhomes for sale jarmin amp jones'

distance = 284
spam score = 43
title = 'villas at montclair townhomes for sale jarmin amp jones'

distance = 287
spam score = 50
title = 'cotting court condos for sale jarmin amp jones'

distance = 287
spam score = 44
title = 'terraces at park avenue townhomes for sale jarmin amp jones'

distance = 287
spam score = 48
title = 'lofts at reynoldstown crossing homes for sale jarmin amp jones'

distance = 290
spam score = 52
title = 'sovereign condos for sale jarmin amp jones'

distance = 291
spam score = 35
title = 'all midtown condos jarmin amp jones'

distance = 303
spam score = 76
title = 'poncey highlands jarmin amp jones'

distance = 307
spam score = 75
title = 'atlantic station homes for sale jarmin amp jones'

distance = 307
spam score = 77
title = 'old fourth ward jarmin amp jones'

distance = 309
spam score = 60
title = 'art foundry condos for sale jarmin amp jones'

distance = 311
spam score = 56
title = 'meridian buckhead condos for sale jarmin amp jones'

distance = 318
spam score = 23
title = 'all buckhead townhomes jarmin amp jones'

distance = 318
spam score = 49
title = '805 peachtree lofts jarmin amp jones'

distance = 321
spam score = 49
title = 'the winston condos for sale jarmin amp jones'

distance = 327
spam score = 67
title = 'loring heights jarmin amp jones'

distance = 331
spam score = 46
title = 'one river place condos for sale jarmin amp jones'

distance = 359
spam score = 44
title = '10 terminus condos for sale jarmin amp jones'

distance = 413
spam score = 35
title = 'all buckhead condos jarmin amp jones'

distance = 432
spam score = 20
title = 'buckhead homes for sale jarmin amp jones'

distance = 99
spam score = 11
title = 'geography us states quiz 2'

distance = 99
spam score = 9
title = 'geography us states quiz 4'

distance = 99
spam score = 11
title = 'geography us states quiz 1'

distance = 99
spam score = 10
title = 'geography us states quiz 3'

distance = 99
spam score = 9
title = 'geography us states quiz 5'

distance = 101
spam score = 11
title = 'united states history us presidents quiz 4'

distance = 101
spam score = 14
title = 'united states history us presidents quiz 1'

distance = 101
spam score = 11
title = 'united states history us presidents quiz 3'

distance = 101
spam score = 13
title = 'united states history us presidents quiz 2'

distance = 117
spam score = 9
title = 'spanish vocabulary getting there quiz 5'

distance = 117
spam score = 9
title = 'spanish vocabulary getting there quiz 2'

distance = 117
spam score = 11
title = 'spanish vocabulary getting there quiz 1'

distance = 122
spam score = 9
title = 'energy units of energy quiz 1'

distance = 123
spam score = 13
title = 'united states history george washington quiz 2'

distance = 124
spam score = 11
title = 'united states history george washington quiz 1'

distance = 124
spam score = 10
title = 'french vocabulary getting there quiz 1'

distance = 124
spam score = 10
title = 'italian vocabulary getting there quiz 1'

distance = 124
spam score = 14
title = 'italian vocabulary getting there quiz 3'

distance = 124
spam score = 9
title = 'french vocabulary getting there quiz 2'

distance = 124
spam score = 14
title = 'italian vocabulary getting there quiz 2'

distance = 175
spam score = 11
title = 'esl for portuguese speakers family quiz 2'

distance = 175
spam score = 11
title = 'spanish vocabulary family quiz 2'

distance = 175
spam score = 11
title = 'esl for portuguese speakers family quiz 1'

distance = 175
spam score = 9
title = 'spanish vocabulary family quiz 1'

distance = 175
spam score = 9
title = 'units of measurement units of distance english quiz 1'

distance = 175
spam score = 9
title = 'units of measurement units of distance english quiz 3'

distance = 176
spam score = 10
title = 'football super bowl team records quiz 1'

distance = 176
spam score = 11
title = 'esl for portuguese speakers house quiz 1'

distance = 176
spam score = 11
title = 'esl for portuguese speakers house quiz 3'

distance = 176
spam score = 10
title = 'esl for italian speakers medical quiz 1'

distance = 187
spam score = 9
title = 'esl for french speakers shopping quiz 3'

distance = 187
spam score = 10
title = 'esl for french speakers shopping quiz 6'

distance = 187
spam score = 14
title = 'esl for portuguese speakers medical quiz 2'

distance = 187
spam score = 10
title = 'esl for french speakers shopping quiz 2'

distance = 187
spam score = 15
title = 'esl for french speakers occupations quiz 2'

distance = 187
spam score = 9
title = 'esl for french speakers shopping quiz 1'

distance = 187
spam score = 12
title = 'esl for french speakers food quiz 6'

distance = 188
spam score = 9
title = 'geography us state nicknames reversed quiz 5'

distance = 188
spam score = 11
title = 'esl for portuguese speakers occupations quiz 2'

distance = 188
spam score = 15
title = 'esl for french speakers food quiz 1'

distance = 197
spam score = 14
title = 'the oscars best actor winners quiz 3'

distance = 197
spam score = 14
title = 'the oscars best actor winners quiz 6'

distance = 197
spam score = 14
title = 'the oscars best actor winners quiz 8'

distance = 197
spam score = 14
title = 'the oscars best actor winners quiz 2'

distance = 197
spam score = 14
title = 'the oscars best actor winners quiz 7'

distance = 197
spam score = 14
title = 'the oscars best actor winners quiz 1'

distance = 197
spam score = 14
title = 'the oscars best actor winners quiz 5'

distance = 198
spam score = 10
title = 'esl for spanish speakers numbers quiz 3'

distance = 198
spam score = 9
title = 'esl for spanish speakers numbers quiz 2'

distance = 198
spam score = 11
title = 'esl for spanish speakers numbers quiz 6'

distance = 213
spam score = 13
title = 'esl for portuguese speakers nature quiz 1'

distance = 213
spam score = 14
title = 'esl for portuguese speakers house quiz 2'

distance = 214
spam score = 11
title = 'spanish vocabulary basic phrases quiz 3'

distance = 214
spam score = 8
title = 'esl for spanish speakers entertainment quiz 2'

distance = 214
spam score = 9
title = 'esl for spanish speakers entertainment quiz 3'

distance = 214
spam score = 11
title = 'spanish vocabulary basic phrases quiz 2'

distance = 214
spam score = 14
title = 'esl for italian speakers medical quiz 1'

distance = 214
spam score = 9
title = 'esl for spanish speakers colors quiz 1'

distance = 214
spam score = 9
title = 'esl for italian speakers occupations quiz 4'

distance = 214
spam score = 11
title = 'esl for italian speakers occupations quiz 2'

distance = 223
spam score = 14
title = 'esl for french speakers occupations quiz 1'

distance = 223
spam score = 15
title = 'esl for french speakers occupations quiz 3'

distance = 223
spam score = 9
title = 'esl for italian speakers food quiz 5'

distance = 223
spam score = 7
title = 'esl for spanish speakers shopping quiz 5'

distance = 223
spam score = 13
title = 'esl for french speakers shopping quiz 5'

distance = 223
spam score = 13
title = 'esl for french speakers shopping quiz 7'

distance = 224
spam score = 13
title = 'china the great wall of china quiz 1'

distance = 224
spam score = 10
title = 'australia the olgas quiz 1'

distance = 224
spam score = 14
title = 'esl for italian speakers food quiz 6'

distance = 224
spam score = 13
title = 'esl for french speakers shopping quiz 1'

distance = 244
spam score = 9
title = 'esl for italian speakers describing people quiz 1'

distance = 244
spam score = 10
title = 'esl for italian speakers describing people quiz 2'

distance = 244
spam score = 11
title = 'biology climbers quiz 1'

distance = 244
spam score = 10
title = 'nutrition dairy quiz 1'

distance = 245
spam score = 10
title = 'advanced vocabulary verbs 1 quiz 1'

distance = 245
spam score = 15
title = 'united states presidents andrew jackson quiz 1'

distance = 245
spam score = 13
title = 'esl for portuguese speakers basic phrases quiz 2'

distance = 245
spam score = 10
title = 'esl for spanish speakers describing people quiz 2'

distance = 245
spam score = 10
title = 'esl for spanish speakers describing people quiz 1'

distance = 246
spam score = 11
title = 'advanced vocabulary verbs 5 quiz 1'

distance = 269
spam score = 11
title = 'united states presidents harry truman quiz 1'

distance = 269
spam score = 16
title = 'about standardized tests about mcsa quiz 1'

distance = 269
spam score = 16
title = 'about standardized tests about gre quiz 1'

distance = 269
spam score = 14
title = 'united states presidents chester arthur quiz 1'

distance = 270
spam score = 10
title = 'animals trivia fun animal facts 2 quiz 1'

distance = 270
spam score = 8
title = 'sight words sight words primer chart'

distance = 270
spam score = 12
title = 'spanish irregular verbs hacer conjugation quiz 1'

distance = 270
spam score = 14
title = 'nutrition carotenoids quiz 1'

distance = 270
spam score = 9
title = 'new york madison square garden quiz 1'

distance = 270
spam score = 10
title = 'geography trivia iowa quiz 1'

distance = 297
spam score = 11
title = 'spanish regular verbs regular er verbs conditional quiz 1'

distance = 298
spam score = 11
title = 'advanced vocabulary noun usage 2 quiz 1'

distance = 298
spam score = 11
title = 'advanced vocabulary noun usage 4 quiz 1'

distance = 298
spam score = 10
title = 'advanced vocabulary noun usage 10 quiz 1'

distance = 298
spam score = 10
title = 'advanced vocabulary noun usage 11 quiz 1'

distance = 298
spam score = 12
title = 'advanced vocabulary noun usage 8 quiz 1'

distance = 298
spam score = 10
title = 'japan kenrokuen garden quiz 1'

distance = 298
spam score = 12
title = 'advanced vocabulary noun usage 7 quiz 1'

distance = 298
spam score = 10
title = 'advanced vocabulary noun usage 9 quiz 1'

distance = 298
spam score = 10
title = 'nutrition pick best food 2 quiz 1'

distance = 182
spam score = 81
title = ''

distance = 184
spam score = 79
title = ''

distance = 185
spam score = 79
title = ''

distance = 186
spam score = 80
title = ''

distance = 186
spam score = 79
title = ''

distance = 187
spam score = 79
title = ''

distance = 187
spam score = 80
title = ''

distance = 187
spam score = 79
title = ''

distance = 187
spam score = 80
title = ''

distance = 188
spam score = 79
title = ''

distance = 189
spam score = 78
title = ''

distance = 189
spam score = 79
title = ''

distance = 190
spam score = 79
title = ''

distance = 191
spam score = 78
title = ''

distance = 191
spam score = 77
title = ''

distance = 192
spam score = 80
title = ''

distance = 192
spam score = 82
title = ''

distance = 193
spam score = 78
title = ''

distance = 193
spam score = 80
title = ''

distance = 193
spam score = 79
title = ''

distance = 193
spam score = 80
title = ''

distance = 194
spam score = 79
title = ''

distance = 194
spam score = 79
title = ''

distance = 194
spam score = 79
title = ''

distance = 195
spam score = 78
title = ''

distance = 195
spam score = 79
title = ''

distance = 195
spam score = 81
title = ''

distance = 195
spam score = 79
title = ''

distance = 196
spam score = 78
title = ''

distance = 196
spam score = 78
title = ''

distance = 197
spam score = 81
title = ''

distance = 198
spam score = 79
title = ''

distance = 198
spam score = 79
title = ''

distance = 198
spam score = 79
title = ''

distance = 198
spam score = 78
title = ''

distance = 198
spam score = 79
title = ''

distance = 199
spam score = 79
title = ''

distance = 199
spam score = 79
title = ''

distance = 199
spam score = 79
title = ''

distance = 200
spam score = 78
title = ''

distance = 200
spam score = 80
title = ''

distance = 200
spam score = 81
title = ''

distance = 200
spam score = 79
title = ''

distance = 200
spam score = 78
title = ''

distance = 201
spam score = 78
title = ''

distance = 202
spam score = 78
title = ''

distance = 202
spam score = 79
title = ''

distance = 203
spam score = 78
title = ''

distance = 204
spam score = 81
title = ''

distance = 204
spam score = 77
title = ''

distance = 204
spam score = 79
title = ''

distance = 205
spam score = 78
title = ''

distance = 205
spam score = 78
title = ''

distance = 205
spam score = 78
title = ''

distance = 205
spam score = 79
title = ''

distance = 205
spam score = 81
title = ''

distance = 206
spam score = 77
title = ''

distance = 206
spam score = 78
title = ''

distance = 206
spam score = 79
title = ''

distance = 206
spam score = 78
title = ''

distance = 208
spam score = 79
title = ''

distance = 208
spam score = 81
title = ''

distance = 208
spam score = 79
title = ''

distance = 209
spam score = 79
title = ''

distance = 209
spam score = 78
title = ''

distance = 210
spam score = 80
title = ''

distance = 211
spam score = 79
title = ''

distance = 211
spam score = 78
title = ''

distance = 211
spam score = 81
title = ''

distance = 215
spam score = 78
title = ''

distance = 215
spam score = 78
title = ''

distance = 218
spam score = 80
title = ''

distance = 222
spam score = 78
title = ''

distance = 230
spam score = 78
title = ''

distance = 235
spam score = 86
title = ''

distance = 239
spam score = 80
title = ''

distance = 240
spam score = 80
title = ''

distance = 244
spam score = 86
title = ''

distance = 255
spam score = 75
title = ''

distance = 284
spam score = 77
title = ''

distance = 302
spam score = 87
title = ''

distance = 345
spam score = 77
title = ''

distance = 373
spam score = 70
title = ''

distance = 399
spam score = 66
title = ''

distance = 448
spam score = 84
title = ''

distance = 480
spam score = 92
title = ''

distance = 497
spam score = 63
title = ''

distance = 529
spam score = 77
title = ''

distance = 532
spam score = 68
title = ''

distance = 770
spam score = 62
title = ''

distance = 45
spam score = 51
title = ''

distance = 46
spam score = 50
title = ''

distance = 75
spam score = 55
title = ''

distance = 75
spam score = 60
title = ''

distance = 75
spam score = 59
title = ''

distance = 336
spam score = 46
title = ''

distance = 336
spam score = 48
title = ''

distance = 336
spam score = 49
title = ''

distance = 340
spam score = 38
title = ''

distance = 341
spam score = 43
title = ''

distance = 341
spam score = 45
title = ''

distance = 11
spam score = 86
title = ''

distance = 17
spam score = 83
title = ''

distance = 29
spam score = 84
title = ''

distance = 33
spam score = 90
title = ''

distance = 39
spam score = 87
title = ''

distance = 276
spam score = 89
title = ''

distance = 296
spam score = 80
title = ''

distance = 296
spam score = 79
title = ''

distance = 630
spam score = 64
title = ''

distance = 58
spam score = 15
title = '6k run bulldog run'

distance = 60
spam score = 16
title = '2011 december'

distance = 63
spam score = 14
title = 'twoaday run bulldog run'

distance = 67
spam score = 17
title = '2007 may'

distance = 68
spam score = 17
title = '2010 july'

distance = 69
spam score = 15
title = 'spirit of the marathon run bulldog run'

distance = 69
spam score = 16
title = 'interview run bulldog run'

distance = 72
spam score = 14
title = 'bugs run bulldog run'

distance = 74
spam score = 15
title = 'derby day 5k run bulldog run'

distance = 74
spam score = 16
title = '2010 august'

distance = 77
spam score = 13
title = 'new quarter park 6k run bulldog run'

distance = 78
spam score = 15
title = 'summer running run bulldog run'

distance = 78
spam score = 16
title = '2011 june'

distance = 79
spam score = 15
title = 'stats run bulldog run'

distance = 79
spam score = 13
title = 'shark attack run bulldog run'

distance = 79
spam score = 14
title = 'william and mary run bulldog run'

distance = 80
spam score = 18
title = '2011 october'

distance = 80
spam score = 15
title = 'triathlon run bulldog run'

distance = 80
spam score = 16
title = 'british bulldog run bulldog run'

distance = 82
spam score = 17
title = 'american run bulldog run'

distance = 122
spam score = 14
title = 'electronic timing run bulldog run'

distance = 122
spam score = 17
title = 'white and run run bulldog run'

distance = 122
spam score = 15
title = 'remote runner tracking run bulldog run'

distance = 123
spam score = 19
title = 'hope for the warriors run bulldog run'

distance = 123
spam score = 12
title = 'heptathlon run bulldog run'

distance = 123
spam score = 14
title = 'sprinting run bulldog run'

distance = 123
spam score = 14
title = 'chicago marathon run bulldog run'

distance = 123
spam score = 15
title = 'tommie copper run bulldog run'

distance = 123
spam score = 17
title = 'mileage run bulldog run'

distance = 123
spam score = 16
title = 'orgain run bulldog run'

distance = 153
spam score = 14
title = '2011 july'

distance = 153
spam score = 18
title = 'runner8217s lounge blog run bulldog run'

distance = 153
spam score = 16
title = 'gerry lindgren run bulldog run'

distance = 153
spam score = 17
title = 'the hill climber run bulldog run'

distance = 153
spam score = 19
title = 'prediction run bulldog run'

distance = 153
spam score = 16
title = 'cyclerobx run bulldog run'

distance = 153
spam score = 23
title = 'elizabeth river run run bulldog run'

distance = 154
spam score = 23
title = 'energy surge run bulldog run'

distance = 155
spam score = 16
title = 'east beach norfolk half marathon run bulldog run'

distance = 156
spam score = 17
title = 'duathlon run bulldog run'

distance = 194
spam score = 19
title = 'london marathon run bulldog run'

distance = 194
spam score = 18
title = 'gifts run bulldog run'

distance = 196
spam score = 25
title = 'endurolytes run bulldog run'

distance = 197
spam score = 18
title = 'vibram five fingers run bulldog run'

distance = 198
spam score = 17
title = 'hair of the dog 5k run bulldog run'

distance = 198
spam score = 18
title = 'vff run bulldog run'

distance = 199
spam score = 14
title = 'friday four miler'

distance = 199
spam score = 23
title = 'nutrition run bulldog run'

distance = 200
spam score = 23
title = 'heart rate run bulldog run'

distance = 200
spam score = 19
title = 'sun run bulldog run'

distance = 224
spam score = 10
title = 'progressive five miler'

distance = 226
spam score = 11
title = 'progressive 4 miler 8211 where have my legs gone'

distance = 226
spam score = 12
title = 'free 8220run for your life8221 dvd'

distance = 226
spam score = 29
title = '2009 october'

distance = 226
spam score = 24
title = 'four million steps day 12 update'

distance = 228
spam score = 14
title = 'the comeback continues'

distance = 228
spam score = 14
title = 'monday ten miler'

distance = 229
spam score = 15
title = 'hundred push ups week 5 day 3'

distance = 230
spam score = 19
title = 'heat run bulldog run'

distance = 230
spam score = 36
title = 'gps run bulldog run'

distance = 253
spam score = 16
title = 'garminless four miles'

distance = 253
spam score = 17
title = 'newton gravity run bulldog run'

distance = 253
spam score = 20
title = 'newton running run bulldog run'

distance = 254
spam score = 13
title = 'just a run'

distance = 254
spam score = 29
title = '2007 july'

distance = 254
spam score = 18
title = 'last wednesday in may'

distance = 254
spam score = 18
title = 'new balance shoesaccessories and sport science shirts on sale at the clymb'

distance = 254
spam score = 21
title = 'mcmillan custom marathon plan week 16 day 2'

distance = 254
spam score = 15
title = 'saucony run bulldog run'

distance = 254
spam score = 10
title = 'final long run before shamrock marathon'

distance = 276
spam score = 16
title = 'mcmillan custom marathon plan week 7 day 7'

distance = 277
spam score = 19
title = 'marathon taper run bulldog run'

distance = 277
spam score = 27
title = 'hundred push ups week 3 day 2'

distance = 277
spam score = 17
title = 'modified key run workout 1'

distance = 278
spam score = 17
title = 'mcmillan custom marathon plan week 10 day 3'

distance = 279
spam score = 11
title = 'a sluggish nine miler'

distance = 279
spam score = 26
title = 'ultra run bulldog run'

distance = 279
spam score = 23
title = 'mcmillan custom marathon plan week 10 day 1 8211 almost a day off'

distance = 280
spam score = 22
title = 'another long run in the bank'

distance = 280
spam score = 30
title = 'week 3 8211 key run workout 1'

distance = 311
spam score = 14
title = 'flat five miles 038 week 5 push ups exhaustion test'

distance = 312
spam score = 27
title = 'first to the finish marathon training plan'

distance = 312
spam score = 17
title = 'save time on the treadmill with runervals 70'

distance = 313
spam score = 24
title = 'dean karnazes on 34the marathon34'

distance = 313
spam score = 19
title = 'half marathon run bulldog run'

distance = 315
spam score = 15
title = 'legs trashed at mount trashmore'

distance = 315
spam score = 9
title = 'new quarter park 6k'

distance = 315
spam score = 16
title = 'tidewater striders tuneup series 20k'

distance = 316
spam score = 14
title = 'runervals 60 time saver i cruise 038 tempo training'

distance = 316
spam score = 20
title = 'where did the last week go'

distance = 369
spam score = 23
title = 'mcmillan custom marathon plan week 1 day 1'

distance = 370
spam score = 9
title = 'dean karnazes secrets i learned running 50 marathons in 50 days'

distance = 371
spam score = 18
title = 'mcmillan custom marathon plan week 13 day 2'

distance = 372
spam score = 16
title = 'hundred pushups iphone app 8212 8220gift this app8221 for father8217s day'

distance = 375
spam score = 16
title = 'sale run bulldog run'

distance = 379
spam score = 17
title = 'hundred push ups week 3 day 3'

distance = 382
spam score = 34
title = 'week 10 8211 key run workout 2'

distance = 382
spam score = 18
title = 'first key run workout 1'

distance = 383
spam score = 9
title = 'what a weekend'

distance = 386
spam score = 30
title = 'new endurolytes fizz varieties and a free hammer nutrition anniversary visor'

distance = 1571
spam score = 59
title = 'an 8220adventure marathon8221 in argentina8217s lake district lives up to the hype the runner039s trip run long travel far discover more'

distance = 36
spam score = 92
title = 'art start for year one silcoates school'

distance = 36
spam score = 92
title = 'art start for year one silcoates school'

distance = 52
spam score = 92
title = 'year 8 acrobats silcoates school'

distance = 52
spam score = 92
title = 'year 8 acrobats silcoates school'

distance = 54
spam score = 95
title = 'year 1 alien design silcoates school'

distance = 54
spam score = 95
title = 'year 1 alien design silcoates school'

distance = 57
spam score = 94
title = 'he8217s henry the eighth he is silcoates school'

distance = 57
spam score = 94
title = 'he8217s henry the eighth he is silcoates school'

distance = 64
spam score = 92
title = 'year 10 bookworms silcoates school'

distance = 64
spam score = 93
title = 'staff vs students hockey silcoates school'

distance = 64
spam score = 93
title = 'history theatre trip silcoates school'

distance = 64
spam score = 93
title = 'staff vs students hockey silcoates school'

distance = 64
spam score = 92
title = 'year 10 bookworms silcoates school'

distance = 64
spam score = 93
title = 'history theatre trip silcoates school'

distance = 65
spam score = 93
title = 'history grand designs silcoates school'

distance = 65
spam score = 93
title = 'history grand designs silcoates school'

distance = 65
spam score = 95
title = 'sixth form french society silcoates school'

distance = 66
spam score = 94
title = 'u12 district hockey champions silcoates school'

distance = 66
spam score = 94
title = 'la belle musique silcoates school'

distance = 66
spam score = 93
title = 'la belle musique silcoates school'

distance = 94
spam score = 94
title = 'austria ski trip silcoates school'

distance = 95
spam score = 95
title = 'prefect bowling silcoates school'

distance = 96
spam score = 91
title = 'more swimming success for robert silcoates school'

distance = 96
spam score = 92
title = 'chapel treasure silcoates school'

distance = 96
spam score = 93
title = 'chapel treasure silcoates school'

distance = 96
spam score = 93
title = 'summer ball tickets now on sale silcoates school'

distance = 96
spam score = 91
title = 'sport relief runners raise over 1000 silcoates school'

distance = 96
spam score = 90
title = 'sport relief runners raise over 1000 silcoates school'

distance = 96
spam score = 90
title = 'more swimming success for robert silcoates school'

distance = 97
spam score = 93
title = 'junior school carol service silcoates school'

distance = 106
spam score = 93
title = 'snow white and the diverse dwarfs silcoates school'

distance = 106
spam score = 93
title = 'lauren keeps rolling on silcoates school'

distance = 106
spam score = 93
title = 'snow white and the diverse dwarfs silcoates school'

distance = 107
spam score = 87
title = 'national hockey cup success silcoates school'

distance = 107
spam score = 94
title = 'craft club silcoates school'

distance = 107
spam score = 87
title = 'national hockey cup success silcoates school'

distance = 109
spam score = 89
title = 'sunny hill 80s disco silcoates school'

distance = 109
spam score = 91
title = 'upper sixth politics conference silcoates school'

distance = 110
spam score = 93
title = 'students of german celebrate nikolaus silcoates school'

distance = 110
spam score = 94
title = 'year 9 holocaust memorial work silcoates school'

distance = 118
spam score = 93
title = 'lower sixth centigrade careers testing silcoates school'

distance = 119
spam score = 97
title = 'year 9 adventure weekend silcoates school'

distance = 119
spam score = 97
title = 'year 9 adventure weekend silcoates school'

distance = 119
spam score = 92
title = 'thank you from sunny hill silcoates school'

distance = 119
spam score = 92
title = 'thank you from sunny hill silcoates school'

distance = 120
spam score = 92
title = 'st hildas news week beginning 27th february silcoates school'

distance = 120
spam score = 92
title = 'st hildas news week beginning 27th february silcoates school'

distance = 120
spam score = 91
title = 'charlotte8217s tae kwon do success silcoates school'

distance = 120
spam score = 94
title = 'hockey v old silcoatians silcoates school'

distance = 120
spam score = 94
title = 'hockey v old silcoatians silcoates school'

distance = 133
spam score = 90
title = '1st vii netball success at invitational tournament silcoates school'

distance = 133
spam score = 90
title = '1st vii netball success at invitational tournament silcoates school'

distance = 133
spam score = 91
title = 'junior school at young voices concert silcoates school'

distance = 134
spam score = 92
title = 'junior sport continues despite the wet weather silcoates school'

distance = 134
spam score = 91
title = 'junior sport continues despite the wet weather silcoates school'

distance = 136
spam score = 93
title = 'ladies luncheon silcoates school'

distance = 136
spam score = 94
title = 'ladies luncheon silcoates school'

distance = 137
spam score = 92
title = 'christmas every day in chapel for year 10 and 11 silcoates school'

distance = 137
spam score = 96
title = 'st hildas remembrance service silcoates school'

distance = 137
spam score = 92
title = 'christmas every day in chapel for year 10 and 11 silcoates school'

distance = 152
spam score = 99
title = 'chapel resources silcoates school'

distance = 152
spam score = 97
title = '200 club 8211 introduction silcoates school'

distance = 152
spam score = 96
title = 'forthcoming events silcoates school'

distance = 153
spam score = 95
title = 'isi silcoates school'

distance = 155
spam score = 94
title = 'lessons from auschwitz project orientation silcoates school'

distance = 155
spam score = 94
title = 'summer term 2012 silcoates school'

distance = 155
spam score = 94
title = 'lessons from auschwitz project orientation silcoates school'

distance = 155
spam score = 94
title = 'sixth form information handbook silcoates school'

distance = 156
spam score = 95
title = 'terms and conditions silcoates school'

distance = 156
spam score = 82
title = 'swimming success and sponsorship for danielle silcoates school'

distance = 181
spam score = 98
title = 'fees silcoates school'

distance = 183
spam score = 81
title = 'camerons charity skydive raises over 1500 silcoates school'

distance = 183
spam score = 81
title = 'camerons charity skydive raises over 1500 silcoates school'

distance = 183
spam score = 97
title = 'alumni relations 8211 update form silcoates school'

distance = 184
spam score = 94
title = 'the salzburg singers visit junior assembly silcoates school'

distance = 184
spam score = 96
title = 'spring timetable silcoates school'

distance = 185
spam score = 96
title = 'trips and visits silcoates school'

distance = 186
spam score = 92
title = 'junior school end of term chapel service silcoates school'

distance = 186
spam score = 96
title = 'strings concert at wakefield cathedral silcoates school'

distance = 186
spam score = 96
title = 'strings concert at wakefield cathedral silcoates school'

distance = 239
spam score = 95
title = 'examination administration silcoates school'

distance = 239
spam score = 93
title = 'contact information silcoates school'

distance = 239
spam score = 88
title = 'a hockneyhodgkin hotchpotch silcoates school'

distance = 240
spam score = 94
title = 'correspondence silcoates school'

distance = 241
spam score = 93
title = 'summer term 2012 calendar silcoates school'

distance = 241
spam score = 91
title = 'mokee joe and icky doo dah visit the junior school silcoates school'

distance = 244
spam score = 94
title = 'other policies silcoates school'

distance = 245
spam score = 97
title = 'lunch menus silcoates school'

distance = 246
spam score = 99
title = 'silcoates junior school silcoates school'

distance = 246
spam score = 97
title = 'examination results silcoates school'

distance = 297
spam score = 97
title = 'admission information silcoates school'

distance = 297
spam score = 97
title = 'aims and ethos silcoates school'

distance = 301
spam score = 97
title = 'child protection silcoates school'

distance = 305
spam score = 94
title = 'clarioncall notice for bt email customers silcoates school'

distance = 305
spam score = 94
title = 'clarioncall notice for bt email customers silcoates school'

distance = 310
spam score = 96
title = 'academic silcoates school'

distance = 310
spam score = 95
title = '03 unit silcoates school'

distance = 323
spam score = 97
title = 'aims and ethos silcoates school'

distance = 328
spam score = 97
title = 'child protection silcoates school'

distance = 342
spam score = 97
title = 'aims and ethos silcoates school'

distance = 1420
spam score = 73
title = 'sponsors of phorum 2012 cloud computing conference phorum philly'

distance = 1428
spam score = 75
title = 'social media links phorum 2012 participants phorum philly'

distance = 1518
spam score = 74
title = 'ticket prices for phorum 2012 cloud computing conference phorum philly'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 96
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 1
spam score = 97
title = 'optoma emea 404'

distance = 9
spam score = 97
title = 'optoma emea 404'

distance = 9
spam score = 97
title = 'optoma emea 404'

distance = 10
spam score = 97
title = 'optoma emea 404'

distance = 10
spam score = 97
title = 'optoma emea 404'

distance = 10
spam score = 97
title = 'optoma emea 404'

distance = 10
spam score = 97
title = 'optoma emea 404'

distance = 10
spam score = 97
title = 'optoma emea 404'

distance = 10
spam score = 97
title = 'optoma emea 404'

distance = 10
spam score = 97
title = 'optoma emea 404'

distance = 10
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 96
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 96
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 18
spam score = 97
title = 'optoma emea 404'

distance = 381
spam score = 96
title = ''

distance = 381
spam score = 96
title = ''

distance = 381
spam score = 96
title = ''

distance = 381
spam score = 96
title = ''

distance = 381
spam score = 96
title = ''

distance = 381
spam score = 96
title = ''

distance = 381
spam score = 96
title = ''

distance = 381
spam score = 96
title = ''

distance = 381
spam score = 96
title = ''

distance = 381
spam score = 96
title = ''

distance = 1214
spam score = 75
title = 'optoma emea distance calculator'

distance = 1217
spam score = 80
title = 'optoma asp centres'

distance = 1326
spam score = 86
title = 'optoma press releases'

distance = 1349
spam score = 77
title = 'optoma emea 3d faq'

distance = 1457
spam score = 84
title = 'optoma support'

distance = 1648
spam score = 81
title = 'optoma support form'

distance = 63
spam score = 77
title = ''

distance = 72
spam score = 79
title = ''

distance = 75
spam score = 80
title = ''

distance = 75
spam score = 81
title = ''

distance = 82
spam score = 78
title = ''

distance = 86
spam score = 79
title = ''

distance = 94
spam score = 79
title = ''

distance = 97
spam score = 78
title = ''

distance = 98
spam score = 78
title = ''

distance = 98
spam score = 79
title = ''

distance = 99
spam score = 78
title = ''

distance = 100
spam score = 79
title = ''

distance = 102
spam score = 77
title = ''

distance = 104
spam score = 78
title = ''

distance = 104
spam score = 79
title = ''

distance = 105
spam score = 79
title = ''

distance = 106
spam score = 78
title = ''

distance = 107
spam score = 78
title = ''

distance = 108
spam score = 79
title = ''

distance = 109
spam score = 79
title = ''

distance = 109
spam score = 80
title = ''

distance = 111
spam score = 78
title = ''

distance = 112
spam score = 78
title = ''

distance = 113
spam score = 79
title = ''

distance = 113
spam score = 78
title = ''

distance = 115
spam score = 79
title = ''

distance = 115
spam score = 78
title = ''

distance = 117
spam score = 80
title = ''

distance = 119
spam score = 78
title = ''

distance = 122
spam score = 79
title = ''

distance = 123
spam score = 79
title = ''

distance = 123
spam score = 78
title = ''

distance = 125
spam score = 78
title = ''

distance = 125
spam score = 79
title = ''

distance = 126
spam score = 79
title = ''

distance = 130
spam score = 79
title = ''

distance = 134
spam score = 78
title = ''

distance = 136
spam score = 79
title = ''

distance = 142
spam score = 79
title = ''

distance = 142
spam score = 79
title = ''

distance = 144
spam score = 78
title = ''

distance = 149
spam score = 79
title = ''

distance = 151
spam score = 79
title = ''

distance = 153
spam score = 80
title = ''

distance = 163
spam score = 79
title = ''

distance = 260
spam score = 79
title = ''

distance = 1858
spam score = 15
title = ''

distance = 128
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 128
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 128
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 128
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 131
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 131
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 131
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 131
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 131
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 131
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 131
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 131
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 131
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 143
spam score = 82
title = 'lifepoint church wilmington nc'

distance = 143
spam score = 81
title = 'lifepoint church wilmington nc'

distance = 143
spam score = 81
title = 'lifepoint church wilmington nc'

distance = 143
spam score = 81
title = 'lifepoint church wilmington nc'

distance = 151
spam score = 76
title = 'lifepoint church wilmington nc'

distance = 151
spam score = 76
title = 'lifepoint church wilmington nc'

distance = 151
spam score = 76
title = 'lifepoint church wilmington nc'

distance = 191
spam score = 78
title = 'lifepoint church wilmington nc'

distance = 191
spam score = 78
title = 'lifepoint church wilmington nc'

distance = 191
spam score = 78
title = 'lifepoint church wilmington nc'

distance = 191
spam score = 78
title = 'lifepoint church wilmington nc'

distance = 194
spam score = 81
title = 'lifepoint church wilmington nc'

distance = 197
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 197
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 197
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 197
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 200
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 213
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 213
spam score = 83
title = 'lifepoint church wilmington nc'

distance = 213
spam score = 83
title = 'lifepoint church wilmington nc'

distance = 213
spam score = 83
title = 'lifepoint church wilmington nc'

distance = 213
spam score = 83
title = 'lifepoint church wilmington nc'

distance = 213
spam score = 81
title = 'lifepoint church wilmington nc'

distance = 213
spam score = 81
title = 'lifepoint church wilmington nc'

distance = 213
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 213
spam score = 79
title = 'lifepoint church wilmington nc'

distance = 214
spam score = 78
title = 'lifepoint church wilmington nc'

distance = 242
spam score = 78
title = 'lifepoint church wilmington nc'

distance = 242
spam score = 78
title = 'lifepoint church wilmington nc'

distance = 242
spam score = 78
title = 'lifepoint church wilmington nc'

distance = 242
spam score = 82
title = 'lifepoint church wilmington nc'

distance = 247
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 247
spam score = 80
title = 'lifepoint church wilmington nc'

distance = 248
spam score = 77
title = 'lifepoint church wilmington nc'

distance = 248
spam score = 78
title = 'lifepoint church wilmington nc'

distance = 248
spam score = 77
title = 'lifepoint church wilmington nc'

distance = 248
spam score = 77
title = 'lifepoint church wilmington nc'

distance = 271
spam score = 77
title = 'lifepoint church wilmington nc'

distance = 282
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 283
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 286
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 286
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 287
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 289
spam score = 90
title = 'lifepoint church wilmington nc'

distance = 292
spam score = 87
title = 'lifepoint church wilmington nc'

distance = 294
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 294
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 314
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 315
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 315
spam score = 87
title = 'lifepoint church wilmington nc'

distance = 315
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 315
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 317
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 318
spam score = 91
title = 'lifepoint church wilmington nc'

distance = 318
spam score = 87
title = 'lifepoint church wilmington nc'

distance = 318
spam score = 85
title = 'lifepoint church wilmington nc'

distance = 322
spam score = 87
title = 'lifepoint church wilmington nc'

distance = 340
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 340
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 341
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 341
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 344
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 345
spam score = 81
title = 'lifepoint church wilmington nc'

distance = 345
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 345
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 345
spam score = 87
title = 'lifepoint church wilmington nc'

distance = 345
spam score = 81
title = 'lifepoint church wilmington nc'

distance = 357
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 357
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 357
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 357
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 358
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 360
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 360
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 360
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 360
spam score = 90
title = 'lifepoint church wilmington nc'

distance = 361
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 394
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 397
spam score = 87
title = 'lifepoint church wilmington nc'

distance = 400
spam score = 90
title = 'lifepoint church wilmington nc'

distance = 401
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 402
spam score = 90
title = 'lifepoint church wilmington nc'

distance = 403
spam score = 87
title = 'lifepoint church wilmington nc'

distance = 404
spam score = 90
title = 'lifepoint church wilmington nc'

distance = 407
spam score = 87
title = 'lifepoint church wilmington nc'

distance = 411
spam score = 87
title = 'lifepoint church wilmington nc'

distance = 411
spam score = 86
title = 'lifepoint church wilmington nc'

distance = 531
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 544
spam score = 89
title = 'lifepoint church wilmington nc'

distance = 561
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 591
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 632
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 652
spam score = 88
title = 'lifepoint church wilmington nc'

distance = 39
spam score = 43
title = 'store wordpress customization website design loyalty cards promotional materials'

distance = 40
spam score = 39
title = 'checkout wordpress customization website design loyalty cards promotional materials'

distance = 40
spam score = 44
title = 'home wordpress customization website design loyalty cards promotional materials'

distance = 42
spam score = 44
title = 'web design wordpress customization website design loyalty cards promotional materials'

distance = 44
spam score = 39
title = 'flyer design wordpress customization website design loyalty cards promotional materials'

distance = 47
spam score = 42
title = 'your account wordpress customization website design loyalty cards promotional materials'

distance = 48
spam score = 42
title = 'register wordpress customization website design loyalty cards promotional materials'

distance = 71
spam score = 46
title = 'custom business cards wordpress customization website design loyalty cards promotional materials'

distance = 75
spam score = 38
title = 'contact wordpress customization website design loyalty cards promotional materials'

distance = 86
spam score = 30
title = 'how to split wordpress content into two or more columns wordpress customization website design loyalty cards promotional materials'

distance = 89
spam score = 32
title = 'how to write a post in wordpress wordpress customization website design loyalty cards promotional materials'

distance = 90
spam score = 34
title = 'logo design wordpress customization website design loyalty cards promotional materials'

distance = 95
spam score = 32
title = 'wordpress 8211 moving wp site to a subdomain wordpress customization website design loyalty cards promotional materials'

distance = 96
spam score = 33
title = 'loyalty cards wordpress customization website design loyalty cards promotional materials'

distance = 101
spam score = 45
title = 'banner ads wordpress customization website design loyalty cards promotional materials'

distance = 102
spam score = 36
title = 'google search wordpress customization website design loyalty cards promotional materials'

distance = 112
spam score = 28
title = 'wordpress 8211 exporting and importing database wordpress customization website design loyalty cards promotional materials'

distance = 113
spam score = 37
title = 'your website sucks here8217s why wordpress customization website design loyalty cards promotional materials'

distance = 117
spam score = 38
title = 'how to use the new custom menu feature in wordpress 30 wordpress customization website design loyalty cards promotional materials'

distance = 119
spam score = 40
title = 'promotional materials wordpress customization website design loyalty cards promotional materials'

distance = 139
spam score = 22
title = 'pagelines framework 20 video tutorials wordpress customization website design loyalty cards promotional materials'

distance = 141
spam score = 35
title = 'wordpress child theme 8211 3 column thirty ten wordpress customization website design loyalty cards promotional materials'

distance = 143
spam score = 32
title = 'wordpress 8211 just upgraded to wordpress 27 wordpress customization website design loyalty cards promotional materials'

distance = 146
spam score = 35
title = 'thematic wordpress theme page structure diagram wordpress customization website design loyalty cards promotional materials'

distance = 147
spam score = 28
title = 'google font directory wordpress customization website design loyalty cards promotional materials'

distance = 147
spam score = 34
title = 'free wordpress themes 2011 edition 8211 smashing magazine wordpress customization website design loyalty cards promotional materials'

distance = 148
spam score = 21
title = 'wordpress mobilefriendly themes amp plugins wordpress customization website design loyalty cards promotional materials'

distance = 150
spam score = 28
title = 'how to zen cart 8211 add downloadable mp3 file wordpress customization website design loyalty cards promotional materials'

distance = 152
spam score = 37
title = 'pricing wordpress customization website design loyalty cards promotional materials'

distance = 152
spam score = 35
title = 'the anatomy of a perfect landing page 8211 formstack wordpress customization website design loyalty cards promotional materials'

distance = 159
spam score = 24
title = 'ecommerce tip before adding 300 products make sure shipping amp tax work wordpress customization website design loyalty cards promotional materials'

distance = 159
spam score = 51
title = 'business card designs wordpress customization website design loyalty cards promotional materials'

distance = 171
spam score = 37
title = 'print ads wordpress customization website design loyalty cards promotional materials'

distance = 176
spam score = 46
title = 'wordpress 286 security release 8211 upgrade wordpress customization website design loyalty cards promotional materials'

distance = 176
spam score = 33
title = 'technology the real meaning of google wave wordpress customization website design loyalty cards promotional materials'

distance = 178
spam score = 24
title = 'excel on mac text on multiple lines in one cell wordpress customization website design loyalty cards promotional materials'

distance = 181
spam score = 33
title = 'jquery a designer8217s perspective wordpress customization website design loyalty cards promotional materials'

distance = 182
spam score = 34
title = 'google makes custom web typography ridiculously easy wordpress customization website design loyalty cards promotional materials'

distance = 183
spam score = 32
title = 'responsive design testing 8211 matt kersley wordpress customization website design loyalty cards promotional materials'

distance = 184
spam score = 38
title = '30 css selectors you must memorize from tuts plus wordpress customization website design loyalty cards promotional materials'

distance = 191
spam score = 31
title = 'wordpress tutorial 8211 wp ecommerce 374 change 8220pampp8221 text to 8220samph8221 for shipping amp handling wordpress customization website design loyalty cards promotional materials'

distance = 193
spam score = 30
title = 'mobile 8211 things you have to consider when designing for mobile wordpress customization website design loyalty cards promotional materials'

distance = 193
spam score = 33
title = 'google analytics for wordpress 8211 yoast wordpress customization website design loyalty cards promotional materials'

distance = 195
spam score = 22
title = 'wordpress 8220press this8221 bookmarklet wordpress customization website design loyalty cards promotional materials'

distance = 197
spam score = 21
title = 'platformpro wordpress drag amp drop framework wordpress customization website design loyalty cards promotional materials'

distance = 199
spam score = 38
title = 'how to keep your blog hacker spammer and spywarefree 8211 problogger wordpress customization website design loyalty cards promotional materials'

distance = 199
spam score = 23
title = 'ultimate css gradient generator 8211 colorzillacom wordpress customization website design loyalty cards promotional materials'

distance = 202
spam score = 24
title = 'seo google natural ranking for scivagocom wordpress customization website design loyalty cards promotional materials'

distance = 202
spam score = 28
title = 'ultimate css gradient generator wordpress customization website design loyalty cards promotional materials'

distance = 207
spam score = 34
title = 'sidebars in wordpress 8211 justin tadlock wordpress customization website design loyalty cards promotional materials'

distance = 215
spam score = 32
title = 'wordpress 30 resources from mashablecom wordpress customization website design loyalty cards promotional materials'

distance = 215
spam score = 29
title = 'technology augmented reality amp google wave wordpress customization website design loyalty cards promotional materials'

distance = 216
spam score = 42
title = 'resources wordpress customization website design loyalty cards promotional materials'

distance = 219
spam score = 37
title = 'how to build a media site on wordpress part 1 8211 smashing magazine wordpress customization website design loyalty cards promotional materials'

distance = 220
spam score = 35
title = 'jquery timeline image slider 8211 css lab wordpress customization website design loyalty cards promotional materials'

distance = 221
spam score = 23
title = 'using css textshadow to create cool text effects 8211 line25 wordpress customization website design loyalty cards promotional materials'

distance = 221
spam score = 28
title = 'wordpress plugin for related posts yet another related posts plugin yarpp wordpress customization website design loyalty cards promotional materials'

distance = 222
spam score = 25
title = 'free seamless paper textures from behancecom wordpress customization website design loyalty cards promotional materials'

distance = 223
spam score = 41
title = 'wordpress 8211 multiple columns with wp easy columns wordpress customization website design loyalty cards promotional materials'

distance = 232
spam score = 37
title = 'wordpress plugin fix for lightbox 2 not working wordpress customization website design loyalty cards promotional materials'

distance = 242
spam score = 29
title = 'testimonial hillary schieve plato8217s closet reno wordpress customization website design loyalty cards promotional materials'

distance = 248
spam score = 30
title = 'solved wordpress nextgen gallery image gallery overlay broken wordpress customization website design loyalty cards promotional materials'

distance = 248
spam score = 24
title = 'why the search marketing industry must adapt or perish 8211 mashable wordpress customization website design loyalty cards promotional materials'

distance = 249
spam score = 28
title = 'flyer 8211 tom gordon fall 2010 class university of nevada reno wordpress customization website design loyalty cards promotional materials'

distance = 251
spam score = 29
title = 'wordpress customization theme customization 8211 dr tory clark wordpress customization website design loyalty cards promotional materials'

distance = 252
spam score = 21
title = 'tubepress 8211 how to fix your vimeo gallery and why its broken wordpress customization website design loyalty cards promotional materials'

distance = 252
spam score = 37
title = 'custom wordpress homepage with customizable widgets wordpress customization website design loyalty cards promotional materials'

distance = 253
spam score = 31
title = 'wp ecommerce fix for broken product links wordpress customization website design loyalty cards promotional materials'

distance = 253
spam score = 30
title = 'totally cool menu navigation using jquery from codrops wordpress customization website design loyalty cards promotional materials'

distance = 255
spam score = 35
title = 'zen cart 8211 change chapter and toc navigation from vertical to horizontal wordpress customization website design loyalty cards promotional materials'

distance = 266
spam score = 40
title = 'platformpro 8211 second navigation wordpress customization website design loyalty cards promotional materials'

distance = 266
spam score = 35
title = 'adobe illustrator tip increasing shadow edge quality wordpress customization website design loyalty cards promotional materials'

distance = 267
spam score = 36
title = 'oneclick publishing to the social web dlvrit wordpress customization website design loyalty cards promotional materials'

distance = 271
spam score = 25
title = 'the following themes are installed but incomplete themes must have a stylesheet and a template wordpress customization website design loyalty cards promotional materials'

distance = 271
spam score = 40
title = 'adobe illustrator tutorial 8211 converting objects to grayscale wordpress customization website design loyalty cards promotional materials'

distance = 272
spam score = 19
title = 'banner ad design 8211 hope for the holidays cd wordpress customization website design loyalty cards promotional materials'

distance = 274
spam score = 33
title = 'social media 8211 how to create a facebook page wordpress customization website design loyalty cards promotional materials'

distance = 276
spam score = 30
title = 'how to add featured image to wordpress platformpro theme wordpress customization website design loyalty cards promotional materials'

distance = 281
spam score = 33
title = 'wordpress 8211 platformpro change primary nav color wordpress customization website design loyalty cards promotional materials'

distance = 281
spam score = 42
title = 'logo trends 2011 8211 an annual review by logolounge wordpress customization website design loyalty cards promotional materials'

distance = 286
spam score = 26
title = 'manual credit card processing shopping carts wordpress customization website design loyalty cards promotional materials'

distance = 286
spam score = 30
title = 'brochure design wordpress customization website design loyalty cards promotional materials'

distance = 292
spam score = 36
title = 'custom postcards for pfilates 8211 full color postcard design wordpress customization website design loyalty cards promotional materials'

distance = 292
spam score = 33
title = 'how to build an app empire can you create the next instagram wordpress customization website design loyalty cards promotional materials'

distance = 295
spam score = 34
title = 'wordpress change color of text in post amp page editor wordpress customization website design loyalty cards promotional materials'

distance = 313
spam score = 47
title = 'wordpress tutorial 8211 wp ecommerce setting shipping rates wordpress customization website design loyalty cards promotional materials'

distance = 313
spam score = 29
title = 'wordpress audio player 8211 playpress wordpress customization website design loyalty cards promotional materials'

distance = 318
spam score = 40
title = 'mixergy 8211 how i edit my interviews 8211 video recording software wordpress customization website design loyalty cards promotional materials'

distance = 325
spam score = 36
title = '21 stimulating color palette tools for designers 8211 sitepointcom wordpress customization website design loyalty cards promotional materials'

distance = 327
spam score = 27
title = 'wordpress 8211 thematic feature site theme wordpress customization website design loyalty cards promotional materials'

distance = 350
spam score = 34
title = 'email encoder bundle for wordpress wordpress customization website design loyalty cards promotional materials'

distance = 355
spam score = 38
title = 'wordpress tutorial 8211 remove the word 8220protected8221 from title text of passwordprotected pages wordpress customization website design loyalty cards promotional materials'

distance = 356
spam score = 49
title = 'how to setup feedburner for wordpress wordpress customization website design loyalty cards promotional materials'

distance = 361
spam score = 46
title = 'wp ecommerce 8211 can8217t edit or delete products wordpress customization website design loyalty cards promotional materials'

distance = 370
spam score = 33
title = 'adobe illustrator tip convert outlined ai text back to live text wordpress customization website design loyalty cards promotional materials'

distance = 371
spam score = 24
title = 'wordpress 8211 custom fields to change hypertext link color wordpress customization website design loyalty cards promotional materials'

distance = 376
spam score = 31
title = 'zen cart shopping cart 8211 editing zen cart 8220order email confirmation8221 text wordpress customization website design loyalty cards promotional materials'

distance = 383
spam score = 35
title = 'menu button background transparency makes text transparent fix wordpress customization website design loyalty cards promotional materials'

distance = 402
spam score = 29
title = 'magento ecommerce 8211 v1324 install tips on 1and1 hosting wordpress customization website design loyalty cards promotional materials'

distance = 407
spam score = 28
title = 'zen cart fix 8211 customer can8217t log in error msg there was a security error when trying to login wordpress customization website design loyalty cards promotional materials'

distance = 438
spam score = 37
title = 'wordpress center navigation for platformpro framework wordpress customization website design loyalty cards promotional materials'

distance = 438
spam score = 30
title = 'bike vault demo for reno mayor bob cashell at reno green summit 2008 at university of nevada reno wordpress customization website design loyalty cards promotional materials'

distance = 476
spam score = 44
title = 'how to see who retweeted your tweets in new twitter wordpress customization website design loyalty cards promotional materials'

distance = 508
spam score = 49
title = 'zen cart 8211 fix for media manager assign to products not working wordpress customization website design loyalty cards promotional materials'

distance = 510
spam score = 45
title = 'wordpress child theme 8211 add horz footer menu wordpress customization website design loyalty cards promotional materials'

distance = 511
spam score = 44
title = 'wordpress child theme 8211 case study 8211 2020 euro lens bath wordpress customization website design loyalty cards promotional materials'

distance = 673
spam score = 34
title = 'zen cart 8211 audio player button broken bare html code displayed instead wordpress customization website design loyalty cards promotional materials'

distance = 1302
spam score = 41
title = 'quick ecommerce solution 8211 prestashop ottawa web designer developer wordpress drupal mobile design development wilder tweedale'

distance = 1424
spam score = 51
title = 'beginner8217s guide to child themes in wordpress 8211 pt 1 ottawa web designer developer wordpress drupal mobile design development wilder tweedale'

distance = 75
spam score = 78
title = 'download mp3 better street music buy better street mp3 music mp3fiestacom'

distance = 78
spam score = 74
title = 'download mp3 bhfv music buy bhfv mp3 music mp3fiestacom'

distance = 80
spam score = 78
title = 'download mp3 beneath music buy beneath mp3 music mp3fiestacom'

distance = 89
spam score = 80
title = 'download mp3 303 music buy 303 mp3 music mp3fiestacom'

distance = 94
spam score = 77
title = 'download mp3 bg music buy bg mp3 music mp3fiestacom'

distance = 95
spam score = 82
title = 'download mp3 adac 8286 music buy adac 8286 mp3 music mp3fiestacom'

distance = 98
spam score = 81
title = 'download mp3 acovsur music buy acovsur mp3 music mp3fiestacom'

distance = 99
spam score = 79
title = 'download mp3 a7ie music buy a7ie mp3 music mp3fiestacom'

distance = 100
spam score = 77
title = 'download mp3 202s music buy 202s mp3 music mp3fiestacom'

distance = 101
spam score = 81
title = 'download mp3 777 music buy 777 mp3 music mp3fiestacom'

distance = 101
spam score = 83
title = 'download mp3 anna music buy anna mp3 music mp3fiestacom'

distance = 101
spam score = 77
title = 'download mp3 akm music buy akm mp3 music mp3fiestacom'

distance = 104
spam score = 78
title = 'download mp3 4d music buy 4d mp3 music mp3fiestacom'

distance = 106
spam score = 80
title = 'download mp3 atris music buy atris mp3 music mp3fiestacom'

distance = 106
spam score = 80
title = 'download mp3 alf music buy alf mp3 music mp3fiestacom'

distance = 110
spam score = 70
title = 'download mp3 214 music buy 214 mp3 music mp3fiestacom'

distance = 111
spam score = 81
title = 'download mp3 aws music buy aws mp3 music mp3fiestacom'

distance = 112
spam score = 76
title = 'download mp3 bsc project music buy bsc project mp3 music mp3fiestacom'

distance = 112
spam score = 81
title = 'download mp3 apartment 10 music buy apartment 10 mp3 music mp3fiestacom'

distance = 112
spam score = 78
title = 'download mp3 303f music buy 303f mp3 music mp3fiestacom'

distance = 203
spam score = 78
title = 'download mp3 braingrinder music buy braingrinder mp3 music mp3fiestacom'

distance = 203
spam score = 82
title = 'download mp3 amc music buy amc mp3 music mp3fiestacom'

distance = 203
spam score = 82
title = 'download mp3 agonist music buy agonist mp3 music mp3fiestacom'

distance = 203
spam score = 77
title = 'download mp3 bound stems music buy bound stems mp3 music mp3fiestacom'

distance = 203
spam score = 78
title = 'download mp3 albion music buy albion mp3 music mp3fiestacom'

distance = 203
spam score = 81
title = 'download mp3 ancestral curse music buy ancestral curse mp3 music mp3fiestacom'

distance = 203
spam score = 79
title = 'download mp3 audiodraftsman music buy audiodraftsman mp3 music mp3fiestacom'

distance = 203
spam score = 74
title = 'download mp3 audius music buy audius mp3 music mp3fiestacom'

distance = 203
spam score = 77
title = 'download mp3 begnagrad music buy begnagrad mp3 music mp3fiestacom'

distance = 203
spam score = 87
title = 'download mp3 anakwad music buy anakwad mp3 music mp3fiestacom'

distance = 220
spam score = 81
title = 'download mp3 bones brigade music buy bones brigade mp3 music mp3fiestacom'

distance = 221
spam score = 83
title = 'download mp3 burden of a day music buy burden of a day mp3 music mp3fiestacom'

distance = 221
spam score = 73
title = 'download mp3 blueneck music buy blueneck mp3 music mp3fiestacom'

distance = 221
spam score = 71
title = 'download mp3 brooklyn friends music buy brooklyn friends mp3 music mp3fiestacom'

distance = 221
spam score = 76
title = 'download mp3 a2b feat fara music buy a2b feat fara mp3 music mp3fiestacom'

distance = 221
spam score = 78
title = 'download mp3 blue states music buy blue states mp3 music mp3fiestacom'

distance = 221
spam score = 80
title = 'download mp3 braintec music buy braintec mp3 music mp3fiestacom'

distance = 221
spam score = 76
title = 'download mp3 big electric cat music buy big electric cat mp3 music mp3fiestacom'

distance = 221
spam score = 73
title = 'download mp3 ace the space music buy ace the space mp3 music mp3fiestacom'

distance = 221
spam score = 81
title = 'download mp3 aannaa music buy aannaa mp3 music mp3fiestacom'

distance = 238
spam score = 70
title = 'download mp3 burnt friedman music buy burnt friedman mp3 music mp3fiestacom'

distance = 238
spam score = 79
title = 'download mp3 bloody irish boys music buy bloody irish boys mp3 music mp3fiestacom'

distance = 238
spam score = 76
title = 'download mp3 adope music buy adope mp3 music mp3fiestacom'

distance = 238
spam score = 78
title = 'download mp3 albert vorne music buy albert vorne mp3 music mp3fiestacom'

distance = 238
spam score = 77
title = 'download mp3 beto e menito music buy beto e menito mp3 music mp3fiestacom'

distance = 238
spam score = 72
title = 'download mp3 bexta music buy bexta mp3 music mp3fiestacom'

distance = 238
spam score = 82
title = 'download mp3 andre vicenzzo music buy andre vicenzzo mp3 music mp3fiestacom'

distance = 238
spam score = 79
title = 'download mp3 angel jozhy k music buy angel jozhy k mp3 music mp3fiestacom'

distance = 239
spam score = 83
title = 'download mp3 alex parks music buy alex parks mp3 music mp3fiestacom'

distance = 239
spam score = 76
title = 'download mp3 bianchi vito music buy bianchi vito mp3 music mp3fiestacom'

distance = 257
spam score = 79
title = 'download mp3 apathia music buy apathia mp3 music mp3fiestacom'

distance = 257
spam score = 82
title = 'download mp3 artem zorin music buy artem zorin mp3 music mp3fiestacom'

distance = 257
spam score = 80
title = 'download mp3 applescal music buy applescal mp3 music mp3fiestacom'

distance = 257
spam score = 83
title = 'download mp3 asten wave music buy asten wave mp3 music mp3fiestacom'

distance = 258
spam score = 81
title = 'download mp3 acumen and vsexion music buy acumen and vsexion mp3 music mp3fiestacom'

distance = 258
spam score = 82
title = 'download mp3 bonafide king music buy bonafide king mp3 music mp3fiestacom'

distance = 258
spam score = 79
title = 'download mp3 amuri in star ocean music buy amuri in star ocean mp3 music mp3fiestacom'

distance = 258
spam score = 81
title = 'download mp3 bare infinity music buy bare infinity mp3 music mp3fiestacom'

distance = 258
spam score = 80
title = 'download mp3 abakus music buy abakus mp3 music mp3fiestacom'

distance = 258
spam score = 83
title = 'download mp3 acid pauli music buy acid pauli mp3 music mp3fiestacom'

distance = 279
spam score = 80
title = 'download mp3 balstyrko music buy balstyrko mp3 music mp3fiestacom'

distance = 279
spam score = 85
title = 'download mp3 anatoly pereslegin music buy anatoly pereslegin mp3 music mp3fiestacom'

distance = 279
spam score = 77
title = 'download mp3 arthur tkachuk music buy arthur tkachuk mp3 music mp3fiestacom'

distance = 279
spam score = 80
title = 'download mp3 betray my secrets music buy betray my secrets mp3 music mp3fiestacom'

distance = 279
spam score = 85
title = 'download mp3 bcr boys music buy bcr boys mp3 music mp3fiestacom'

distance = 279
spam score = 76
title = 'download mp3 buck wild music buy buck wild mp3 music mp3fiestacom'

distance = 279
spam score = 78
title = 'download mp3 angela brownbridge music buy angela brownbridge mp3 music mp3fiestacom'

distance = 279
spam score = 75
title = 'download mp3 battlezone music buy battlezone mp3 music mp3fiestacom'

distance = 279
spam score = 82
title = 'download mp3 anatakikou music buy anatakikou mp3 music mp3fiestacom'

distance = 279
spam score = 68
title = 'download mp3 blackburn julia music buy blackburn julia mp3 music mp3fiestacom'

distance = 303
spam score = 80
title = 'download mp3 alton and hortense ellis music buy alton and hortense ellis mp3 music mp3fiestacom'

distance = 303
spam score = 83
title = 'download mp3 alex tepper and paul harris music buy alex tepper and paul harris mp3 music mp3fiestacom'

distance = 303
spam score = 79
title = 'download mp3 btwinz music buy btwinz mp3 music mp3fiestacom'

distance = 303
spam score = 82
title = 'download mp3 beat assassins music buy beat assassins mp3 music mp3fiestacom'

distance = 303
spam score = 80
title = 'download mp3 al storm vs last of the mohicans and jswish music buy al storm vs last of the mohicans and jswish mp3 music mp3fiestacom'

distance = 303
spam score = 82
title = 'download mp3 altus and silvercord music buy altus and silvercord mp3 music mp3fiestacom'

distance = 303
spam score = 81
title = 'download mp3 alusion music buy alusion mp3 music mp3fiestacom'

distance = 303
spam score = 77
title = 'download mp3 aalberg and angstrom music buy aalberg and angstrom mp3 music mp3fiestacom'

distance = 303
spam score = 78
title = 'download mp3 beyond system music buy beyond system mp3 music mp3fiestacom'

distance = 303
spam score = 82
title = 'download mp3 ajam feat natalie broomes music buy ajam feat natalie broomes mp3 music mp3fiestacom'

distance = 333
spam score = 84
title = 'download mp3 ali sural music buy ali sural mp3 music mp3fiestacom'

distance = 333
spam score = 76
title = 'download mp3 acidkids music buy acidkids mp3 music mp3fiestacom'

distance = 333
spam score = 74
title = 'download mp3 brazen abbot music buy brazen abbot mp3 music mp3fiestacom'

distance = 333
spam score = 77
title = 'download mp3 blagard music buy blagard mp3 music mp3fiestacom'

distance = 333
spam score = 79
title = 'download mp3 bimbo jones music buy bimbo jones mp3 music mp3fiestacom'

distance = 333
spam score = 83
title = 'download mp3 andy c and ellis dee music buy andy c and ellis dee mp3 music mp3fiestacom'

distance = 333
spam score = 82
title = 'download mp3 ashera music buy ashera mp3 music mp3fiestacom'

distance = 333
spam score = 83
title = 'download mp3 blackrain music buy blackrain mp3 music mp3fiestacom'

distance = 333
spam score = 75
title = 'download mp3 bill laswell sussan deyhim music buy bill laswell sussan deyhim mp3 music mp3fiestacom'

distance = 333
spam score = 81
title = 'download mp3 ana kiro music buy ana kiro mp3 music mp3fiestacom'

distance = 383
spam score = 76
title = 'download mp3 brian eno and moebius roedelius plank music buy brian eno and moebius roedelius plank mp3 music mp3fiestacom'

distance = 384
spam score = 82
title = 'download mp3 agharta music buy agharta mp3 music mp3fiestacom'

distance = 384
spam score = 73
title = 'download mp3 brett anderson music buy brett anderson mp3 music mp3fiestacom'

distance = 384
spam score = 76
title = 'download mp3 audiojunkie and stylus ft rachael music buy audiojunkie and stylus ft rachael mp3 music mp3fiestacom'

distance = 384
spam score = 79
title = 'download mp3 blake baxter music buy blake baxter mp3 music mp3fiestacom'

distance = 384
spam score = 79
title = 'download mp3 buchan elizabeth music buy buchan elizabeth mp3 music mp3fiestacom'

distance = 384
spam score = 82
title = 'download mp3 banks l a tananarive due and brandon massey music buy banks l a tananarive due and brandon massey mp3 music mp3fiestacom'

distance = 384
spam score = 81
title = 'download mp3 adam beyer vs cari lekebusch music buy adam beyer vs cari lekebusch mp3 music mp3fiestacom'

distance = 384
spam score = 80
title = 'download mp3 alex c feat y ass music buy alex c feat y ass mp3 music mp3fiestacom'

distance = 385
spam score = 77
title = 'download mp3 amistades peligrosas music buy amistades peligrosas mp3 music mp3fiestacom'

distance = 1728
spam score = 40
title = 'hogan im gonna to sing til the spirit moves free music links from classic cat'

distance = 1729
spam score = 18
title = 'track mp3pandacom'

distance = 271
spam score = 39
title = ''

distance = 272
spam score = 40
title = ''

distance = 275
spam score = 27
title = ''

distance = 303
spam score = 30
title = ''

distance = 306
spam score = 39
title = ''

distance = 328
spam score = 34
title = ''

distance = 347
spam score = 34
title = ''

distance = 348
spam score = 40
title = ''

distance = 166
spam score = 52
title = ''

distance = 168
spam score = 56
title = ''

distance = 175
spam score = 43
title = ''

distance = 189
spam score = 55
title = ''

distance = 200
spam score = 53
title = ''

distance = 205
spam score = 54
title = ''

distance = 207
spam score = 54
title = ''

distance = 210
spam score = 54
title = ''

distance = 228
spam score = 55
title = ''

distance = 257
spam score = 48
title = ''

distance = 257
spam score = 55
title = ''

distance = 258
spam score = 52
title = ''

distance = 261
spam score = 55
title = ''

distance = 266
spam score = 57
title = ''

distance = 272
spam score = 45
title = ''

distance = 282
spam score = 62
title = ''

distance = 282
spam score = 49
title = ''

distance = 283
spam score = 53
title = ''

distance = 284
spam score = 40
title = ''

distance = 289
spam score = 58
title = ''

distance = 300
spam score = 54
title = ''

distance = 311
spam score = 50
title = ''

distance = 316
spam score = 57
title = ''

distance = 323
spam score = 61
title = ''

distance = 323
spam score = 60
title = ''

distance = 325
spam score = 56
title = ''

distance = 331
spam score = 54
title = ''

distance = 331
spam score = 50
title = ''

distance = 331
spam score = 53
title = ''

distance = 333
spam score = 58
title = ''

distance = 339
spam score = 55
title = ''

distance = 345
spam score = 47
title = ''

distance = 358
spam score = 49
title = ''

distance = 360
spam score = 50
title = ''

distance = 387
spam score = 57
title = ''

distance = 394
spam score = 53
title = ''

distance = 422
spam score = 41
title = ''

distance = 455
spam score = 58
title = ''

distance = 510
spam score = 42
title = ''

distance = 551
spam score = 57
title = ''

distance = 141
spam score = 97
title = ''

distance = 145
spam score = 99
title = ''

distance = 148
spam score = 98
title = ''

distance = 149
spam score = 98
title = ''

distance = 158
spam score = 99
title = ''

distance = 164
spam score = 99
title = ''

distance = 169
spam score = 98
title = ''

distance = 173
spam score = 96
title = ''

distance = 177
spam score = 98
title = ''

distance = 177
spam score = 99
title = ''

distance = 180
spam score = 96
title = ''

distance = 183
spam score = 97
title = ''

distance = 184
spam score = 97
title = ''

distance = 188
spam score = 97
title = ''

distance = 192
spam score = 95
title = ''

distance = 205
spam score = 99
title = ''

distance = 205
spam score = 96
title = ''

distance = 205
spam score = 97
title = ''

distance = 210
spam score = 97
title = ''

distance = 211
spam score = 98
title = ''

distance = 214
spam score = 98
title = ''

distance = 214
spam score = 96
title = ''

distance = 214
spam score = 98
title = ''

distance = 215
spam score = 99
title = ''

distance = 218
spam score = 97
title = ''

distance = 223
spam score = 96
title = ''

distance = 224
spam score = 97
title = ''

distance = 237
spam score = 98
title = ''

distance = 241
spam score = 97
title = ''

distance = 243
spam score = 97
title = ''

distance = 244
spam score = 97
title = ''

distance = 248
spam score = 99
title = ''

distance = 249
spam score = 98
title = ''

distance = 251
spam score = 97
title = ''

distance = 252
spam score = 96
title = ''

distance = 252
spam score = 98
title = ''

distance = 253
spam score = 98
title = ''

distance = 256
spam score = 98
title = ''

distance = 256
spam score = 98
title = ''

distance = 257
spam score = 96
title = ''

distance = 264
spam score = 98
title = ''

distance = 266
spam score = 98
title = ''

distance = 266
spam score = 96
title = ''

distance = 268
spam score = 98
title = ''

distance = 272
spam score = 99
title = ''

distance = 281
spam score = 99
title = ''

distance = 286
spam score = 99
title = ''

distance = 294
spam score = 97
title = ''

distance = 295
spam score = 97
title = ''

distance = 295
spam score = 97
title = ''

distance = 298
spam score = 99
title = ''

distance = 304
spam score = 99
title = ''

distance = 310
spam score = 98
title = ''

distance = 313
spam score = 97
title = ''

distance = 314
spam score = 98
title = ''

distance = 324
spam score = 98
title = ''

distance = 328
spam score = 98
title = ''

distance = 333
spam score = 97
title = ''

distance = 345
spam score = 95
title = ''

distance = 348
spam score = 95
title = ''

distance = 348
spam score = 99
title = ''

distance = 350
spam score = 97
title = ''

distance = 351
spam score = 97
title = ''

distance = 372
spam score = 99
title = ''

distance = 373
spam score = 99
title = ''

distance = 382
spam score = 99
title = ''

distance = 386
spam score = 98
title = ''

distance = 401
spam score = 97
title = ''

distance = 412
spam score = 99
title = ''

distance = 413
spam score = 98
title = ''

distance = 414
spam score = 98
title = ''

distance = 431
spam score = 98
title = ''

distance = 436
spam score = 99
title = ''

distance = 438
spam score = 98
title = ''

distance = 439
spam score = 98
title = ''

distance = 442
spam score = 99
title = ''

distance = 445
spam score = 98
title = ''

distance = 447
spam score = 97
title = ''

distance = 468
spam score = 99
title = ''

distance = 489
spam score = 97
title = ''

distance = 511
spam score = 99
title = ''

distance = 536
spam score = 99
title = ''

distance = 577
spam score = 99
title = ''

distance = 579
spam score = 99
title = ''

distance = 587
spam score = 96
title = ''

distance = 138
spam score = 19
title = 'tower search hispanic directory'

distance = 144
spam score = 17
title = 'exactseek hispanic directory'

distance = 145
spam score = 19
title = 'sonic run hispanic directory'

distance = 146
spam score = 14
title = 'ringtones at 1001 consejos hispanic directory'

distance = 153
spam score = 19
title = 'travel leisure hispanic directory'

distance = 154
spam score = 22
title = 'courses spanish hispanic directory'

distance = 157
spam score = 15
title = 'dominican republic directory hispanic directory'

distance = 159
spam score = 18
title = 'el directorio de hispanic directory'

distance = 160
spam score = 18
title = 'belleza natural hispanic directory'

distance = 161
spam score = 19
title = 'negocios hispanic directory'

distance = 161
spam score = 21
title = 'chapunet hispanic directory'

distance = 162
spam score = 13
title = 'music at 1001 consejos hispanic directory'

distance = 163
spam score = 12
title = 'videos at 1001 consejos hispanic directory'

distance = 163
spam score = 16
title = 'cruceros y ms hispanic directory'

distance = 164
spam score = 18
title = 'family at 1001 consejos hispanic directory'

distance = 165
spam score = 20
title = 'puzzels online hispanic directory'

distance = 166
spam score = 20
title = 'countedeal hispanic directory'

distance = 166
spam score = 18
title = 'free web submission hispanic directory'

distance = 167
spam score = 14
title = 'ticket barato hispanic directory'

distance = 169
spam score = 16
title = 'pergamino virtual hispanic directory'

distance = 208
spam score = 16
title = 'negocio hispanic directory'

distance = 208
spam score = 16
title = 'alpfa hispanic directory'

distance = 209
spam score = 13
title = 'tarjetas bubba hispanic directory'

distance = 209
spam score = 15
title = 'shopping at 1001 consejos hispanic directory'

distance = 210
spam score = 13
title = 'health amp fitness at 1001 consejos hispanic directory'

distance = 211
spam score = 15
title = 'latin cardio fitness hispanic directory'

distance = 211
spam score = 14
title = 'money and finance at 1001 consejos hispanic directory'

distance = 211
spam score = 16
title = 'hispanic college fund hispanic directory'

distance = 211
spam score = 14
title = 'revista record hispanic directory'

distance = 213
spam score = 13
title = 'employment at 1001 consejos hispanic directory'

distance = 226
spam score = 22
title = 'webmd hispanic directory'

distance = 226
spam score = 15
title = 'phrases finder hispanic directory'

distance = 228
spam score = 17
title = 'el exito hispanic directory'

distance = 228
spam score = 18
title = 'fox sports hispanic directory'

distance = 228
spam score = 16
title = 'the gonzalez report hispanic directory'

distance = 228
spam score = 12
title = 'amigo foods hispanic directory'

distance = 229
spam score = 21
title = 'gusanito hispanic directory'

distance = 229
spam score = 17
title = 'latin gossip hispanic directory'

distance = 229
spam score = 13
title = 'executives at 1001 consejos hispanic directory'

distance = 230
spam score = 13
title = 'brown planet hispanic directory'

distance = 242
spam score = 21
title = 'horoscopos hispanic directory'

distance = 245
spam score = 16
title = 'ricky martin hispanic directory'

distance = 246
spam score = 17
title = 'latina food hispanic directory'

distance = 246
spam score = 13
title = 'concerts at 1001 consejos hispanic directory'

distance = 247
spam score = 20
title = 'paella hispanic directory'

distance = 247
spam score = 14
title = 'minijuegos chicas hispanic directory'

distance = 248
spam score = 15
title = 'top latino hispanic directory'

distance = 250
spam score = 15
title = 'abuelos hispanic directory'

distance = 250
spam score = 13
title = 'lotto at 1001 consejos hispanic directory'

distance = 250
spam score = 13
title = 'maquillaje hispanic directory'

distance = 259
spam score = 13
title = 'carros deportivos hispanic directory'

distance = 259
spam score = 16
title = 'choneez hispanic directory'

distance = 259
spam score = 17
title = 'el diario hispanic directory'

distance = 259
spam score = 12
title = 'entertainment at 1001 consejos hispanic directory'

distance = 260
spam score = 13
title = 'about mexican food hispanic directory'

distance = 260
spam score = 17
title = 'directorio web rss hispanic directory'

distance = 262
spam score = 20
title = 'nada logo hispanic directory'

distance = 262
spam score = 14
title = 'seguros paisano hispanic directory'

distance = 262
spam score = 17
title = 'latin lounge tv hispanic directory'

distance = 262
spam score = 14
title = 'scholarship hispanic hispanic directory'

distance = 279
spam score = 18
title = 'boletos de conciertos hispanic directory'

distance = 280
spam score = 19
title = 'ahorausa hispanic directory'

distance = 280
spam score = 11
title = 'frases de amistad hispanic directory'

distance = 280
spam score = 12
title = 'pregnancy at 1001 consejos hispanic directory'

distance = 280
spam score = 14
title = 'horoscopes at 1001 consejos hispanic directory'

distance = 281
spam score = 16
title = 'mi gente hispanic directory'

distance = 281
spam score = 19
title = 'my automovil hispanic directory'

distance = 282
spam score = 17
title = 'viajar hispanic directory'

distance = 282
spam score = 10
title = 'mejor amor hispanic directory'

distance = 282
spam score = 15
title = 'viva mxico hispanic directory'

distance = 297
spam score = 12
title = 'beauty at 1001 consejos hispanic directory'

distance = 299
spam score = 15
title = 'lindisima hispanic directory'

distance = 301
spam score = 15
title = 'cantarima bilingual videos hispanic directory'

distance = 303
spam score = 18
title = 'auto hoy hispanic directory'

distance = 304
spam score = 15
title = 'latcarrers hispanic directory'

distance = 304
spam score = 17
title = 'disfraces hispanic directory'

distance = 310
spam score = 18
title = 'manualidades hispanic directory'

distance = 310
spam score = 18
title = 'autos nuevos hispanic directory'

distance = 313
spam score = 14
title = 'travlang8217s spanishenglish dictionary hispanic directory'

distance = 313
spam score = 20
title = 'home amp garden hispanic directory'

distance = 337
spam score = 19
title = 'cny latino hispanic directory'

distance = 338
spam score = 13
title = 'vestidos y vestidos hispanic directory'

distance = 339
spam score = 13
title = 'musica online hispanic directory'

distance = 339
spam score = 13
title = '123greetings hispanic directory'

distance = 339
spam score = 18
title = 'maldef hispanic directory'

distance = 341
spam score = 14
title = 'careers and college hispanic directory'

distance = 344
spam score = 8
title = 'rumbo hispanic directory'

distance = 344
spam score = 12
title = 'hola tu hispanic directory'

distance = 344
spam score = 15
title = 'abc del beb hispanic directory'

distance = 346
spam score = 17
title = 'boricua imports hispanic directory'

distance = 381
spam score = 15
title = 'traductores gratis hispanic directory'

distance = 384
spam score = 14
title = 'ndice de masa corporal hispanic directory'

distance = 385
spam score = 14
title = 'regalos navidad hispanic directory'

distance = 386
spam score = 14
title = 'ihispano hispanic directory'

distance = 389
spam score = 19
title = 'casa nueva guide hispanic directory'

distance = 389
spam score = 18
title = 'entradas hispanic directory'

distance = 389
spam score = 15
title = 'spanish book distributor hispanic directory'

distance = 389
spam score = 14
title = 'juegos pc hispanic directory'

distance = 391
spam score = 16
title = 'auto mundo hispanic directory'

distance = 393
spam score = 15
title = 'alegsa hispanic directory'

distance = 646
spam score = 13
title = 'ringtone websites hispanic directory'

distance = 754
spam score = 15
title = 'immigration websites hispanic directory'

distance = 767
spam score = 15
title = 'lotto websites hispanic directory'

distance = 807
spam score = 11
title = 'map websites hispanic directory'

distance = 885
spam score = 7
title = 'weather websites hispanic directory'

distance = 1118
spam score = 25
title = 'scholarship websites hispanic directory'

distance = 1121
spam score = 14
title = 'home websites hispanic directory'

distance = 1863
spam score = 65
title = 'published papers'

distance = 172
spam score = 99
title = 'hot fuzz 124 brattle theatre'

distance = 177
spam score = 99
title = 'rocky horror picture show 124 brattle theatre'

distance = 187
spam score = 98
title = 'it8217s a gift 124 brattle theatre'

distance = 188
spam score = 98
title = 'fast times at ridgemont high 124 brattle theatre'

distance = 189
spam score = 99
title = 'baby face 124 brattle theatre'

distance = 192
spam score = 94
title = 'brattle screen 124 brattle theatre'

distance = 196
spam score = 94
title = 'brattle stage 124 brattle theatre'

distance = 199
spam score = 94
title = 'brattle interior 124 brattle theatre'

distance = 200
spam score = 94
title = 'brattle hall exterior 124 brattle theatre'

distance = 201
spam score = 99
title = 'hot fuzz 124 brattle theatre'

distance = 204
spam score = 99
title = 'it8217s a wonderful life 124 brattle theatre'

distance = 206
spam score = 99
title = '2001 a space odyssey 124 brattle theatre'

distance = 208
spam score = 99
title = 'predators 124 brattle theatre'

distance = 210
spam score = 94
title = 'back to the future 3 124 brattle theatre'

distance = 211
spam score = 94
title = 'brattle oscar party 2004 124 brattle theatre'

distance = 215
spam score = 99
title = 'blazing saddles 124 brattle theatre'

distance = 216
spam score = 99
title = 'it8217s a wonderful life 124 brattle theatre'

distance = 218
spam score = 98
title = 'we are the night 124 brattle theatre'

distance = 218
spam score = 99
title = 'shaun of the dead 124 brattle theatre'

distance = 218
spam score = 99
title = 'rear window 124 brattle theatre'

distance = 276
spam score = 96
title = 'poltergeist 124 brattle theatre'

distance = 277
spam score = 99
title = 'evangelion 10 you are not alone 124 brattle theatre'

distance = 277
spam score = 99
title = 'naked lunch 124 brattle theatre'

distance = 277
spam score = 95
title = 'strange days 124 brattle theatre'

distance = 277
spam score = 98
title = '42nd street 124 brattle theatre'

distance = 278
spam score = 98
title = 'dogtooth 124 brattle theatre'

distance = 278
spam score = 97
title = 'juon the grudge 124 brattle theatre'

distance = 278
spam score = 98
title = 'kinks party 124 brattle theatre'

distance = 278
spam score = 97
title = 'gold diggers of 1933 124 brattle theatre'

distance = 279
spam score = 98
title = 'the big combo 124 brattle theatre'

distance = 298
spam score = 98
title = 'meek8217s cutoff 124 brattle theatre'

distance = 298
spam score = 99
title = 'true grit 1969 124 brattle theatre'

distance = 298
spam score = 98
title = 'the maltese falcon 124 brattle theatre'

distance = 298
spam score = 99
title = 'machete 124 brattle theatre'

distance = 298
spam score = 98
title = 'anton chekhovs the duel 124 brattle theatre'

distance = 298
spam score = 98
title = 'one two three 124 brattle theatre'

distance = 299
spam score = 99
title = 'giorgio moroder8217s metropolis 124 brattle theatre'

distance = 299
spam score = 97
title = 'cape fear 124 brattle theatre'

distance = 300
spam score = 98
title = 'phantom of the paradise 124 brattle theatre'

distance = 300
spam score = 94
title = 'concerts 124 brattle theatre'

distance = 314
spam score = 98
title = 'the french connection 124 brattle theatre'

distance = 314
spam score = 97
title = 'the amityville horror 124 brattle theatre'

distance = 315
spam score = 97
title = 'fantastic mr fox 124 brattle theatre'

distance = 315
spam score = 98
title = 'the big uneasy screens tuesday july 26th 124 brattle theatre'

distance = 315
spam score = 98
title = 'ai artificial intelligence 124 brattle theatre'

distance = 315
spam score = 98
title = '8 women 124 brattle theatre'

distance = 315
spam score = 98
title = 'machete 124 brattle theatre'

distance = 316
spam score = 98
title = 'the innkeepers 124 brattle theatre'

distance = 316
spam score = 99
title = 'its a wonderful life 124 brattle theatre'

distance = 316
spam score = 97
title = 'tabloid 124 brattle theatre'

distance = 329
spam score = 97
title = 'a christmas tale 124 brattle theatre'

distance = 329
spam score = 99
title = 'enter the void 124 brattle theatre'

distance = 329
spam score = 99
title = 'badlands 124 brattle theatre'

distance = 330
spam score = 95
title = 'gilda 124 brattle theatre'

distance = 330
spam score = 98
title = 'all the lovin8217 kinfolk 124 brattle theatre'

distance = 330
spam score = 97
title = 'grapes of wrath 124 brattle theatre'

distance = 330
spam score = 97
title = 'fantastic mr fox 124 brattle theatre'

distance = 330
spam score = 98
title = 'the robber 124 brattle theatre'

distance = 330
spam score = 98
title = 'chris amp don a love story 124 brattle theatre'

distance = 330
spam score = 98
title = 'edward scissorhands 124 brattle theatre'

distance = 344
spam score = 92
title = 'buy stuff 124 brattle theatre'

distance = 344
spam score = 99
title = 'pearl jam twenty 124 brattle theatre'

distance = 345
spam score = 98
title = 'true grit 2010 124 brattle theatre'

distance = 345
spam score = 94
title = 'in the mood for love 124 brattle theatre'

distance = 345
spam score = 99
title = 'edgar wright selects flash gordon 124 brattle theatre'

distance = 345
spam score = 98
title = 'true grit 2010 124 brattle theatre'

distance = 345
spam score = 96
title = 'the vampire lovers 124 brattle theatre'

distance = 346
spam score = 97
title = 'brett easton ellis 124 brattle theatre'

distance = 346
spam score = 97
title = 'mother 124 brattle theatre'

distance = 346
spam score = 92
title = 'buy stuff 124 brattle theatre'

distance = 364
spam score = 97
title = 'black swan 124 brattle theatre'

distance = 364
spam score = 99
title = 'battleship potemkin 124 brattle theatre'

distance = 364
spam score = 99
title = 'the girl with the dragon tattoo 124 brattle theatre'

distance = 365
spam score = 94
title = 'buy stuff 124 brattle theatre'

distance = 365
spam score = 95
title = 'nostalgia for the light 124 brattle theatre'

distance = 365
spam score = 94
title = 'buy stuff 124 brattle theatre'

distance = 365
spam score = 94
title = 'buy stuff 124 brattle theatre'

distance = 365
spam score = 94
title = 'buy stuff 124 brattle theatre'

distance = 365
spam score = 94
title = 'buy stuff 124 brattle theatre'

distance = 365
spam score = 93
title = 'buy stuff 124 brattle theatre'

distance = 390
spam score = 98
title = 'the african queen 124 brattle theatre'

distance = 390
spam score = 97
title = 'waterworld 124 brattle theatre'

distance = 390
spam score = 98
title = 'the african queen 124 brattle theatre'

distance = 390
spam score = 95
title = 'buy stuff 124 brattle theatre'

distance = 390
spam score = 98
title = 'the african queen 124 brattle theatre'

distance = 391
spam score = 99
title = 'cremaster 45 124 brattle theatre'

distance = 391
spam score = 98
title = 'the wages of fear 124 brattle theatre'

distance = 392
spam score = 99
title = 'the african queen 124 brattle theatre'

distance = 392
spam score = 99
title = 'cremaster 3 124 brattle theatre'

distance = 392
spam score = 97
title = 'who is harry nilsson and why is everybody talkin about him 124 brattle theatre'

distance = 417
spam score = 99
title = 'everyday sunshine the story of fishbone 124 brattle theatre'

distance = 418
spam score = 96
title = 'donor spotlight dan and michlyne thal 124 brattle theatre'

distance = 418
spam score = 91
title = 'buy stuff 124 brattle theatre'

distance = 418
spam score = 93
title = 'and everything is going fine 124 brattle theatre'

distance = 418
spam score = 97
title = '13 assassins 124 brattle theatre'

distance = 419
spam score = 99
title = 'gerrymandering 124 brattle theatre'

distance = 420
spam score = 98
title = 'groundhog day 124 brattle theatre'

distance = 422
spam score = 98
title = 'pearl jam twenty 124 brattle theatre'

distance = 423
spam score = 98
title = '13 assassins 124 brattle theatre'

distance = 423
spam score = 93
title = 'cremaster 12 124 brattle theatre'

distance = 510
spam score = 97
title = 'administration 124 brattle theatre'

distance = 510
spam score = 97
title = 'being elmo a puppeteer8217s journey 124 brattle theatre'

distance = 517
spam score = 98
title = 'being elmo a puppeteer8217s journey 124 brattle theatre'

distance = 530
spam score = 96
title = 'mysteries of lisbon 124 brattle theatre'

distance = 537
spam score = 98
title = 'being elmo a puppeteer8217s journey 124 brattle theatre'

distance = 539
spam score = 97
title = 'being elmo a puppeteer8217s journey 124 brattle theatre'

distance = 545
spam score = 93
title = 'weekend 124 brattle theatre'

distance = 566
spam score = 99
title = 'guy 038 madeline on a park bench 124 brattle theatre'

distance = 716
spam score = 98
title = 'directions amp parking 124 brattle theatre'

distance = 169
spam score = 52
title = 'happily ever after wedding invitation photo'

distance = 172
spam score = 53
title = 'photo beach wedding invitation'

distance = 175
spam score = 56
title = 'hooting good birthday party invitation'

distance = 182
spam score = 58
title = 'couple8217s initialed thank you card 8211 personalized photo'

distance = 185
spam score = 58
title = 'modern boy8217s communion thank you'

distance = 186
spam score = 53
title = 'daisy chain birthday photo invitation'

distance = 188
spam score = 55
title = 'baby monkey photo thank you card'

distance = 191
spam score = 53
title = 'starry photo 17th birthday invitation 8211 black amp red'

distance = 197
spam score = 57
title = 'midnight wedding photo announcement'

distance = 198
spam score = 61
title = 'life in photos birthday invitation'

distance = 201
spam score = 59
title = 'monkey around birthday thank you'

distance = 206
spam score = 64
title = 'modern christmas birth announcement'

distance = 207
spam score = 58
title = 'cowboys team colors birthday invitation'

distance = 209
spam score = 56
title = 'fuchsia snowflakes birth announcement'

distance = 212
spam score = 62
title = 'whimsical college commencement invitation 8211 green photo'

distance = 213
spam score = 59
title = 'rock star babes birthday invitation'

distance = 216
spam score = 57
title = 'merry christmas to all photo card'

distance = 218
spam score = 59
title = 'green amp blue seuss christmas card'

distance = 218
spam score = 59
title = 'storytime photo birthday invitation 8211 moose books'

distance = 218
spam score = 55
title = 'construction trucks birthday invitation'

distance = 249
spam score = 61
title = 'irish baby monkey birthday invitation'

distance = 249
spam score = 51
title = 'irish bride smiles shower invitation'

distance = 250
spam score = 58
title = 'green amp pink butterfly bridal invitation'

distance = 250
spam score = 55
title = 'silver amp red butterflies bridal shower card'

distance = 251
spam score = 63
title = 'valentine photo baptism thank you'

distance = 251
spam score = 56
title = 'black amp red butterflies shower invitation'

distance = 251
spam score = 57
title = 'green amp gold autumn 50th anniversary card'

distance = 252
spam score = 60
title = 'refreshing blue three photo graduation card'

distance = 252
spam score = 54
title = 'bridal cooking shower invitation'

distance = 252
spam score = 52
title = 'jeans photo save the date card'

distance = 261
spam score = 57
title = 'christmas snowflakes photo baby shower invitation'

distance = 262
spam score = 59
title = 'heritage baptism photo thank you card'

distance = 262
spam score = 59
title = 'heritage baptism photo thank you card'

distance = 262
spam score = 58
title = 'customcolored penguin birthday invitation'

distance = 264
spam score = 62
title = 'winter chic wedding thank you collage card'

distance = 264
spam score = 59
title = 'wild zoo thank you card'

distance = 264
spam score = 59
title = 'cream spring bunnies birthday invitation'

distance = 265
spam score = 60
title = 'two birthdays one party invitation'

distance = 265
spam score = 52
title = 'jungle cub ultrasound invitation'

distance = 265
spam score = 53
title = 'purple wee babe shower invitation'

distance = 276
spam score = 56
title = 'coed shamrock ultrasound invitation'

distance = 276
spam score = 58
title = 'purple harvest wagon thank you card'

distance = 276
spam score = 59
title = 'pretty minnie birthday photo invitation'

distance = 276
spam score = 59
title = 'film strip 2012 new year photo card'

distance = 276
spam score = 63
title = 'square university graduation party card 8211 gold green amp brown'

distance = 277
spam score = 49
title = 'yankees amp orioles coed shower invitation'

distance = 278
spam score = 57
title = 'chic shamrock baptism thank you card'

distance = 278
spam score = 64
title = 'shabby lavender open house invitation'

distance = 279
spam score = 55
title = 'sunshine dream graduation invitation'

distance = 279
spam score = 53
title = 'coral elegance communion invitation'

distance = 286
spam score = 56
title = 'wild jungle boy shower invitation'

distance = 286
spam score = 54
title = 'formal blue baby shower card'

distance = 287
spam score = 46
title = 'purple shamrock rsvp card'

distance = 287
spam score = 61
title = 'baby bright birthday thank you card'

distance = 288
spam score = 61
title = 'adventure girl coed shower invitation'

distance = 288
spam score = 61
title = 'vintage modern turquoise graduation card'

distance = 288
spam score = 63
title = 'easter birthday party sibling invitation'

distance = 289
spam score = 59
title = 'photo coed garden bridal shower invitation'

distance = 289
spam score = 61
title = 'circus nostalgia birthday invitation'

distance = 289
spam score = 59
title = 'photo coed garden bridal shower invitation'

distance = 301
spam score = 61
title = 'green amp yellow poppies party invitation'

distance = 301
spam score = 67
title = 'irish girl owl shower invitation'

distance = 302
spam score = 56
title = 'butterfly dance thank you card'

distance = 302
spam score = 58
title = 'shamrock girl rsvp card'

distance = 304
spam score = 64
title = 'black amp green photo graduation card'

distance = 304
spam score = 60
title = 'john deere baby shower invitation'

distance = 304
spam score = 66
title = 'summery photo modern graduation card'

distance = 305
spam score = 60
title = 'guy8217s black amp crimson graduation card'

distance = 305
spam score = 60
title = 'guy8217s black amp crimson graduation card'

distance = 305
spam score = 62
title = 'baby snowflake princess shower invitation'

distance = 324
spam score = 60
title = 'cute amp classic baby thank you card'

distance = 327
spam score = 62
title = 'princess finery birthday invitation'

distance = 329
spam score = 57
title = 'cinderella masquerade shower invitation 8211 purple bridal'

distance = 329
spam score = 49
title = 'graduation party multiphoto collage invitation'

distance = 329
spam score = 64
title = 'countryside butterfly shower invitation'

distance = 329
spam score = 63
title = 'countryside butterfly shower invitation'

distance = 329
spam score = 53
title = 'pink snowy owl thank you card'

distance = 329
spam score = 68
title = 'hooty owl baby shower invitation'

distance = 329
spam score = 52
title = 'pink snowy owl thank you card'

distance = 329
spam score = 67
title = 'casual chic twin graduation card'

distance = 345
spam score = 65
title = 'photo antiqued 50th anniversary card'

distance = 345
spam score = 58
title = 'fancy dress quinceaera invitation'

distance = 345
spam score = 54
title = 'ruby anniversary vow renewal invitation 8211 40th ceremony'

distance = 347
spam score = 61
title = 'green calico christening photo invitation'

distance = 348
spam score = 47
title = 'farm birthday invitation 8211 cow boy'

distance = 351
spam score = 64
title = 'black amp gold splash thank you card'

distance = 351
spam score = 64
title = 'black amp gold splash thank you card'

distance = 352
spam score = 55
title = 'lavender amp silver garden shower invitation'

distance = 355
spam score = 59
title = 'rose lace baptism amp dedication invitation 8211 ladylike two photo'

distance = 357
spam score = 59
title = 'sentimental bridal shower invitation'

distance = 401
spam score = 63
title = 'butterfly rainbow first communion invitation'

distance = 404
spam score = 53
title = 'green butterfly garden shower invitation'

distance = 404
spam score = 52
title = 'snowy chic baby shower invitation'

distance = 407
spam score = 52
title = 'fresh black amp white engagement card'

distance = 410
spam score = 57
title = 'lavender spring baptism invitation'

distance = 410
spam score = 57
title = 'lavender spring baptism invitation'

distance = 410
spam score = 54
title = 'black photo masquerade party invitation'

distance = 415
spam score = 47
title = 'dreamy baby coed shower invitation'

distance = 415
spam score = 56
title = 'film strip 65th birthday invitation'

distance = 420
spam score = 50
title = 'black buccaneer birthday invitation'

distance = 774
spam score = 31
title = 'where the toddler is multicolored8230'

distance = 830
spam score = 59
title = 'celebrating two months of captured memories8230'

distance = 862
spam score = 35
title = 'the continuing adventures of the toddler and his duck8230'

distance = 1042
spam score = 55
title = 'our flor customizable area rug 8211 the duck review'

distance = 1901
spam score = 12
title = 'concept explore browsable dictionary'

distance = 111
spam score = 76
title = 'the city mashkulture'

distance = 118
spam score = 75
title = 'today8217s photograph mashkulture'

distance = 122
spam score = 72
title = 'daily video fort lean 8220beach holiday8221 2011 mashkulture'

distance = 125
spam score = 76
title = 'daily video wiz khalifa 8220in the cut8221 2010 mashkulture'

distance = 126
spam score = 86
title = 'how photographers spend their time mashkulture'

distance = 126
spam score = 75
title = 'today8217s photograph mashkulture'

distance = 130
spam score = 78
title = 'today8217s photograph mashkulture'

distance = 132
spam score = 69
title = 'endless roads 2 8216the island8217 mashkulture'

distance = 133
spam score = 73
title = 'jmoney 821609 spring mashkulture'

distance = 134
spam score = 72
title = 'a day with mighty healthy mashkulture'

distance = 136
spam score = 71
title = 'daily video peaches 8220mud8221 2011 mashkulture'

distance = 137
spam score = 77
title = 'today8217s photograph mashkulture'

distance = 137
spam score = 72
title = 'daily video trash talk 8220slander8221 mashkulture'

distance = 142
spam score = 78
title = 'today8217s photograph mashkulture'

distance = 143
spam score = 72
title = 'flying fortress 2011 summer tshirts mashkulture'

distance = 147
spam score = 76
title = 'word as image mashkulture'

distance = 150
spam score = 77
title = 'huf welcomes josh matthews mashkulture'

distance = 150
spam score = 77
title = 'huf welcomes josh matthews mashkulture'

distance = 153
spam score = 69
title = 'air jordan v 8216blackmetallic silver8217 2011 retro mashkulture'

distance = 155
spam score = 76
title = 'dogs in cars mashkulture'

distance = 193
spam score = 76
title = 'parra 8216i like the tee shirt but i will get the painting8217 recap mashkulture'

distance = 193
spam score = 74
title = 'today8217s photograph mashkulture'

distance = 193
spam score = 75
title = 'mishka 821609 summer new era preview 2 mashkulture'

distance = 194
spam score = 75
title = 'johnny cupcakes 2011 march tshirts 2 mashkulture'

distance = 194
spam score = 74
title = 'warriors of radness 8216california girls8217 video nsfw mashkulture'

distance = 195
spam score = 76
title = 'massive 8216heels8217 mural by insa mashkulture'

distance = 196
spam score = 79
title = 'today8217s photograph mashkulture'

distance = 200
spam score = 74
title = 'daily video anthrax 8220antisocial8221 1988 mashkulture'

distance = 201
spam score = 81
title = 'suicidal tendencies x new era 59fifty mashkulture'

distance = 203
spam score = 80
title = 'creative recreation 2010 spring 8216made in italy8217 collection mashkulture'

distance = 215
spam score = 79
title = 'pam 821609 springsummer 8216low cut8217 sneakers mashkulture'

distance = 216
spam score = 70
title = 'daily video arcade fire 8220sprawl ii mountains beyond mountains8221 2011 mashkulture'

distance = 217
spam score = 73
title = 'nike air structure triax 91 8216granite8217 mashkulture'

distance = 218
spam score = 77
title = 'rockersnyc 2010 fallwinter preview mashkulture'

distance = 218
spam score = 66
title = 'nixon 8216the monopoly8217 watch mashkulture'

distance = 220
spam score = 69
title = 'today8217s photograph mashkulture'

distance = 221
spam score = 64
title = 'kidrobot 821609 summer tees mashkulture'

distance = 222
spam score = 72
title = 'alexander tikhomirov photography mashkulture'

distance = 224
spam score = 75
title = 'staple x airwalk 2010 spring mashkulture'

distance = 224
spam score = 79
title = 'today8217s photograph mashkulture'

distance = 244
spam score = 77
title = 'nike air max light 8216neutral greyblackphoto blueneon lime8217 mashkulture'

distance = 244
spam score = 73
title = 'daily video pantera 8220piss8221 mashkulture'

distance = 246
spam score = 85
title = 'shepard fairey 8216180 south8217 print mashkulture'

distance = 247
spam score = 82
title = 'monday8217s moff mashkulture'

distance = 247
spam score = 66
title = 'nike blazer high vintage nd 8216black8217 amp 8216grey8217 mashkulture'

distance = 248
spam score = 80
title = 'obey 8216windmill8217 print mashkulture'

distance = 248
spam score = 66
title = 'dondi8217s 8216children of the grave8217 wholecar series mashkulture'

distance = 248
spam score = 64
title = 'gsg tony montana 8216callface8217 print mashkulture'

distance = 249
spam score = 83
title = 'the hundreds 8216dom bomb8217 tee mashkulture'

distance = 250
spam score = 62
title = '2011 listed the best prints of the year 8211 top 15 mashkulture'

distance = 270
spam score = 60
title = 'vintage transformers box art mashkulture'

distance = 270
spam score = 70
title = 'daily video pantera 8220piss8221 mashkulture'

distance = 271
spam score = 73
title = 'monday8217s moff mashkulture'

distance = 273
spam score = 71
title = 'crooks amp castles 821609 summer lookbook mashkulture'

distance = 275
spam score = 76
title = 'bbcice cream sunglasses mashkulture'

distance = 276
spam score = 74
title = 'interview with greg rivera from mishka mashkulture'

distance = 276
spam score = 69
title = 'gourmet 2012 spring quadici l 8216navytan8217 mashkulture'

distance = 276
spam score = 78
title = 'parra 8216the disco of italo8217 exhibit mashkulture'

distance = 277
spam score = 76
title = 'quoddy leather deck chukkas mashkulture'

distance = 278
spam score = 66
title = 'daily video western tink 8220fancy shmancy8221 mashkulture'

distance = 299
spam score = 76
title = 'richard stultz 8216choices8217 mashkulture'

distance = 300
spam score = 78
title = 'kiss x medicom toy i was made for lovin8217 you kubricks mashkulture'

distance = 300
spam score = 71
title = 'new mural by agostino mashkulture'

distance = 304
spam score = 79
title = 'plndr car giveaway mashkulture'

distance = 305
spam score = 53
title = 'heel bruise 2012 spring tshirts mashkulture'

distance = 306
spam score = 67
title = 'acapulco gold 2012 spring lookbook mashkulture'

distance = 308
spam score = 78
title = 'plndr car giveaway mashkulture'

distance = 310
spam score = 66
title = 'mashkulture monster'

distance = 310
spam score = 69
title = 'mashkulture casey girard'

distance = 311
spam score = 78
title = 'monday8217s moff mashkulture'

distance = 339
spam score = 80
title = 'the aerial photography of alex maclean mashkulture'

distance = 341
spam score = 64
title = 'mashkulture dondi'

distance = 342
spam score = 70
title = 'following joe mashkulture'

distance = 347
spam score = 68
title = 'mashkulture mel ramos'

distance = 348
spam score = 52
title = 'how an ipad is made mashkulture'

distance = 353
spam score = 49
title = 'mashkulture andrey nepomnyaschev'

distance = 357
spam score = 78
title = 'justin mezzell illustration mashkulture'

distance = 358
spam score = 68
title = 'mashkulture iggy pop'

distance = 364
spam score = 67
title = 'anything 2011 springsummer lookbook mashkulture'

distance = 365
spam score = 66
title = 'mashkulture animation'

distance = 426
spam score = 82
title = 'mashkulture category dance'

distance = 431
spam score = 77
title = 'georges le mercenaire 8216animals are kewl iii8217 mashkulture'

distance = 431
spam score = 78
title = 'georges le mercenaire 8216animals are kewl iii8217 mashkulture'

distance = 456
spam score = 55
title = 'powell peralta 2010 fall retro tshirts mashkulture'

distance = 458
spam score = 76
title = 'mashkulture baker skateboards'

distance = 464
spam score = 76
title = 'easter dinners mashkulture'

distance = 465
spam score = 80
title = 'today8217s photograph mashkulture'

distance = 470
spam score = 61
title = 'air jordan vii 8216bordeaux8217 mashkulture'

distance = 473
spam score = 64
title = '2011 listed best sneakers of the year 8211 top 10 mashkulture'

distance = 473
spam score = 75
title = 'a few books i got for christmas mashkulture'

distance = 515
spam score = 72
title = 'polaroid x altru tshirts mashkulture'

distance = 516
spam score = 79
title = 'zoo york 8216harlem bronx brooklyn8217 logo decks mashkulture'

distance = 517
spam score = 83
title = 'original fake for valentine8217s day mashkulture'

distance = 518
spam score = 73
title = 'christmas arrived early today via ups a big thank you to nixon for the gift mashkulture'

distance = 524
spam score = 77
title = 'the art of kris tate mashkulture'

distance = 529
spam score = 76
title = 'monday night beers mashkulture'

distance = 531
spam score = 65
title = 'mashkulture levi8217s'

distance = 531
spam score = 83
title = 'mashkulture andrew wk'

distance = 535
spam score = 84
title = 'mashkulture anti hero'

distance = 538
spam score = 77
title = 'nike huarache free run 8216whitesoarcyber8217 mashkulture'

distance = 756
spam score = 52
title = '2011 listed the best tshirts of the year 8211 top 25 mashkulture'

distance = 799
spam score = 78
title = 'mashkulture martha cooper'

distance = 892
spam score = 68
title = 'nanushka 8211 interview with szandra sndor mashkulture'

distance = 1018
spam score = 69
title = 'mashkulture design'

distance = 1050
spam score = 71
title = 'mashkulture sunglasses'

distance = 174
spam score = 89
title = ''

distance = 180
spam score = 84
title = ''

distance = 180
spam score = 94
title = ''

distance = 191
spam score = 93
title = ''

distance = 195
spam score = 93
title = ''

distance = 203
spam score = 92
title = ''

distance = 204
spam score = 96
title = ''

distance = 210
spam score = 90
title = ''

distance = 212
spam score = 92
title = ''

distance = 214
spam score = 90
title = ''

distance = 215
spam score = 96
title = ''

distance = 223
spam score = 89
title = ''

distance = 259
spam score = 85
title = ''

distance = 261
spam score = 84
title = ''

distance = 263
spam score = 84
title = ''

distance = 267
spam score = 93
title = ''

distance = 268
spam score = 81
title = ''

distance = 276
spam score = 80
title = ''

distance = 276
spam score = 81
title = ''

distance = 278
spam score = 84
title = ''

distance = 285
spam score = 85
title = ''

distance = 285
spam score = 80
title = ''

distance = 287
spam score = 80
title = ''

distance = 287
spam score = 80
title = ''

distance = 294
spam score = 85
title = ''

distance = 297
spam score = 85
title = ''

distance = 302
spam score = 89
title = ''

distance = 311
spam score = 90
title = ''

distance = 311
spam score = 85
title = ''

distance = 317
spam score = 89
title = ''

distance = 321
spam score = 92
title = ''

distance = 334
spam score = 84
title = ''

distance = 341
spam score = 91
title = ''

distance = 348
spam score = 90
title = ''

distance = 352
spam score = 89
title = ''

distance = 353
spam score = 90
title = ''

distance = 353
spam score = 90
title = ''

distance = 355
spam score = 89
title = ''

distance = 360
spam score = 89
title = ''

distance = 368
spam score = 91
title = ''

distance = 368
spam score = 90
title = ''

distance = 371
spam score = 85
title = ''

distance = 387
spam score = 92
title = ''

distance = 389
spam score = 91
title = ''

distance = 389
spam score = 91
title = ''

distance = 398
spam score = 94
title = ''

distance = 399
spam score = 91
title = ''

distance = 406
spam score = 66
title = ''

distance = 410
spam score = 91
title = ''

distance = 412
spam score = 90
title = ''

distance = 435
spam score = 96
title = ''

distance = 442
spam score = 87
title = ''

distance = 489
spam score = 58
title = ''

distance = 510
spam score = 95
title = ''

distance = 511
spam score = 94
title = ''

distance = 549
spam score = 95
title = ''

distance = 551
spam score = 94
title = ''

distance = 552
spam score = 94
title = ''

distance = 557
spam score = 94
title = ''

distance = 653
spam score = 95
title = ''

distance = 30
spam score = 51
title = 'domenico prattichizzo amp sirslab039s folks blog raquo what is it'

distance = 72
spam score = 48
title = 'domenico prattichizzo amp sirslab039s folks blog raquo playing for change'

distance = 98
spam score = 45
title = 'domenico prattichizzo amp sirslab039s folks blog raquo latex a complete reference page'

distance = 100
spam score = 46
title = 'domenico prattichizzo amp sirslab039s folks blog raquo how to write for the web'

distance = 103
spam score = 48
title = 'domenico prattichizzo amp sirslab039s folks blog raquo sirslab on youtube'

distance = 105
spam score = 41
title = 'domenico prattichizzo amp sirslab039s folks blog raquo kids and robotic humanoids'

distance = 107
spam score = 44
title = 'domenico prattichizzo amp sirslab039s folks blog raquo procrastination'

distance = 116
spam score = 44
title = 'domenico prattichizzo amp sirslab039s folks blog raquo robot teachers'

distance = 118
spam score = 49
title = 'domenico prattichizzo amp sirslab039s folks blog raquo design museum'

distance = 121
spam score = 49
title = 'domenico prattichizzo amp sirslab039s folks blog raquo a new facebook fan page'

distance = 122
spam score = 53
title = 'domenico prattichizzo amp sirslab039s folks blog raquo safety on mac'

distance = 127
spam score = 50
title = 'domenico prattichizzo amp sirslab039s folks blog raquo photos for your slide'

distance = 128
spam score = 40
title = 'domenico prattichizzo amp sirslab039s folks blog raquo robots on bikes'

distance = 131
spam score = 53
title = 'domenico prattichizzo amp sirslab039s folks blog raquo asap in academia'

distance = 132
spam score = 40
title = 'domenico prattichizzo amp sirslab039s folks blog raquo vr and shopping'

distance = 138
spam score = 59
title = 'domenico prattichizzo amp sirslab039s folks blog raquo comics from iran'

distance = 140
spam score = 49
title = 'domenico prattichizzo amp sirslab039s folks blog raquo robotics and art'

distance = 141
spam score = 48
title = 'domenico prattichizzo amp sirslab039s folks blog raquo exoskeleton for everyday use'

distance = 142
spam score = 40
title = 'domenico prattichizzo amp sirslab039s folks blog raquo iphone and lego'

distance = 143
spam score = 46
title = 'domenico prattichizzo amp sirslab039s folks blog raquo students apple'

distance = 202
spam score = 42
title = 'domenico prattichizzo amp sirslab039s folks blog raquo augmented reality with bing'

distance = 205
spam score = 47
title = 'domenico prattichizzo amp sirslab039s folks blog raquo latex fonts problem with leopard'

distance = 206
spam score = 57
title = 'domenico prattichizzo amp sirslab039s folks blog raquo acronyms and abbreviations'

distance = 208
spam score = 41
title = 'domenico prattichizzo amp sirslab039s folks blog raquo traveling with one bag only'

distance = 208
spam score = 46
title = 'domenico prattichizzo amp sirslab039s folks blog raquo apple patents for tablet'

distance = 210
spam score = 43
title = 'domenico prattichizzo amp sirslab039s folks blog raquo 9 webcam jig the new hobbyist'

distance = 210
spam score = 50
title = 'domenico prattichizzo amp sirslab039s folks blog raquo how the brain creates meaning'

distance = 211
spam score = 60
title = 'domenico prattichizzo amp sirslab039s folks blog raquo a nice article on scientific communication'

distance = 211
spam score = 41
title = 'domenico prattichizzo amp sirslab039s folks blog raquo ereaders'

distance = 211
spam score = 45
title = 'domenico prattichizzo amp sirslab039s folks blog raquo an interview with stephen wolfram'

distance = 234
spam score = 45
title = 'domenico prattichizzo amp sirslab039s folks blog raquo multiple iphoto libraries'

distance = 234
spam score = 49
title = 'domenico prattichizzo amp sirslab039s folks blog raquo iowa state universitys humanoid robot'

distance = 234
spam score = 42
title = 'domenico prattichizzo amp sirslab039s folks blog raquo pack your suitcase as efficiently as a flight attendant'

distance = 236
spam score = 44
title = 'domenico prattichizzo amp sirslab039s folks blog raquo a nice video on how students can use a tablet'

distance = 237
spam score = 49
title = 'domenico prattichizzo amp sirslab039s folks blog raquo a nice post on math mac and cooperation'

distance = 239
spam score = 51
title = 'domenico prattichizzo amp sirslab039s folks blog raquo new videos on youtube'

distance = 240
spam score = 42
title = 'domenico prattichizzo amp sirslab039s folks blog raquo on the relevance of good writing for scientists'

distance = 245
spam score = 30
title = 'domenico prattichizzo amp sirslab039s folks blog raquo apple itunes u tops 600 million downloads'

distance = 245
spam score = 46
title = 'domenico prattichizzo amp sirslab039s folks blog raquo a nice screen sharing tool for team work'

distance = 245
spam score = 52
title = 'domenico prattichizzo amp sirslab039s folks blog raquo jonathan ive will receive an honorary doctorate'

distance = 271
spam score = 49
title = 'domenico prattichizzo amp sirslab039s folks blog raquo word count for skim'

distance = 273
spam score = 47
title = 'domenico prattichizzo amp sirslab039s folks blog raquo new book on computer vision by r szeliski'

distance = 273
spam score = 44
title = 'domenico prattichizzo amp sirslab039s folks blog raquo svn su macosx'

distance = 274
spam score = 50
title = 'domenico prattichizzo amp sirslab039s folks blog raquo latex bf wins'

distance = 276
spam score = 52
title = 'domenico prattichizzo amp sirslab039s folks blog raquo ciritorno e ciricette'

distance = 277
spam score = 44
title = 'domenico prattichizzo amp sirslab039s folks blog raquo readmetxt file for group working in svn'

distance = 278
spam score = 40
title = 'domenico prattichizzo amp sirslab039s folks blog raquo the art for digital input methods patent for multitouch and hands'

distance = 278
spam score = 50
title = 'domenico prattichizzo amp sirslab039s folks blog raquo os x how to open folder in a new windows'

distance = 278
spam score = 52
title = 'domenico prattichizzo amp sirslab039s folks blog raquo foto noi e i robot 8211 1 di 15 8211 national geographic'

distance = 278
spam score = 46
title = 'domenico prattichizzo amp sirslab039s folks blog raquo 8220rotation about82178217 or 8220rotation around82178217'

distance = 290
spam score = 50
title = 'domenico prattichizzo amp sirslab039s folks blog raquo applications of robotics in medicine'

distance = 292
spam score = 36
title = 'domenico prattichizzo amp sirslab039s folks blog raquo search'

distance = 294
spam score = 44
title = 'domenico prattichizzo amp sirslab039s folks blog raquo usare al meglio i bookmark di acrobat'

distance = 294
spam score = 32
title = 'domenico prattichizzo amp sirslab039s folks blog raquo font gill sans'

distance = 297
spam score = 29
title = 'domenico prattichizzo amp sirslab039s folks blog raquo svn and latex or other compiled files'

distance = 297
spam score = 47
title = 'domenico prattichizzo amp sirslab039s folks blog raquo steve jobs revelations from a tech giant 8211 cbs news'

distance = 299
spam score = 43
title = 'domenico prattichizzo amp sirslab039s folks blog raquo google wave as a new colloborative research tool'

distance = 299
spam score = 50
title = 'domenico prattichizzo amp sirslab039s folks blog raquo in research the problem is the problem'

distance = 300
spam score = 45
title = 'domenico prattichizzo amp sirslab039s folks blog raquo read it later vs instapaper vs readability'

distance = 300
spam score = 32
title = 'domenico prattichizzo amp sirslab039s folks blog raquo ipad 2 as video conferencing solution 52 tiger'

distance = 326
spam score = 51
title = 'domenico prattichizzo amp sirslab039s folks blog raquo mac os x 107 lion the ars technica review'

distance = 327
spam score = 49
title = 'domenico prattichizzo amp sirslab039s folks blog raquo vuoi diventare un utente mac'

distance = 329
spam score = 51
title = 'domenico prattichizzo amp sirslab039s folks blog raquo latex and pdf synchronization'

distance = 331
spam score = 45
title = 'domenico prattichizzo amp sirslab039s folks blog raquo rodney brooks8217 prophetic talk robots will invade our lives'

distance = 334
spam score = 42
title = 'domenico prattichizzo amp sirslab039s folks blog raquo 6 tips for minimizing cell phone radiation the chart 8211 cnncom blogs'

distance = 335
spam score = 50
title = 'domenico prattichizzo amp sirslab039s folks blog raquo the coffee vs tea infographic lays out each drink8217s benefits sidebyside'

distance = 335
spam score = 44
title = 'domenico prattichizzo amp sirslab039s folks blog raquo cloud computing'

distance = 348
spam score = 35
title = 'domenico prattichizzo amp sirslab039s folks blog raquo how to delete or archive attachments in apple mail and free up disk space'

distance = 348
spam score = 47
title = 'domenico prattichizzo amp sirslab039s folks blog raquo subscribe via email'

distance = 351
spam score = 48
title = 'domenico prattichizzo amp sirslab039s folks blog raquo latex sigma in bold face'

distance = 373
spam score = 53
title = 'domenico prattichizzo amp sirslab039s folks blog raquo dpseminarsty a style file to write slide in latex 2e'

distance = 375
spam score = 44
title = 'domenico prattichizzo amp sirslab039s folks blog raquo some notes on writing scientific documents'

distance = 379
spam score = 41
title = 'domenico prattichizzo amp sirslab039s folks blog raquo transhumanism in opera mit professor creates robotic opera singularity hub'

distance = 380
spam score = 43
title = 'domenico prattichizzo amp sirslab039s folks blog raquo indiscrezioni prezzi iphone 3gs in italia'

distance = 382
spam score = 31
title = 'domenico prattichizzo amp sirslab039s folks blog raquo write day by day to exercise you writing skills in science'

distance = 385
spam score = 33
title = 'domenico prattichizzo amp sirslab039s folks blog raquo dashexpander is an amazing free text expansion tool for mac os x'

distance = 388
spam score = 48
title = 'domenico prattichizzo amp sirslab039s folks blog raquo apple8217s supplychain secret hoard lasers 8211 businessweek'

distance = 391
spam score = 36
title = 'domenico prattichizzo amp sirslab039s folks blog raquo vocre is a free speech translator that instantly translates voice 9to5mac apple intelligence'

distance = 396
spam score = 48
title = 'domenico prattichizzo amp sirslab039s folks blog raquo how to write a lot for the sciences 8211 profhacker 8211 the chronicle of higher education'

distance = 396
spam score = 49
title = 'domenico prattichizzo amp sirslab039s folks blog raquo honda robotics unveils nextgeneration asimo robot 8211 ieee spectrum'

distance = 433
spam score = 40
title = 'domenico prattichizzo amp sirslab039s folks blog raquo gli ebooks fanno litigare biblioteche ed editori 8211 repubblicait'

distance = 433
spam score = 51
title = 'domenico prattichizzo amp sirslab039s folks blog raquo suggestions on how not to mishandle mathematical formul'

distance = 435
spam score = 41
title = 'domenico prattichizzo amp sirslab039s folks blog raquo up next for the ipodfather intelligent thermostat with a click wheel of sorts 9to5mac apple intelligence'

distance = 436
spam score = 45
title = 'domenico prattichizzo amp sirslab039s folks blog raquo le 10 migliori app che supportano airplay ipadevice italia'

distance = 437
spam score = 60
title = 'domenico prattichizzo amp sirslab039s folks blog raquo apple will announce their plans to revolutionize university classrooms later this month rumor cult of mac'

distance = 440
spam score = 53
title = 'domenico prattichizzo amp sirslab039s folks blog raquo libralis 02 is now on line'

distance = 440
spam score = 34
title = 'domenico prattichizzo amp sirslab039s folks blog raquo how to make a quick and dirty emergency usbtocigarette lighter socket'

distance = 444
spam score = 50
title = 'domenico prattichizzo amp sirslab039s folks blog raquo how to learn the basics of digital technology 8211 profhacker 8211 the chronicle of higher education'

distance = 447
spam score = 36
title = 'domenico prattichizzo amp sirslab039s folks blog raquo cisco8217s umi and telepresence video calling systems now with work at home and home at work 8212 engadget'

distance = 451
spam score = 44
title = 'domenico prattichizzo amp sirslab039s folks blog raquo mac compatible webcam list best web cameras for apple osx'

distance = 532
spam score = 53
title = 'domenico prattichizzo amp sirslab039s folks blog raquo the robotic vision haptic virtual reality group sirslab in siena'

distance = 539
spam score = 42
title = 'domenico prattichizzo amp sirslab039s folks blog raquo use outlines and paragraph titles to write your paper'

distance = 540
spam score = 45
title = 'domenico prattichizzo amp sirslab039s folks blog raquo fromto latex tofrom all other formats with pandoc'

distance = 553
spam score = 50
title = 'domenico prattichizzo amp sirslab039s folks blog raquo how to insert a latex formula in inkscape'

distance = 563
spam score = 51
title = 'domenico prattichizzo amp sirslab039s folks blog raquo tips for sharing your latex source files'

distance = 567
spam score = 61
title = 'domenico prattichizzo amp sirslab039s folks blog raquo new ieee ram8217s youtube channel'

distance = 571
spam score = 54
title = 'domenico prattichizzo amp sirslab039s folks blog raquo improving your english language knowledge'

distance = 584
spam score = 30
title = 'domenico prattichizzo amp sirslab039s folks blog raquo darpa8217s 8216avatar project8217 aims to give soldiers surrogate robots make james cameron proud 8212 engadget'

distance = 584
spam score = 32
title = 'domenico prattichizzo amp sirslab039s folks blog raquo darpa8217s 8216avatar project8217 aims to give soldiers surrogate robots make james cameron proud 8212 engadget'

distance = 587
spam score = 38
title = 'domenico prattichizzo amp sirslab039s folks blog raquo realt virtuale una stanza ad immersione totale permette di interagire in 3d con oggetti ed ambienti'

distance = 999
spam score = 42
title = 'domenico prattichizzo amp sirslab039s folks blog raquo use a batch or script file to do complex operations like compiling a latex file in macosx'

distance = 13
spam score = 31
title = '1507672304f76b3c6922b laquo the classy geek'

distance = 17
spam score = 34
title = 'positivity laquo the classy geek'

distance = 29
spam score = 26
title = 'packinglight laquo the classy geek'

distance = 32
spam score = 29
title = 'itcrowdseasons13 laquo the classy geek'

distance = 33
spam score = 35
title = 'img20110105212709 laquo the classy geek'

distance = 34
spam score = 29
title = 'carryonbags laquo the classy geek'

distance = 34
spam score = 30
title = 'pandoracovers laquo the classy geek'

distance = 34
spam score = 35
title = '31daybillorganizer laquo the classy geek'

distance = 34
spam score = 39
title = 'multiplemonitors laquo the classy geek'

distance = 34
spam score = 36
title = 'masseffect2 laquo the classy geek'

distance = 36
spam score = 30
title = 'blackmenssuit laquo the classy geek'

distance = 37
spam score = 33
title = 'itcrowddvd laquo the classy geek'

distance = 38
spam score = 30
title = 'externalharddrive laquo the classy geek'

distance = 39
spam score = 40
title = 'glassesnoframe laquo the classy geek'

distance = 39
spam score = 33
title = 'battleladies laquo the classy geek'

distance = 39
spam score = 29
title = 'airlinecabin laquo the classy geek'

distance = 39
spam score = 33
title = 'rolledmensties laquo the classy geek'

distance = 40
spam score = 32
title = 'whiskeystones laquo the classy geek'

distance = 40
spam score = 37
title = 'grammarpolice laquo the classy geek'

distance = 41
spam score = 38
title = '500xtowsonuniversity laquo the classy geek'

distance = 55
spam score = 33
title = 'aboutmeservices laquo the classy geek'

distance = 55
spam score = 31
title = 'appletimemachine laquo the classy geek'

distance = 56
spam score = 29
title = 'amazonkindle3hand laquo the classy geek'

distance = 56
spam score = 35
title = 'pilsnerglasses laquo the classy geek'

distance = 57
spam score = 34
title = 'twitterbutton laquo the classy geek'

distance = 58
spam score = 32
title = 'rdioalbums laquo the classy geek'

distance = 58
spam score = 30
title = 'wowwedding laquo the classy geek'

distance = 59
spam score = 34
title = 'largeredwineglass laquo the classy geek'

distance = 60
spam score = 30
title = 'htpc open case laquo the classy geek'

distance = 60
spam score = 37
title = 'helpjapan2designcrush laquo the classy geek'

distance = 65
spam score = 31
title = 'couplecouchlounging laquo the classy geek'

distance = 65
spam score = 36
title = 'hendricksgin laquo the classy geek'

distance = 65
spam score = 32
title = 'boogieboardlcd laquo the classy geek'

distance = 65
spam score = 29
title = 'cataclysmwallpaper1920x1200 laquo the classy geek'

distance = 65
spam score = 28
title = 'ikeaexpedit laquo the classy geek'

distance = 66
spam score = 37
title = 'gourmetdesignerchocolates laquo the classy geek'

distance = 67
spam score = 32
title = 'koronewaterbottle laquo the classy geek'

distance = 67
spam score = 34
title = 'facebookbutton laquo the classy geek'

distance = 68
spam score = 29
title = 'cybercleanputty laquo the classy geek'

distance = 69
spam score = 30
title = 'xbox360kinect laquo the classy geek'

distance = 72
spam score = 32
title = 'applemacperforma6400gp laquo the classy geek'

distance = 73
spam score = 31
title = 'blackpowerbooklombard laquo the classy geek'

distance = 73
spam score = 32
title = 'riedelsommeliercollection laquo the classy geek'

distance = 73
spam score = 36
title = 'microfibercloseup laquo the classy geek'

distance = 74
spam score = 33
title = 'wineglassesbottle laquo the classy geek'

distance = 75
spam score = 34
title = 'riedelburgundyredglass laquo the classy geek'

distance = 76
spam score = 30
title = 'blackwingtipshoes laquo the classy geek'

distance = 77
spam score = 27
title = 'thumbplayblackberry laquo the classy geek'

distance = 77
spam score = 35
title = 'wiredsaddestcubicles laquo the classy geek'

distance = 78
spam score = 33
title = 'wordpresslogolensflare laquo the classy geek'

distance = 83
spam score = 34
title = 'eclipselitetouchkeyboard laquo the classy geek'

distance = 84
spam score = 36
title = 'gear4unityuniversalremote laquo the classy geek'

distance = 84
spam score = 28
title = 'zunepassbanner laquo the classy geek'

distance = 85
spam score = 31
title = 'iphone4facetime laquo the classy geek'

distance = 85
spam score = 40
title = 'kensingtoncirclesurgeprotector laquo the classy geek'

distance = 85
spam score = 30
title = 'barnesandnoblenookcolor laquo the classy geek'

distance = 85
spam score = 34
title = 'startrekenterprisepizzacutter laquo the classy geek'

distance = 88
spam score = 30
title = 'skullhubusbhub laquo the classy geek'

distance = 88
spam score = 34
title = 'paranoiaagentshonenbat laquo the classy geek'

distance = 89
spam score = 33
title = 'samsungfascinatevzw laquo the classy geek'

distance = 94
spam score = 31
title = 'thinkgeekbuckyballs laquo the classy geek'

distance = 95
spam score = 35
title = 'booqmambacatch laquo the classy geek'

distance = 95
spam score = 32
title = 'thinkgeekledartcube laquo the classy geek'

distance = 95
spam score = 33
title = 'aboutmeblogfeed laquo the classy geek'

distance = 95
spam score = 35
title = 'whiffroastersbox laquo the classy geek'

distance = 96
spam score = 35
title = 'casualfamilydinnercarvingthanksgivingturkeypinksherbet laquo the classy geek'

distance = 97
spam score = 31
title = 'pogosketchipad laquo the classy geek'

distance = 100
spam score = 35
title = 'dodocaseipadcase laquo the classy geek'

distance = 100
spam score = 30
title = 'kickstandipadholder laquo the classy geek'

distance = 100
spam score = 32
title = 'thinkgeeklovepotions laquo the classy geek'

distance = 111
spam score = 39
title = 'belgiantulipbeerglassdavidjensenbeer47 laquo the classy geek'

distance = 113
spam score = 35
title = 'visualizationfacebookworldofrelationships laquo the classy geek'

distance = 114
spam score = 27
title = 'coditsafriendlylaptopbag laquo the classy geek'

distance = 114
spam score = 33
title = 'clamcaseipadcase laquo the classy geek'

distance = 114
spam score = 36
title = 'humanandzombiebloodcaffeinatedenergypotion laquo the classy geek'

distance = 123
spam score = 32
title = 'mrbentostainlesslunchjars laquo the classy geek'

distance = 124
spam score = 35
title = 'wallmountdisplayflickruserwilllisac laquo the classy geek'

distance = 125
spam score = 31
title = 'piratejollyrogerflask laquo the classy geek'

distance = 125
spam score = 30
title = 'iphoneundmotorolamilestonedroid laquo the classy geek'

distance = 126
spam score = 35
title = 'alfabeerglassesperceptivetravel laquo the classy geek'

distance = 145
spam score = 39
title = 'creativeaurvanaxfinoisecancellingheadphones laquo the classy geek'

distance = 152
spam score = 36
title = 'officedesksetupflickrusernightrpstar laquo the classy geek'

distance = 157
spam score = 39
title = 'emptycomputerdeskflickruserstephenedmonds laquo the classy geek'

distance = 186
spam score = 53
title = 'contact laquo the classy geek'

distance = 255
spam score = 25
title = 'stop sopa and pipa laquo the classy geek'

distance = 324
spam score = 29
title = 'wondering where the classy geek went here8217s a clue8230 laquo the classy geek'

distance = 373
spam score = 12
title = 'the classy geek goes to ces laquo the classy geek'

distance = 387
spam score = 32
title = 'the classy geek is officially onboard at lifehacker laquo the classy geek'

distance = 395
spam score = 33
title = 'ask the classy geek laquo the classy geek'

distance = 397
spam score = 38
title = 'ask the classy geek laquo the classy geek'

distance = 536
spam score = 23
title = 'class up your apartment with the uncommon green laquo the classy geek'

distance = 543
spam score = 15
title = 'classy quickie 8211 grilled cheese made great laquo the classy geek'

distance = 580
spam score = 22
title = 'do your part to help japan laquo the classy geek'

distance = 611
spam score = 9
title = '5 simple knife safety tips for the kitchen laquo the classy geek'

distance = 635
spam score = 36
title = 'classy quickie cooking the perfect turkey laquo the classy geek'

distance = 658
spam score = 16
title = 'how to make your own homemade condiments laquo the classy geek'

distance = 679
spam score = 14
title = 'the proper way to press and fold a dress shirt laquo the classy geek'

distance = 681
spam score = 24
title = 'make a greek frappe coffee in less than 5 minutes laquo the classy geek'

distance = 740
spam score = 22
title = 'how to perfect your french press technique laquo the classy geek'

distance = 746
spam score = 26
title = 'make your own baconinfused old fashioned laquo the classy geek'

distance = 959
spam score = 10
title = 'musthave bar essentials 8211 part 2 essential mixers laquo the classy geek'

distance = 961
spam score = 6
title = 'what does your first anime say about you laquo the classy geek'

distance = 988
spam score = 5
title = 'essential whisky facts everyone should know laquo the classy geek'

distance = 1036
spam score = 18
title = 'think different laquo the classy geek'

distance = 1036
spam score = 51
title = 'chelpixie why you should stop using your inbox as a to do list laquo the classy geek'

distance = 1044
spam score = 6
title = 'classy gear 8211 gear we like october 2010 laquo the classy geek'

distance = 1888
spam score = 72
title = 'more things japanese raquo ancient tales of yomitan village'

distance = 129
spam score = 87
title = 'kevin rossiters double sighted rossiter and co'

distance = 134
spam score = 89
title = 'rossiter and co q a a quick guide rossiter and co'

distance = 134
spam score = 90
title = 'latest video video shorts for sykes air conditioning rossiter and co'

distance = 135
spam score = 86
title = 'conference presentation ideas needed in 2 weeks rossiter and co'

distance = 136
spam score = 90
title = 'interviews123 new web video production rossiter and co'

distance = 137
spam score = 85
title = 'should i use a video presentation for my conference rossiter and co'

distance = 141
spam score = 85
title = 'multinational company looking for corporate video rossiter and co'

distance = 141
spam score = 87
title = 'can you produce overseas rossiter and co'

distance = 141
spam score = 83
title = 'video for exhibition or not or not rossiter and co'

distance = 142
spam score = 87
title = 'an idea for an instructional video rossiter and co'

distance = 143
spam score = 87
title = 'training video for tires rossiter and co'

distance = 143
spam score = 87
title = 'corporate video for waste management provider rossiter and co'

distance = 145
spam score = 86
title = 'local authority frightened by high cost of video rossiter and co'

distance = 145
spam score = 84
title = 'use a professional presenter and enhance your web video rossiter and co'

distance = 147
spam score = 90
title = 'interactive induction dvd please rossiter and co'

distance = 149
spam score = 88
title = 'happy new year to all our corporate multimedia video web visitors rossiter and co'

distance = 149
spam score = 88
title = 'winning a construction grant with dvd rossiter and co'

distance = 149
spam score = 87
title = 'mini corporate video new product rossiter and co'

distance = 150
spam score = 87
title = 'free training video production handbook out today rossiter and co'

distance = 150
spam score = 71
title = 'rossiter and co'

distance = 209
spam score = 88
title = 'managed services provider needs bid support multimedia rossiter and co'

distance = 209
spam score = 88
title = '5 ways safety video can reduce compensation claims rossiter and co'

distance = 209
spam score = 86
title = 'filming the ceo for an international group rossiter and co'

distance = 209
spam score = 92
title = 'understanding the value of interactive video training rossiter and co'

distance = 209
spam score = 85
title = 'custom manual handling dvd for our workforce rossiter and co'

distance = 209
spam score = 90
title = 'home health safety resources rossiter and co'

distance = 209
spam score = 85
title = '5 ways safety video can reduce claims rossiter and co'

distance = 210
spam score = 81
title = 'video play button rossiter and co'

distance = 210
spam score = 89
title = 'can i have a video where i provide the stills text and music rossiter and co'

distance = 210
spam score = 87
title = 'shooting the ceo rossiter and co'

distance = 226
spam score = 88
title = 'do i need flash or multimedia for my presentation rossiter and co'

distance = 226
spam score = 89
title = 'helpful tips for shooting a chief executive video production rossiter and co'

distance = 226
spam score = 85
title = 'producing simulated newscasts rossiter and co'

distance = 226
spam score = 89
title = 'increasing online sales with video for accountancy practice rossiter and co'

distance = 227
spam score = 94
title = 'using our fm engineers to sell our company rossiter and co'

distance = 227
spam score = 88
title = 'corporate dvd costs for a school rossiter and co'

distance = 228
spam score = 90
title = 'awards winner interactive media project of the year rossiter and co'

distance = 228
spam score = 93
title = 'online safety video for retailers elearning package rossiter and co'

distance = 229
spam score = 85
title = 'induction dvd interactive tool to assist with training rossiter and co'

distance = 229
spam score = 89
title = 'new media components video rossiter and co'

distance = 245
spam score = 89
title = 'increasing sales leads for software provider part 2 rossiter and co'

distance = 246
spam score = 87
title = 'should i use a freelancer or a video company for my web video rossiter and co'

distance = 246
spam score = 75
title = 'video production costs can be cut 50 percent rossiter and co'

distance = 246
spam score = 89
title = 'tip 6 how video seo will increase your business enquiries rossiter and co'

distance = 246
spam score = 86
title = '3 london constructor wants advice on marketing package rossiter and co'

distance = 246
spam score = 84
title = 'web video production to revitalise home page rossiter and co'

distance = 247
spam score = 83
title = '10 web video statistics you need to know rossiter and co'

distance = 247
spam score = 84
title = 'outsourcing video services through a lead agency rossiter and co'

distance = 247
spam score = 88
title = 'intranet video streamed to workforce rossiter and co'

distance = 247
spam score = 75
title = 'animation the designer amp corporate end user rossiter and co'

distance = 262
spam score = 83
title = 'interactive training multimedia tips for managers rossiter and co'

distance = 262
spam score = 74
title = 'foreign language video and multimedia methodology rossiter and co'

distance = 262
spam score = 80
title = 'corporate video producers offer a quote for company presentation rossiter and co'

distance = 262
spam score = 87
title = 'does corporate video work rossiter and co'

distance = 262
spam score = 71
title = 'export video dvd amp stream rossiter and co'

distance = 262
spam score = 74
title = 'seo case study laghan entertainment rossiter and co'

distance = 263
spam score = 78
title = 'video production costs halved first 30 rossiter and co'

distance = 263
spam score = 64
title = 'presenterled video dvd amp stream rossiter and co'

distance = 263
spam score = 80
title = 'corporate video presentations by video production companies rossiter and co'

distance = 263
spam score = 77
title = 'sales presentation by corporate video producers rossiter and co'

distance = 276
spam score = 73
title = 'training video production services rossiter and co'

distance = 276
spam score = 60
title = 'crew for a video production shoot cameraman director rossiter and co'

distance = 277
spam score = 78
title = 'videos by industry rossiter and co'

distance = 277
spam score = 78
title = 'web applications managing information or resources rossiter and co'

distance = 277
spam score = 80
title = 'digital video production by corporate video producers companies rossiter and co'

distance = 277
spam score = 72
title = 'training video production top tip 5 bring it to life with actors presenters and a cast rossiter and co'

distance = 277
spam score = 79
title = 'online video communication rossiter and co'

distance = 277
spam score = 81
title = 'business plan corporate presentations promotional video production to influence potential customers rossiter and co'

distance = 277
spam score = 83
title = 'video multimedia presentations business plan by video production companies rossiter and co'

distance = 277
spam score = 83
title = 'online video producer online videos make your website communicate rossiter and co'

distance = 289
spam score = 80
title = 'corporate amp business video services through professional presentations rossiter and co'

distance = 290
spam score = 83
title = 'promotional video multimedia sales presentations to target your potential audience effectively rossiter and co'

distance = 290
spam score = 91
title = 'how do i get more people to buy at my online store pt 2 rossiter and co'

distance = 290
spam score = 89
title = 'effective web video presentation for a healthcare website rossiter and co'

distance = 291
spam score = 89
title = 'how do i get more people to buy at my online store pt 1 rossiter and co'

distance = 291
spam score = 61
title = 'video script approval rossiter and co'

distance = 291
spam score = 85
title = 'corporate video producers help produce corporate videos rossiter and co'

distance = 291
spam score = 82
title = 'top tips to spot and avoid black hat seo rossiter and co'

distance = 291
spam score = 76
title = 'advanced digital video editing tighter integration with cdrom rossiter and co'

distance = 291
spam score = 79
title = 'mini corporate video rossiter and co'

distance = 312
spam score = 68
title = 'company video glossary rossiter and co'

distance = 312
spam score = 70
title = 'business audiences company video company video audience video production company video producer rossiter and co'

distance = 312
spam score = 79
title = 'business plan presentations with use of video flash solutions rossiter and co'

distance = 312
spam score = 76
title = 'training video production top tip 2 keep them awake rossiter and co'

distance = 313
spam score = 65
title = 'addedvalue vs the great idea rossiter and co'

distance = 313
spam score = 74
title = 'instant impact marketing video rossiter and co'

distance = 313
spam score = 63
title = 'video editing the rough cut and final cut rossiter and co'

distance = 313
spam score = 84
title = 'professional corporate business plan presentation to help your business grow rossiter and co'

distance = 315
spam score = 72
title = 'type of corporate video programme and its cost rossiter and co'

distance = 315
spam score = 77
title = 'corporate video on dvd rossiter and co'

distance = 364
spam score = 78
title = '40 keyword platinum seo pack for significantly improved search rankings rossiter and co'

distance = 364
spam score = 73
title = 'corporate training video production course rossiter and co'

distance = 368
spam score = 87
title = 'prove ppc can deliver sales leads in credit crunch 1 rossiter and co'

distance = 375
spam score = 78
title = '25 keyword silver seo pack for significantly improved search rankings rossiter and co'

distance = 377
spam score = 88
title = 'new media components web microsite rossiter and co'

distance = 378
spam score = 77
title = 'solicitor video production rossiter and co'

distance = 380
spam score = 76
title = 'software video production rossiter and co'

distance = 383
spam score = 73
title = 'corporate video training examples rossiter and co'

distance = 393
spam score = 58
title = 'ask questions to potential company video production companies rossiter and co'

distance = 398
spam score = 77
title = 'conference presentations rossiter and co'

distance = 1382
spam score = 66
title = 'tates bake shop congratulations'

distance = 1386
spam score = 23
title = 'ghana laquo adventure trip'

distance = 1398
spam score = 28
title = 'polar regions laquo adventure trip'

distance = 1401
spam score = 11
title = 'dna evidence twisted minds a website about serial killers'

distance = 1430
spam score = 74
title = 'tates bake shop high tea or coffee break you choose'

distance = 1431
spam score = 74
title = 'tates bake shop high tea or coffee break you choose'

distance = 1440
spam score = 73
title = 'phorum 2012 cloud computing conference phorum philly'

distance = 1452
spam score = 77
title = 'phorum 2012 cloud computing conference phorum philly'

distance = 1742
spam score = 66
title = 'about sharon the resurrection of nat turner sharon ewell foster'

distance = 70
spam score = 83
title = 'beyond blood aptn national news'

distance = 80
spam score = 82
title = 'december 16th 8211 part 1 aptn national news'

distance = 80
spam score = 83
title = 'aptn investigates promo aptn national news'

distance = 88
spam score = 82
title = 'aptn investigates promo aptn national news'

distance = 90
spam score = 84
title = 'december 16th 8211 part 2 aptn national news'

distance = 91
spam score = 84
title = 'infocus february 18 part 1 aptn national news'

distance = 99
spam score = 78
title = 'to russia with buffaloes aptn national news'

distance = 104
spam score = 84
title = 'infocus february 18 part 2 aptn national news'

distance = 105
spam score = 73
title = 'aiming straight as an arrow aptn national news'

distance = 106
spam score = 80
title = 'what8217s a mother to do part 2 aptn national news'

distance = 110
spam score = 79
title = 'what8217s a mother to do part 1 aptn national news'

distance = 119
spam score = 82
title = 'aptn national news broadcast may 30 aptn national news'

distance = 123
spam score = 84
title = 'learning to sing 8216o canada8217 in cree aptn national news'

distance = 124
spam score = 80
title = 'first nations in manitoba battle the flood aptn national news'

distance = 124
spam score = 84
title = 'election 2011 promo aptn national news'

distance = 135
spam score = 76
title = 'nunavut8217s blazing blades aptn national news'

distance = 137
spam score = 84
title = 'civilized to death 8212 part 2 aptn national news'

distance = 138
spam score = 82
title = 'headliners unveiled for aboriginal music week aptn national news'

distance = 140
spam score = 80
title = 'locked up for life part 1 aptn national news'

distance = 142
spam score = 79
title = 'locked up for life part 2 aptn national news'

distance = 172
spam score = 81
title = 'nimby nukes in my back yard 8211 part 2 aptn national news'

distance = 172
spam score = 81
title = 'ottawa mohawk part 1 aptn national news'

distance = 173
spam score = 84
title = 'stick pull aptn national news'

distance = 173
spam score = 80
title = 'april 27th youth panel promo aptn national news'

distance = 173
spam score = 82
title = 'meet nick and megan aptn national news'

distance = 174
spam score = 79
title = 'ottawa manitoba step in to help flood ravaged communities aptn national news'

distance = 175
spam score = 78
title = 'robbie robertson and his 8216right mistake8217 aptn national news'

distance = 176
spam score = 86
title = 'greenland comes to iqaluit8217s aid after deadly blaze aptn national news'

distance = 176
spam score = 82
title = 'residential school lawyers 8211 part 3 aptn national news'

distance = 177
spam score = 82
title = 'aptn investigates iap follow up promo aptn national news'

distance = 191
spam score = 75
title = 'saskatoon police seek information after man found in ditch aptn national news'

distance = 192
spam score = 80
title = 'edmonton centre in the spotlight aptn national news'

distance = 195
spam score = 80
title = 'police suspect gang link in saskatoon murder aptn national news'

distance = 195
spam score = 82
title = 'vancouver cop had pickton 8220in my sights8221 aptn national news'

distance = 196
spam score = 84
title = 'shut down insite and people will die experts aptn national news'

distance = 196
spam score = 77
title = 'rcmp recommends charges against officer over alleged assault on teen aptn national news'

distance = 196
spam score = 80
title = 'breaking colonialism8217s bonds aptn national news'

distance = 198
spam score = 84
title = 'ottawa bureaucrats find new ways of erasing their trail documents suggest aptn national news'

distance = 199
spam score = 82
title = 'election 2011 youth panel aptn national news'

distance = 199
spam score = 82
title = 'cap overcoming obstacles says national chief aptn national news'

distance = 213
spam score = 81
title = 'aboriginal affairs department official made request for 8220illegal8221 deletion of emails expert aptn national news'

distance = 214
spam score = 76
title = 'hockey fight punishment raises questions of racism says kahnawake chief aptn national news'

distance = 216
spam score = 82
title = 'nunavut government facing heat over housing corp red ink aptn national news'

distance = 216
spam score = 84
title = 'nick and megan at the dene games hand games aptn national news'

distance = 217
spam score = 86
title = 'police gather in iqaluit to tackle crime aptn national news'

distance = 218
spam score = 74
title = 'indian affairs failing onreserve kids sheila fraser aptn national news'

distance = 219
spam score = 79
title = 'kanesetake drug bust a bust say residents aptn national news'

distance = 219
spam score = 80
title = 'starlight tours go largely unreported expert aptn national news'

distance = 221
spam score = 80
title = 'ottawa8217s first nation water plan lacks cash critics aptn national news'

distance = 221
spam score = 86
title = 'the snow sculptures of whitehorse aptn national news'

distance = 237
spam score = 81
title = 'drums and misdirection at the dene hand games aptn national news'

distance = 237
spam score = 80
title = 'more dene games with megan jensen aptn national news'

distance = 238
spam score = 79
title = 'elder outraged over caribou 8220slaughter8221 aptn national news'

distance = 241
spam score = 81
title = 'atleo preaches jobs education in regina aptn national news'

distance = 241
spam score = 83
title = 'blood tribe member vows to fight charges over antifracking protest aptn national news'

distance = 244
spam score = 77
title = 'tweeting nunavut aptn national news'

distance = 244
spam score = 84
title = 'aboriginal leaders receive diamond jubilee medals aptn national news'

distance = 245
spam score = 83
title = 'awg 2012 opens with a burst of colour music aptn national news'

distance = 245
spam score = 83
title = 'a new policy for dealing with sex trade workers aptn national news'

distance = 246
spam score = 78
title = 'reviving indigenous languages at the touch of a button aptn national news'

distance = 259
spam score = 83
title = 'a meeting of cultures as akwesasne hosts 8216medicine games8217 aptn national news'

distance = 259
spam score = 81
title = 'whitehorse area residents worry about plans for fracking operations aptn national news'

distance = 259
spam score = 80
title = 'yukon rcmp cleared of brutality allegations aptn national news'

distance = 259
spam score = 87
title = 'quebec tuition fee hikes will impact access for aboriginal students aptn national news'

distance = 262
spam score = 77
title = 'mother of 2 booted by ottawa housing corp over child tax benefit aptn national news'

distance = 267
spam score = 80
title = 'time for national suicide strategy duncan aptn national news'

distance = 267
spam score = 79
title = 'lakota block trucks carrying keystone xl equipment aptn national news'

distance = 269
spam score = 85
title = 'atleo 8220our children can8217t wait any longer8221 aptn national news'

distance = 269
spam score = 83
title = 'iap investigation follow up 8211 part 1 aptn national news'

distance = 269
spam score = 72
title = 'commonlaw husband not guilty in toddler8217s death aptn national news'

distance = 291
spam score = 79
title = 'as rcmp officers lawyer up families of pickton8217s victims express frustration aptn national news'

distance = 294
spam score = 83
title = 'team nunavut unveils flashy new uniforms aptn national news'

distance = 294
spam score = 84
title = 'sisters in spirit champion tolley honoured with award aptn national news'

distance = 295
spam score = 76
title = '8216first nations people still lack what most other canadians take for granted8217 aptn national news'

distance = 296
spam score = 87
title = '8220they make promises and can8217t fulfull them8221 aptn national news'

distance = 296
spam score = 83
title = 'lubicon youth turn to youtube in hopes public will 8220imagine8221 living through oil spill aptn national news'

distance = 297
spam score = 81
title = 'mother recounts horrific details of daughter8217s fate at pickton8217s hands aptn national news'

distance = 298
spam score = 81
title = 'search continues for mildred flett aptn national news'

distance = 299
spam score = 78
title = 'vancouver police deputy chief tells pickton inquiry things getting better aptn national news'

distance = 301
spam score = 82
title = 'indigenous journalists share their stories in norway aptn national news'

distance = 342
spam score = 82
title = 'water bill the product of consultation rickford aptn national news'

distance = 344
spam score = 81
title = 'taseko tries again showdown looms aptn national news'

distance = 349
spam score = 78
title = 'trc commissioner changes tune on residential schools as genocide aptn national news'

distance = 363
spam score = 77
title = 'controversial police clerk faces tough questions over handling of missing women calls aptn national news'

distance = 363
spam score = 84
title = 'kanesatake grand chief refuses salary aptn national news'

distance = 367
spam score = 90
title = 'manitoba grand chief visits israel aptn national news'

distance = 376
spam score = 77
title = 'all sides await federal court decision on fn child welfare case aptn national news'

distance = 381
spam score = 83
title = 'atleo beach call for action on housing water in manitoba aptn national news'

distance = 382
spam score = 79
title = 'missing women inquiry hears of pickton records destroyed aptn national news'

distance = 382
spam score = 88
title = 'aptn national news send your comments'

distance = 543
spam score = 79
title = 'minister duncan will work with nelson if ojibway leader elected afn chief aptn national news'

distance = 557
spam score = 72
title = 'mohawk woman taking her place among the saints aptn national news'

distance = 559
spam score = 82
title = 'time to taima tb in iqaluit aptn national news'

distance = 567
spam score = 94
title = 'aptn national news about aptn investigates'

distance = 572
spam score = 82
title = 'manitoba raids dakota smoke shop seizes mohawk cigs aptn national news'

distance = 587
spam score = 94
title = 'aptn national news about aptn infocus'

distance = 591
spam score = 81
title = 'governing conservatives 8216don8217t know8217 tar sands 8216impact8217 on water caribou forests watchdog aptn national news'

distance = 614
spam score = 89
title = 'incumbent bloc candidate sorry for saying ndp opponent8217s cree ancestry a weakness aptn national news'

distance = 619
spam score = 74
title = 'british opposed canadian8217s nomination to top nato military post us diplomatic cables aptn national news'

distance = 625
spam score = 90
title = 'iran considering bringing first nations leaders to tehran diplomat aptn national news'

distance = 863
spam score = 60
title = 'former harper advisor had deal with escort for first nations water contracts document aptn national news'

distance = 900
spam score = 77
title = 'opp investigating water company once linked to bruce carson aptn national news'

distance = 998
spam score = 90
title = 'former ojibway chief nelson seeks muslim support announces candidacy for top afn chief in mosque aptn national news'

distance = 998
spam score = 57
title = 'rcmp8217s bruce carson investigation probes contract with former escort calgary thinktank emails aptn national news'

distance = 1067
spam score = 83
title = 'carson eyed role for enviro min kent to land water deals aptn national news'

distance = 1807
spam score = 91
title = 'contribution of microbial and invertebrate communities to leaf litter colonization in a mediterranean stream'

distance = 34
spam score = 59
title = ''

distance = 41
spam score = 58
title = ''

distance = 44
spam score = 53
title = ''

distance = 44
spam score = 53
title = ''

distance = 46
spam score = 57
title = ''

distance = 47
spam score = 61
title = ''

distance = 50
spam score = 57
title = ''

distance = 51
spam score = 59
title = ''

distance = 52
spam score = 58
title = ''

distance = 53
spam score = 57
title = ''

distance = 53
spam score = 58
title = ''

distance = 55
spam score = 55
title = ''

distance = 57
spam score = 58
title = ''

distance = 58
spam score = 58
title = ''

distance = 58
spam score = 59
title = ''

distance = 58
spam score = 55
title = ''

distance = 58
spam score = 58
title = ''

distance = 61
spam score = 58
title = ''

distance = 65
spam score = 55
title = ''

distance = 67
spam score = 58
title = ''

distance = 71
spam score = 59
title = ''

distance = 76
spam score = 58
title = ''

distance = 87
spam score = 56
title = ''

distance = 88
spam score = 60
title = ''

distance = 91
spam score = 59
title = ''

distance = 91
spam score = 58
title = ''

distance = 94
spam score = 59
title = ''

distance = 96
spam score = 58
title = ''

distance = 99
spam score = 56
title = ''

distance = 99
spam score = 57
title = ''

distance = 150
spam score = 69
title = ''

distance = 214
spam score = 41
title = ''

distance = 216
spam score = 74
title = ''

distance = 225
spam score = 65
title = ''

distance = 228
spam score = 54
title = ''

distance = 231
spam score = 60
title = ''

distance = 239
spam score = 63
title = ''

distance = 245
spam score = 23
title = ''

distance = 252
spam score = 61
title = ''

distance = 271
spam score = 52
title = ''

distance = 273
spam score = 73
title = ''

distance = 275
spam score = 61
title = ''

distance = 278
spam score = 67
title = ''

distance = 281
spam score = 65
title = ''

distance = 302
spam score = 30
title = ''

distance = 306
spam score = 61
title = ''

distance = 329
spam score = 46
title = ''

distance = 336
spam score = 75
title = ''

distance = 341
spam score = 58
title = ''

distance = 349
spam score = 53
title = ''

distance = 349
spam score = 68
title = ''

distance = 351
spam score = 80
title = ''

distance = 369
spam score = 54
title = ''

distance = 380
spam score = 59
title = ''

distance = 391
spam score = 27
title = ''

distance = 409
spam score = 64
title = ''

distance = 410
spam score = 67
title = ''

distance = 436
spam score = 61
title = ''

distance = 440
spam score = 62
title = ''

distance = 449
spam score = 78
title = ''

distance = 449
spam score = 63
title = ''

distance = 453
spam score = 52
title = ''

distance = 454
spam score = 64
title = ''

distance = 457
spam score = 66
title = ''

distance = 458
spam score = 56
title = ''

distance = 458
spam score = 52
title = ''

distance = 459
spam score = 43
title = ''

distance = 460
spam score = 53
title = ''

distance = 479
spam score = 40
title = ''

distance = 482
spam score = 56
title = ''

distance = 509
spam score = 65
title = ''

distance = 513
spam score = 70
title = ''

distance = 515
spam score = 55
title = ''

distance = 547
spam score = 50
title = ''

distance = 547
spam score = 68
title = ''

distance = 581
spam score = 54
title = ''

distance = 641
spam score = 53
title = ''

distance = 651
spam score = 44
title = ''

distance = 661
spam score = 64
title = ''

distance = 664
spam score = 51
title = ''

distance = 671
spam score = 42
title = ''

distance = 685
spam score = 37
title = ''

distance = 715
spam score = 39
title = ''

distance = 715
spam score = 55
title = ''

distance = 726
spam score = 57
title = ''

distance = 782
spam score = 48
title = ''

distance = 794
spam score = 59
title = ''

distance = 100
spam score = 44
title = 'eagle idaho homes for sale just listed boise real estate blog'

distance = 100
spam score = 63
title = 'community tours boise real estate blog'

distance = 101
spam score = 56
title = 'boise real estate 2011 was a good year boise real estate blog'

distance = 119
spam score = 36
title = 'fall color brookwood subdivision in eagle idaho boise real estate blog'

distance = 120
spam score = 51
title = 'boises incredible greenbelt part ii boise real estate blog'

distance = 121
spam score = 52
title = 'night and day boise vs cleveland boise real estate blog'

distance = 135
spam score = 50
title = 'reform coming for loan servicing boise real estate blog'

distance = 140
spam score = 45
title = 'boise real estate 2010 highend snapshot boise real estate blog'

distance = 142
spam score = 43
title = 'winter brookwood subdivision eagle idaho boise real estate blog'

distance = 146
spam score = 51
title = 'california company moving to boise boise real estate blog'

distance = 147
spam score = 50
title = 'boise real estate101 what is a mortgage boise real estate blog'

distance = 151
spam score = 46
title = 'boise real estate 200000 300000 price comparison boise real estate blog'

distance = 151
spam score = 48
title = 'boise real estate 200000 299999 price comparison boise real estate blog'

distance = 151
spam score = 47
title = 'boise real estate under 200000 price comparison boise real estate blog'

distance = 158
spam score = 44
title = 'why i love this market boise real estate blog'

distance = 159
spam score = 49
title = 'boise real estate sales 2004 to now boise real estate blog'

distance = 166
spam score = 48
title = 'boise real estate 2011 ytd sales price distribution boise real estate blog'

distance = 169
spam score = 39
title = 'boise real estate over 500000 price comparison boise real estate blog'

distance = 169
spam score = 38
title = 'boise real estate 400000 499999 price comparison boise real estate blog'

distance = 174
spam score = 48
title = 'star idaho real estate 2010 snapshot boise real estate blog'

distance = 200
spam score = 51
title = 'kuna idaho real estate 2010 snapshot boise real estate blog'

distance = 201
spam score = 46
title = 'national housing numbers show strength boise real estate blog'

distance = 204
spam score = 47
title = 'when was the bottom boise real estate blog'

distance = 205
spam score = 62
title = 'phils photography boise real estate blog'

distance = 212
spam score = 49
title = 'hobble creek subdivision 2010 snapshot boise real estate blog'

distance = 218
spam score = 51
title = 'do you have a fannie or freddie loan boise real estate blog'

distance = 220
spam score = 45
title = 'boise real estate101 what is a short sale boise real estate blog'

distance = 230
spam score = 38
title = 'whats for sale in kuna idaho boise real estate blog'

distance = 230
spam score = 41
title = 'how builders cut costs exteriors boise real estate blog'

distance = 231
spam score = 47
title = 'craigslist rental scam hits boise boise real estate blog'

distance = 254
spam score = 48
title = 'pmi taken into conservatorship boise real estate blog'

distance = 257
spam score = 46
title = 'real estate loan fraud boise real estate blog'

distance = 260
spam score = 42
title = 'proposed bill would speed up short sales boise real estate blog'

distance = 264
spam score = 44
title = 'i have an all cash offer boise real estate blog'

distance = 271
spam score = 45
title = 'new businesses coming to downtown eagle boise real estate blog'

distance = 281
spam score = 48
title = 'boise real estate statistics spring 2009 boise real estate blog'

distance = 282
spam score = 53
title = 'boise homes for sale area 1020 ne meridian boise real estate blog'

distance = 283
spam score = 50
title = 'boise homes for sale mls area 0200 ne boise boise real estate blog'

distance = 284
spam score = 51
title = 'boise homes for sale mls area 0100 north boise boise real estate blog'

distance = 284
spam score = 53
title = 'boise real estate whats selling whats not boise real estate blog'

distance = 289
spam score = 67
title = '11337 1st street star boise real estate blog'

distance = 289
spam score = 52
title = 'boise homes for sale mls area 0900 eagle boise real estate blog'

distance = 290
spam score = 69
title = 'signs boise real estate blog'

distance = 291
spam score = 73
title = 'a tour of meridian boise real estate blog'

distance = 293
spam score = 49
title = 'boise homes for sale mls area 0600 west boise boise real estate blog'

distance = 293
spam score = 47
title = 'boise real estate construction costs are rising boise real estate blog'

distance = 294
spam score = 69
title = 'fences boise real estate blog'

distance = 295
spam score = 34
title = 'boise real estate listing inventory area 1010 sw meridian boise real estate blog'

distance = 295
spam score = 68
title = 'railroad stuff boise real estate blog'

distance = 297
spam score = 69
title = 'a tour of two rivers boise real estate blog'

distance = 304
spam score = 69
title = 'boise area scenery boise real estate blog'

distance = 305
spam score = 45
title = 'boise homes for sale mls area 0650 west boisegarden city boise real estate blog'

distance = 307
spam score = 42
title = 'boise idaho real estate stats august 2010 boise real estate blog'

distance = 307
spam score = 71
title = '11451 w colony street boise boise real estate blog'

distance = 308
spam score = 64
title = 'boise real estates long road to recovery part i boise real estate blog'

distance = 309
spam score = 37
title = 'eagle idaho real estate stats march 2012 boise real estate blog'

distance = 309
spam score = 70
title = 'a tour of brookwood boise real estate blog'

distance = 309
spam score = 41
title = 'eagle idaho real estate stats september 2010 boise real estate blog'

distance = 310
spam score = 53
title = 'boise real estates amazing lack of reo inventory boise real estate blog'

distance = 311
spam score = 38
title = 'meridian idaho real estate stats march 2012 boise real estate blog'

distance = 314
spam score = 44
title = 'boise idaho real estate stats february 2012 boise real estate blog'

distance = 315
spam score = 42
title = 'boise idaho real estate stats for may 2009 boise real estate blog'

distance = 315
spam score = 43
title = 'meridian idaho real estate stats february 2012 boise real estate blog'

distance = 316
spam score = 36
title = 'strong all cash sale numbers boise real estate blog'

distance = 316
spam score = 40
title = 'eagle idaho real estate stats october 2011 boise real estate blog'

distance = 317
spam score = 41
title = 'boise idaho real estate stats april 2012 boise real estate blog'

distance = 318
spam score = 69
title = 'northwest scenery boise real estate blog'

distance = 318
spam score = 69
title = 'a tour of paramount boise real estate blog'

distance = 319
spam score = 48
title = 'eagle idaho real estate stats january 2012 boise real estate blog'

distance = 321
spam score = 73
title = '1501 w warren street boise boise real estate blog'

distance = 328
spam score = 45
title = 'boise idaho real estate stats for february 2008 boise real estate blog'

distance = 328
spam score = 69
title = '1319 n santa rosa avenue meridian boise real estate blog'

distance = 330
spam score = 68
title = 'a tour of lexington hills boise real estate blog'

distance = 335
spam score = 70
title = 'a tour of bridgetower boise real estate blog'

distance = 336
spam score = 76
title = '297 n yellow pine place eagle boise real estate blog'

distance = 341
spam score = 69
title = 'a tour of hobble creek boise real estate blog'

distance = 342
spam score = 47
title = 'b of a trying rental program boise real estate blog'

distance = 348
spam score = 76
title = '2875 e falcon drive meridian boise real estate blog'

distance = 359
spam score = 43
title = 'payroll tax cut paid by mortgage fee boise real estate blog'

distance = 360
spam score = 71
title = '1204 s arbor island place eagle boise real estate blog'

distance = 369
spam score = 42
title = 'harris ranch subdivision health report boise real estate blog'

distance = 370
spam score = 65
title = '5125 n rothmans avenue boise boise real estate blog'

distance = 370
spam score = 43
title = 'buyer agent incentives in the boise real estate market boise real estate blog'

distance = 371
spam score = 70
title = '1574 s lakemoor way eagle boise real estate blog'

distance = 372
spam score = 52
title = 'boise homes for sale area 1000 se meridian boise real estate blog'

distance = 376
spam score = 73
title = '5770 n dalspring avenue boise boise real estate blog'

distance = 376
spam score = 63
title = '17300 sunnydale place caldwell boise real estate blog'

distance = 379
spam score = 47
title = 'meridian idaho real estate 2010 ytd new home sales boise real estate blog'

distance = 379
spam score = 52
title = 'eagle idaho real estate 2010 ytd new home sales boise real estate blog'

distance = 380
spam score = 49
title = 'quality homes scarce in some boise areas boise real estate blog'

distance = 394
spam score = 29
title = 'phriends of phil clarks yard care boise real estate blog'

distance = 400
spam score = 62
title = 'my 2008 ada county real estate market review boise real estate blog'

distance = 412
spam score = 70
title = '2204 windancer court nampa idaho boise real estate blog'

distance = 421
spam score = 55
title = 'interesting boise real estate stats boise real estate blog'

distance = 449
spam score = 51
title = 'boise real estates dubious pending sales boise real estate blog'

distance = 462
spam score = 57
title = 'februarys phriends of phil featured business boise real estate blog'

distance = 464
spam score = 59
title = 'virtual tours boise real estate blog'

distance = 492
spam score = 76
title = '13357 w baldcypress street west boise boise real estate blog'

distance = 495
spam score = 52
title = 'boise real estate condo townhome health report boise real estate blog'

distance = 524
spam score = 77
title = '1071 e pastoral court eagle idaho boise real estate blog'

distance = 1397
spam score = 19
title = 'boise real estate blog raquo eagle idaho real estate stats 8211 april 2012 raquo print'

distance = 1406
spam score = 20
title = 'boise real estate blog raquo eagle idaho real estate stats 8211 february 2012 raquo print'

distance = 1482
spam score = 31
title = 'boise real estate blog raquo earned principal reductions part ii raquo print'

distance = 95
spam score = 9
title = 'people are talking aboutme'

distance = 125
spam score = 3
title = 'oscar loves austin'

distance = 135
spam score = 4
title = 'the ladies of the source code'

distance = 140
spam score = 4
title = 'celeb cities on the rise'

distance = 152
spam score = 5
title = 'machete trailer has a message for az'

distance = 153
spam score = 6
title = 'franco at the fest'

distance = 153
spam score = 3
title = 'is vince vaughn in austin'

distance = 161
spam score = 6
title = 'austin star map'

distance = 165
spam score = 4
title = 'jack black does westlake high'

distance = 170
spam score = 5
title = 'machete filming right now'

distance = 173
spam score = 4
title = 'more baldwin blogging'

distance = 181
spam score = 5
title = 'predators and red carpet event tonight'

distance = 193
spam score = 10
title = 'sht austinites say'

distance = 196
spam score = 4
title = 'jack black does bastrop'

distance = 197
spam score = 3
title = 'leslie jordan on the pink carpet at the paramount'

distance = 198
spam score = 5
title = 'i039ve got ants in my pants'

distance = 200
spam score = 9
title = 'i spy baldwin'

distance = 207
spam score = 3
title = 'andy roddick raises 750k'

distance = 208
spam score = 5
title = 'more machete filming'

distance = 214
spam score = 33
title = 'grounded in music'

distance = 217
spam score = 16
title = 'three cheers for leslie cochran'

distance = 219
spam score = 5
title = 'predators world premiere in austin'

distance = 221
spam score = 4
title = 'taryn manning mans a dell computer'

distance = 221
spam score = 3
title = 'simon pegg pics'

distance = 222
spam score = 26
title = 'swagg presents the perez hilton one night in austin party'

distance = 224
spam score = 3
title = 'i wish i had a pencil thin moustache'

distance = 224
spam score = 4
title = 'ghosts of girlfriends past premiere'

distance = 231
spam score = 25
title = 'predators austin premiere pics'

distance = 233
spam score = 4
title = 'tough town for paparazzo'

distance = 233
spam score = 11
title = 'sxsw short films qualify for academy awards'

distance = 247
spam score = 10
title = 'mel brooks039 new musical young frankenstein is alive in austin'

distance = 247
spam score = 3
title = 'solange knowles be crazy'

distance = 249
spam score = 32
title = 'we walk the line johnny cash 80th b039day bash in austin'

distance = 253
spam score = 4
title = 'celebs hop to the atx for easter'

distance = 254
spam score = 7
title = 'austin humane society inundated with pets taken from animal hoarder'

distance = 259
spam score = 10
title = 'doc039s says win it for leslie cochran'

distance = 268
spam score = 21
title = 'machete movie premiere madness'

distance = 274
spam score = 9
title = 'attention austin pork lovers bacon is now open'

distance = 283
spam score = 3
title = 'sandra bullock is not dating brett ratner whew'

distance = 295
spam score = 3
title = 'opening soon elektra luxx'

distance = 298
spam score = 18
title = 'texas native kelly clarkson coming to the long center in austin'

distance = 304
spam score = 2
title = 'a time to spill'

distance = 305
spam score = 18
title = 'austin039s favorite homeless guy leslie cochran hospitalized'

distance = 308
spam score = 12
title = 'tim tebow will spend easter in georgetown'

distance = 311
spam score = 3
title = 'i039m ready to get a little offcentered are you'

distance = 316
spam score = 5
title = 'taylor momsen performs at perez hilton039s one night in austinquot party'

distance = 319
spam score = 3
title = 'perez hilton one night in austin party sxsw 2011'

distance = 319
spam score = 2
title = 'the stars of mr nice and a not so nice dis to photogs'

distance = 320
spam score = 8
title = 'hey foodies the austin food amp wine festival is coming'

distance = 326
spam score = 9
title = 'alaskan brewing company bringing its line of beers to austin'

distance = 339
spam score = 10
title = 'who is the hottest chef in austin'

distance = 345
spam score = 7
title = 'james franco screening film at austin film festival'

distance = 357
spam score = 9
title = 'momo039s closed because of code violations'

distance = 359
spam score = 2
title = 'offcentered film fest recap'

distance = 360
spam score = 3
title = 'does anyone remember old austin'

distance = 368
spam score = 1
title = 'cops bust austin man for impersonating a police officer'

distance = 372
spam score = 49
title = 'austin band guns of navarone lands sxsw 2012 gig'

distance = 373
spam score = 8
title = 'drew barrymore and scarlett johansson spotted in austin'

distance = 373
spam score = 7
title = 'squatter breaks into pflugerville home cops can039t get him out'

distance = 377
spam score = 4
title = 'you can dance with jack black'

distance = 378
spam score = 17
title = 'angelina jolie039s daddy jon voight in austin for paramount premiere'

distance = 381
spam score = 11
title = 'moontower comedy and oddity festival coming to austin in april'

distance = 383
spam score = 10
title = 'let me ask you a question about kelly clarkson039s posterior'

distance = 389
spam score = 18
title = 'texan loretta devine will always love whitney houston'

distance = 389
spam score = 1
title = 'zip home safely with zingo'

distance = 391
spam score = 12
title = 'austin039s favorite weird guy leslie cochran moved to hospice'

distance = 402
spam score = 7
title = 'austin americanstatesman blames software on lack of reader commenting'

distance = 408
spam score = 2
title = 'hooray it039s oscar day'

distance = 411
spam score = 1
title = 'dennis quaid and paula deen random rants from fancy pants'

distance = 415
spam score = 9
title = 'guess what austin it039s meat week 2012'

distance = 417
spam score = 10
title = 'sandra bullock soars in quotextremely loud and incredibly closequot'

distance = 418
spam score = 14
title = 'michael petrizzo owner of texas039 first black radio station passes away'

distance = 423
spam score = 33
title = 'protest planned over apd039s arrest of war vet antonio buehler'

distance = 423
spam score = 11
title = 'jack ingram and hayes carll to perform at grounded in music benefit'

distance = 430
spam score = 6
title = 'metrorail all aboard austins taxpayer express'

distance = 442
spam score = 42
title = 'sxsw 2012 celeb stalking day six'

distance = 443
spam score = 4
title = 'is occupy wall street a movement of angry white people'

distance = 445
spam score = 19
title = 'atx television festival coming'

distance = 452
spam score = 19
title = 'austin039s favorite weird guy leslie cochran is dead'

distance = 464
spam score = 6
title = 'austin energy going green is not what it seems'

distance = 470
spam score = 6
title = 'circuit of the americas starts ticketing process for austin f1 race'

distance = 498
spam score = 7
title = 'faces and fashion from the oscars sparks cosmetic surgery debate'

distance = 499
spam score = 10
title = 'university of texas gets donation to save dinosaur tracks'

distance = 501
spam score = 25
title = 'former keye news anchor michelle valles on abc039s quotthe lying gamequot'

distance = 503
spam score = 4
title = 'actual letter to us weekly'

distance = 512
spam score = 7
title = 'jesse james crashes supercar into neighbor039s yard in austin'

distance = 512
spam score = 5
title = 'austin police trying to help organize occupy austin leadership'

distance = 522
spam score = 17
title = 'sxsw 2012 celeb stalking day five'

distance = 524
spam score = 31
title = 'occupy austin protest is underway'

distance = 538
spam score = 31
title = 'american idol kelly clarkson gets political'

distance = 572
spam score = 39
title = 'kxans jim swift still spinning yarns after 34 years'

distance = 574
spam score = 36
title = 'occupy austin protester arrested for masturbation at city hall'

distance = 582
spam score = 21
title = 'keye meteorologist troy kimmel austin039s longest running weatherman'

distance = 611
spam score = 16
title = 'city of austin set to vote on the manufactured plastic bag crisis'

distance = 646
spam score = 29
title = 'austin police file more charges in controversial new year039s arrests'

distance = 663
spam score = 14
title = 'army ranger antonio buehler confronts chief art acevedo on video'

distance = 691
spam score = 63
title = 'historic driskill hotel prepares to celebrate 125th anniversary'

distance = 694
spam score = 22
title = 'deep in the heart movie premiere and red carpet highlights'

distance = 708
spam score = 25
title = 'musical meteorologist mark murray loves his gig at kvue'

distance = 717
spam score = 32
title = 'austin ranked one of the best'

distance = 827
spam score = 33
title = 'new poll has rick santorum crushing gop hopefuls in texas'

distance = 159
spam score = 68
title = ''

distance = 180
spam score = 60
title = ''

distance = 180
spam score = 59
title = ''

distance = 184
spam score = 63
title = ''

distance = 216
spam score = 65
title = ''

distance = 249
spam score = 68
title = ''

distance = 264
spam score = 65
title = ''

distance = 298
spam score = 41
title = ''

distance = 418
spam score = 55
title = ''

distance = 425
spam score = 71
title = ''

distance = 425
spam score = 70
title = ''

distance = 466
spam score = 77
title = ''

distance = 468
spam score = 51
title = ''

distance = 482
spam score = 48
title = ''

distance = 549
spam score = 54
title = ''

distance = 709
spam score = 64
title = ''

distance = 131
spam score = 88
title = 'whiskey pastryscoop'

distance = 132
spam score = 86
title = 'turkish delight pastryscoop'

distance = 134
spam score = 89
title = 'pappadam pastryscoop'

distance = 135
spam score = 87
title = 'gingerbread pastryscoop'

distance = 136
spam score = 91
title = 'peel pastryscoop'

distance = 137
spam score = 88
title = 'magdalena pastryscoop'

distance = 138
spam score = 90
title = 'french toast pastryscoop'

distance = 138
spam score = 88
title = 'cortland apple pastryscoop'

distance = 139
spam score = 89
title = 'lavosh pastryscoop'

distance = 142
spam score = 86
title = 'hazelnut pastryscoop'

distance = 143
spam score = 89
title = 'dtente pastryscoop'

distance = 145
spam score = 88
title = 'cashew pastryscoop'

distance = 148
spam score = 91
title = 'yule log pastryscoop'

distance = 149
spam score = 86
title = 'election cake pastryscoop'

distance = 150
spam score = 85
title = 'royal ann cherry pastryscoop'

distance = 151
spam score = 88
title = 'kneading pastryscoop'

distance = 151
spam score = 84
title = 'quiche pastryscoop'

distance = 152
spam score = 90
title = 'pastry pastryscoop'

distance = 154
spam score = 90
title = 'fructose pastryscoop'

distance = 155
spam score = 88
title = 'sponge pastryscoop'

distance = 178
spam score = 89
title = 'monkey bread pastryscoop'

distance = 178
spam score = 89
title = 'torta pastryscoop'

distance = 178
spam score = 93
title = 'micri pastryscoop'

distance = 178
spam score = 87
title = 'cannoli pastryscoop'

distance = 179
spam score = 89
title = 'pumpkin pastryscoop'

distance = 179
spam score = 89
title = 'saccharomyces pastryscoop'

distance = 180
spam score = 88
title = 'horchata pastryscoop'

distance = 184
spam score = 91
title = 'jaggery pastryscoop'

distance = 184
spam score = 93
title = 'marron pastryscoop'

distance = 185
spam score = 91
title = 'gliadin pastryscoop'

distance = 195
spam score = 87
title = 'crpe suzette pastryscoop'

distance = 195
spam score = 87
title = 'carrageen pastryscoop'

distance = 196
spam score = 86
title = 'key lime pastryscoop'

distance = 196
spam score = 87
title = 'egg wash pastryscoop'

distance = 196
spam score = 83
title = 'apple pie spice pastryscoop'

distance = 197
spam score = 86
title = 'popover pastryscoop'

distance = 197
spam score = 91
title = 'light whipping cream pastryscoop'

distance = 198
spam score = 90
title = 'macdoine pastryscoop'

distance = 198
spam score = 87
title = 'dried apricot pastryscoop'

distance = 199
spam score = 93
title = 'pecan pastryscoop'

distance = 210
spam score = 92
title = 'light cream pastryscoop'

distance = 210
spam score = 87
title = 'cookie handshaped pastryscoop'

distance = 211
spam score = 88
title = 'powdered milk pastryscoop'

distance = 211
spam score = 91
title = 'indian pudding pastryscoop'

distance = 212
spam score = 91
title = 'poppy seed pastryscoop'

distance = 212
spam score = 87
title = 'leckerli pastryscoop'

distance = 213
spam score = 89
title = 'delaware grape pastryscoop'

distance = 213
spam score = 90
title = 'cajeta pastryscoop'

distance = 214
spam score = 89
title = 'au lait pastryscoop'

distance = 214
spam score = 83
title = 'mamey sapote pastryscoop'

distance = 227
spam score = 88
title = 'banbury cake pastryscoop'

distance = 227
spam score = 93
title = 'essences pastryscoop'

distance = 227
spam score = 93
title = 'savarin pastryscoop'

distance = 227
spam score = 94
title = 'atemoya pastryscoop'

distance = 227
spam score = 92
title = 'nasturtium pastryscoop'

distance = 228
spam score = 88
title = 'youngberry pastryscoop'

distance = 228
spam score = 83
title = 'crme anglaise pastryscoop'

distance = 229
spam score = 88
title = 'softcrack stage pastryscoop'

distance = 230
spam score = 88
title = 'divinity pastryscoop'

distance = 230
spam score = 88
title = 'turbinado sugar pastryscoop'

distance = 244
spam score = 90
title = 'mulberry pastryscoop'

distance = 245
spam score = 91
title = 'clafouti pastryscoop'

distance = 246
spam score = 92
title = 'rose water pastryscoop'

distance = 246
spam score = 94
title = 'baguette pastryscoop'

distance = 247
spam score = 93
title = 'sopaipilla pastryscoop'

distance = 247
spam score = 85
title = 'thread stage pastryscoop'

distance = 248
spam score = 89
title = 'mandarin orange pastryscoop'

distance = 249
spam score = 84
title = 'paillettes pastryscoop'

distance = 249
spam score = 90
title = 'acerola pastryscoop'

distance = 249
spam score = 94
title = 'cheesecake pastryscoop'

distance = 262
spam score = 86
title = 'fortune cookie pastryscoop'

distance = 263
spam score = 85
title = 'light molasses pastryscoop'

distance = 263
spam score = 91
title = 'timbale pastryscoop'

distance = 264
spam score = 87
title = 'endosperm pastryscoop'

distance = 264
spam score = 93
title = 'pain au levain pastryscoop'

distance = 265
spam score = 92
title = 'durian pastryscoop'

distance = 266
spam score = 85
title = 'steamed bread pastryscoop'

distance = 267
spam score = 91
title = 'donner un tour pastryscoop'

distance = 269
spam score = 93
title = 'bread pastryscoop'

distance = 270
spam score = 92
title = 'graham cracker pastryscoop'

distance = 294
spam score = 90
title = 'chocolate pastryscoop'

distance = 294
spam score = 89
title = 'quickrise yeast pastryscoop'

distance = 298
spam score = 88
title = 'cobbler pastryscoop'

distance = 298
spam score = 90
title = 'almond paste pastryscoop'

distance = 300
spam score = 90
title = 'demerara sugar pastryscoop'

distance = 308
spam score = 94
title = 'yeast starter pastryscoop'

distance = 308
spam score = 92
title = 'fahrenheit pastryscoop'

distance = 314
spam score = 86
title = 'fruit brandy pastryscoop'

distance = 332
spam score = 93
title = 'sainthonor gteau sainthonor pastryscoop'

distance = 340
spam score = 92
title = 'phyllo pastryscoop'

distance = 643
spam score = 83
title = 'techniques for tart doughs and shortbreads pastryscoop'

distance = 644
spam score = 86
title = 'artisanal bread baking pastryscoop'

distance = 648
spam score = 88
title = 'parisian breads pastryscoop'

distance = 649
spam score = 82
title = 'breakfast breads and pastries pastryscoop'

distance = 668
spam score = 85
title = 'cream puffs eclairs and more pastryscoop'

distance = 679
spam score = 82
title = 'la dolce vita italian pastries pastryscoop'

distance = 699
spam score = 83
title = 'breakfast pastries pastryscoop'

distance = 700
spam score = 89
title = 'artisanal bread baking pastryscoop'

distance = 703
spam score = 87
title = 'artisanal bread baking pastryscoop'

distance = 705
spam score = 88
title = 'master class with jacques torres pastryscoop'

distance = 25
spam score = 63
title = 'gt laquo kambri crews'

distance = 27
spam score = 67
title = 'kambri crews'

distance = 36
spam score = 66
title = 'gtfree tickets and more laquo kambri crews'

distance = 42
spam score = 57
title = 'gtto do list laquo kambri crews'

distance = 42
spam score = 63
title = 'kambri crews'

distance = 43
spam score = 65
title = 'kambri crews'

distance = 45
spam score = 59
title = 'gtrichard jeni laquo kambri crews'

distance = 47
spam score = 66
title = 'gtin the news laquo kambri crews'

distance = 47
spam score = 63
title = 'gtguilt by association laquo kambri crews'

distance = 47
spam score = 66
title = 'gtnola journal complete laquo kambri crews'

distance = 48
spam score = 59
title = 'kambri crews'

distance = 49
spam score = 61
title = 'kambri crews'

distance = 51
spam score = 64
title = 'aug 30 2002 laquo kambri crews'

distance = 51
spam score = 60
title = 'gtbest halloween ever laquo kambri crews'

distance = 51
spam score = 58
title = 'gthahahahahah laquo kambri crews'

distance = 51
spam score = 64
title = 'gtroy rules laquo kambri crews'

distance = 53
spam score = 52
title = 'gtbusted laquo kambri crews'

distance = 55
spam score = 67
title = 'gtso8230 laquo kambri crews'

distance = 56
spam score = 65
title = 'gtmerry christmas laquo kambri crews'

distance = 57
spam score = 65
title = 'gtto do tonight laquo kambri crews'

distance = 117
spam score = 64
title = 'gttouchy feely laquo kambri crews'

distance = 117
spam score = 58
title = 'gtny post video of tom davis8217 book party comix laquo kambri crews'

distance = 118
spam score = 60
title = 'gtthis is the life laquo kambri crews'

distance = 118
spam score = 64
title = 'gtbusiest week ever laquo kambri crews'

distance = 118
spam score = 69
title = 'gtcontest laquo kambri crews'

distance = 123
spam score = 63
title = 'gtso i lied laquo kambri crews'

distance = 123
spam score = 63
title = 'gtsave the dates laquo kambri crews'

distance = 124
spam score = 58
title = 'gtone night in paris laquo kambri crews'

distance = 124
spam score = 56
title = 'gttivo alert laquo kambri crews'

distance = 124
spam score = 68
title = 'gthappy thanksgiving laquo kambri crews'

distance = 149
spam score = 57
title = 'gttonight tonight tonniggghhtt laquo kambri crews'

distance = 150
spam score = 61
title = 'gtpics by anya laquo kambri crews'

distance = 150
spam score = 63
title = 'kambri crews'

distance = 150
spam score = 65
title = 'gtthe latest ballyhoo laquo kambri crews'

distance = 150
spam score = 60
title = 'gtin awesome hate mail laquo kambri crews'

distance = 150
spam score = 61
title = 'gtbelated st patrick8217s day laquo kambri crews'

distance = 151
spam score = 61
title = 'gtlet the holiday party gauntlet begin laquo kambri crews'

distance = 151
spam score = 52
title = 'gtwanna laugh laquo kambri crews'

distance = 152
spam score = 51
title = 'gtfresh meat and american idol stuff laquo kambri crews'

distance = 154
spam score = 64
title = 'gtas promised laquo kambri crews'

distance = 178
spam score = 62
title = 'gtmiscellany laquo kambri crews'

distance = 179
spam score = 69
title = 'sep 24 2002 laquo kambri crews'

distance = 179
spam score = 63
title = 'gtgarofalo amp galifianakis caroline rhea amp robert wuhl laquo kambri crews'

distance = 181
spam score = 62
title = 'gtben bailey comix laquo kambri crews'

distance = 181
spam score = 66
title = 'aug 16 2002 laquo kambri crews'

distance = 182
spam score = 59
title = 'gtonly in ny a quotwtfquot moment laquo kambri crews'

distance = 183
spam score = 66
title = 'gti didn8217t do it i swear laquo kambri crews'

distance = 183
spam score = 53
title = 'i wonder laquo kambri crews'

distance = 185
spam score = 60
title = 'gtjon lovitz recap laquo kambri crews'

distance = 185
spam score = 57
title = 'gtare you soap fans free tonight laquo kambri crews'

distance = 216
spam score = 57
title = 'aug 14 2002 laquo kambri crews'

distance = 216
spam score = 58
title = 'aug 18 2002 laquo kambri crews'

distance = 217
spam score = 53
title = 'kambri crews'

distance = 218
spam score = 73
title = 'full page vagina laquo kambri crews'

distance = 218
spam score = 42
title = 'gt30 rock on location laquo kambri crews'

distance = 219
spam score = 60
title = 'gtrobert wuhl wrap up laquo kambri crews'

distance = 220
spam score = 75
title = 'goodreads book giveaway laquo kambri crews'

distance = 220
spam score = 61
title = 'gtoh a wiseguy laquo kambri crews'

distance = 221
spam score = 54
title = 'gtwho says nuclear policy is no laughing matter laquo kambri crews'

distance = 221
spam score = 63
title = 'gtbusy day ahead laquo kambri crews'

distance = 255
spam score = 50
title = 'gtoperatic version of acdc8217s quotyou shook me all night laquo kambri crews'

distance = 255
spam score = 61
title = 'gtle chuckle hut now with donnell rawlings laquo kambri crews'

distance = 257
spam score = 57
title = 'wow laquo kambri crews'

distance = 258
spam score = 59
title = 'gtfree ticket offer to gutenberg the musical laquo kambri crews'

distance = 258
spam score = 59
title = 'gtupdaties laquo kambri crews'

distance = 259
spam score = 78
title = 'shed laquo kambri crews'

distance = 259
spam score = 32
title = 'kambri crews'

distance = 260
spam score = 62
title = 'gtjest is officially a national publication8230 laquo kambri crews'

distance = 260
spam score = 58
title = 'gtthis new year8217s eve drink less smoke more weed laquo kambri crews'

distance = 261
spam score = 60
title = 'june 30 2002 laquo kambri crews'

distance = 297
spam score = 44
title = 'sep 12 2002 laquo kambri crews'

distance = 302
spam score = 56
title = 'gtnewsletter redux and the holidays laquo kambri crews'

distance = 302
spam score = 68
title = 'gtrobert wuhl amp assume the position laquo kambri crews'

distance = 304
spam score = 61
title = 'gtinsert hokey title here laquo kambri crews'

distance = 304
spam score = 63
title = 'gtholy smokes laquo kambri crews'

distance = 304
spam score = 57
title = 'gtwhat a great week so far laquo kambri crews'

distance = 306
spam score = 59
title = 'gton stage laquo kambri crews'

distance = 307
spam score = 58
title = 'gtwhat is this thing you call quotlovequot laquo kambri crews'

distance = 308
spam score = 74
title = 'june 12 2002 laquo kambri crews'

distance = 311
spam score = 60
title = 'gti scream you scream we all scream for ice cream laquo kambri crews'

distance = 355
spam score = 64
title = 'free bags of 8220weed8221 laquo kambri crews'

distance = 356
spam score = 60
title = 'video laquo kambri crews'

distance = 356
spam score = 69
title = 'gttiming is everything laquo kambri crews'

distance = 357
spam score = 51
title = 'gtthree venues laquo kambri crews'

distance = 357
spam score = 69
title = 'pilot season laquo kambri crews'

distance = 360
spam score = 62
title = 'gtsunday february 22nd 8212 free academy awards viewing party laquo kambri crews'

distance = 360
spam score = 58
title = 'gtanother quotonly in new yorkquot story for cindy adams laquo kambri crews'

distance = 360
spam score = 60
title = 'gtfirst friday roundup 8211 lone star beer amp free vodka laquo kambri crews'

distance = 364
spam score = 59
title = 'gtchristian was on the today show laquo kambri crews'

distance = 365
spam score = 60
title = 'gtambition or desperation laquo kambri crews'

distance = 521
spam score = 68
title = 'kambri8217s books laquo kambri crews'

distance = 521
spam score = 39
title = 'gtsabbatical update part ii laquo kambri crews'

distance = 531
spam score = 61
title = 'sep 11 2002 laquo kambri crews'

distance = 535
spam score = 62
title = 'ochi8217s lounge grand opening laquo kambri crews'

distance = 540
spam score = 44
title = 'carl0s menca 8211 party crasher laquo kambri crews'

distance = 557
spam score = 46
title = 'gtthe best of the gospel of jack laquo kambri crews'

distance = 563
spam score = 57
title = 'martha stewart crawled into my ear amp laid eggs laquo kambri crews'

distance = 563
spam score = 47
title = 'gtpsst hey kid wanna see my scar laquo kambri crews'

distance = 568
spam score = 62
title = 'party video amp thanks laquo kambri crews'

distance = 572
spam score = 64
title = 'sep 21 2002 laquo kambri crews'

distance = 1509
spam score = 83
title = 'customized care 8211 cats 90210 los angeles cat sitting has been cat sitting los angeles california since 2003'

distance = 1569
spam score = 81
title = 'cats 90210 los angeles cat sitting has been cat sitting los angeles california since 2003'

distance = 1632
spam score = 21
title = 'sports giving back during the holidays take your sports career to the next level sports networker is the 1 sports business resource online'

distance = 149
spam score = 20
title = 'the next three days trailer laquo multipleverses vault'

distance = 170
spam score = 21
title = 'chaos 8211 behind the scenes 8211 series premiere laquo multipleverses vault'

distance = 176
spam score = 25
title = 'being human 8211 season 1 featurette laquo multipleverses vault'

distance = 179
spam score = 21
title = 'contraband 8211 tv spot laquo multipleverses vault'

distance = 188
spam score = 13
title = 'battle los angeles premiere video laquo multipleverses vault'

distance = 191
spam score = 30
title = 'the making of game of thrones laquo multipleverses vault'

distance = 194
spam score = 35
title = 'cedar rapids 2011 tv spot laquo multipleverses vault'

distance = 199
spam score = 19
title = 'max greenfield talks new girl laquo multipleverses vault'

distance = 202
spam score = 33
title = 'sdcc 2010 8211 the walking dead 8211 interview laquo multipleverses vault'

distance = 203
spam score = 27
title = 'being human extended promo laquo multipleverses vault'

distance = 205
spam score = 17
title = 'the killing 8211 billy campbell interview laquo multipleverses vault'

distance = 205
spam score = 25
title = 'avatar 8211 re release hd trailer laquo multipleverses vault'

distance = 206
spam score = 37
title = 'scream of the banshee 2011 trailer laquo multipleverses vault'

distance = 206
spam score = 31
title = '8216the expendables8217 cast interviews laquo multipleverses vault'

distance = 207
spam score = 23
title = 'being human 8211 season 2 8211 featurette laquo multipleverses vault'

distance = 208
spam score = 23
title = 'face off 8211 season 2 promos for premiere laquo multipleverses vault'

distance = 208
spam score = 18
title = 'battlefield la 2011 cast interviews laquo multipleverses vault'

distance = 211
spam score = 25
title = 'eureka 8211 season 5 returns in 2012 laquo multipleverses vault'

distance = 211
spam score = 24
title = 'super 8 2011 cast interviews laquo multipleverses vault'

distance = 212
spam score = 20
title = 'being human cast interviews laquo multipleverses vault'

distance = 287
spam score = 19
title = 'katherine heigl talks 8220new year8217s eve8221 laquo multipleverses vault'

distance = 288
spam score = 32
title = 'sdcc 2010 8211 machete 8211 interviews from the convention laquo multipleverses vault'

distance = 289
spam score = 21
title = 'taylor lautner talks abduction with conan laquo multipleverses vault'

distance = 289
spam score = 23
title = 'true blood cast interviews paley fest 2011 laquo multipleverses vault'

distance = 290
spam score = 22
title = 'katherine jenkins talks 8216doctor who8217 christmas special laquo multipleverses vault'

distance = 290
spam score = 30
title = 'the finder season 1 8211 behind the scenes video laquo multipleverses vault'

distance = 290
spam score = 37
title = 'scott pilgrim walking dead and more from comic con 2010 laquo multipleverses vault'

distance = 290
spam score = 31
title = 'making game of thrones 8211 season 2 8211 renlys armor laquo multipleverses vault'

distance = 290
spam score = 29
title = 'common talks about his new cd and performs celebrate laquo multipleverses vault'

distance = 292
spam score = 27
title = 'face off 8211 episode 201 8211 return to oz sneak peek laquo multipleverses vault'

distance = 307
spam score = 27
title = 'jason segel talks muppets and how i met your mother laquo multipleverses vault'

distance = 307
spam score = 20
title = 'syfy series face off promo clip laquo multipleverses vault'

distance = 307
spam score = 24
title = 'the game of thrones bts sneak peek laquo multipleverses vault'

distance = 308
spam score = 24
title = 'gwyneth paltrow talks country strong jan 4 2011 laquo multipleverses vault'

distance = 309
spam score = 24
title = 'haven fur sneak peek laquo multipleverses vault'

distance = 309
spam score = 22
title = 'jon bernthal from the walking dead in studio laquo multipleverses vault'

distance = 309
spam score = 33
title = 'game of thrones 8211 episode 102 8211 the kingsroad 8211 preview laquo multipleverses vault'

distance = 309
spam score = 33
title = 'merlin 8211 episode 207 8211 the witchfinder 8211 sneak peek laquo multipleverses vault'

distance = 310
spam score = 34
title = 'matt bomer talks about chuck laquo multipleverses vault'

distance = 310
spam score = 11
title = 'michael trevino talks vampire diaries on ktla laquo multipleverses vault'

distance = 326
spam score = 20
title = 'being human 8211 episode 112 8211 you8217re the one that i haunt 8211 preview laquo multipleverses vault'

distance = 326
spam score = 20
title = 'celebrity interviews rent neil patrick harris directs laquo multipleverses vault'

distance = 326
spam score = 26
title = 'matt bomer tolerance psa laquo multipleverses vault'

distance = 326
spam score = 26
title = 'leah michelle talks 8220new year8217s eve8221 and glee laquo multipleverses vault'

distance = 326
spam score = 22
title = 'kristin chenoweth talks glee and holiday specials with craig laquo multipleverses vault'

distance = 327
spam score = 16
title = 'robert downey jr talks sherlock holmes with dave laquo multipleverses vault'

distance = 328
spam score = 23
title = 'ringer 8211 season 1 mid year series recap laquo multipleverses vault'

distance = 328
spam score = 21
title = 'valerie bertinelli talks hot in cleveland laquo multipleverses vault'

distance = 329
spam score = 21
title = 'thomas dekker talks cinema verite laquo multipleverses vault'

distance = 329
spam score = 23
title = 'morena baccarin talks homeland with craig laquo multipleverses vault'

distance = 350
spam score = 40
title = 'alphas 8211 season 2 teaser laquo multipleverses vault'

distance = 350
spam score = 33
title = 'being human 8211 episode 111 8211 going dutch 8211 recap laquo multipleverses vault'

distance = 351
spam score = 19
title = 'idiots 8211 with kate bosworth and zoe saldana laquo multipleverses vault'

distance = 352
spam score = 20
title = 'bruce campbell wizard world philly 2011 full panel laquo multipleverses vault'

distance = 352
spam score = 21
title = 'syfy 2012 promo your favorite shows return laquo multipleverses vault'

distance = 353
spam score = 38
title = 'merlin episode 312 8211 the coming of arthur 8211 part 1 8211 preview laquo multipleverses vault'

distance = 354
spam score = 22
title = 'white collar 8211 season 3 summer return promos laquo multipleverses vault'

distance = 354
spam score = 27
title = 'merlin 8211 season 4 syfy premiere promo laquo multipleverses vault'

distance = 355
spam score = 31
title = 'sdcc 2010 8211 psych 8211 james roday interview laquo multipleverses vault'

distance = 356
spam score = 18
title = 'the firm 8211 episode 103 8211 chapter three spoiler clips laquo multipleverses vault'

distance = 380
spam score = 19
title = 'the big bang theory 8211 melissa rauch interview laquo multipleverses vault'

distance = 381
spam score = 19
title = 'merlin 8211 episode 421507 the secret sharer preview laquo multipleverses vault'

distance = 381
spam score = 18
title = 'bruce willis helen mirren and other red interviews at comic con 2010 laquo multipleverses vault'

distance = 381
spam score = 21
title = 'being human 8211 season 1 finale 8211 spoiler clip laquo multipleverses vault'

distance = 382
spam score = 23
title = 'alexander skarsgard talks true blood with regis and kelly laquo multipleverses vault'

distance = 382
spam score = 23
title = 'burn notice michael and fiona 8211 season 5 promo laquo multipleverses vault'

distance = 383
spam score = 30
title = 'game of thrones cersei lannister character profile laquo multipleverses vault'

distance = 383
spam score = 31
title = 'californication 8211 episode 501 8211 jfk to lax sneak peek laquo multipleverses vault'

distance = 383
spam score = 26
title = 'warehouse 13 stars eddie mcclintock and joanne kelly spill on bodyswitching episode laquo multipleverses vault'

distance = 383
spam score = 21
title = 'a warrior8217s heart 2011 trailer laquo multipleverses vault'

distance = 404
spam score = 20
title = 'white collar cast at paley fest 2011 8211 discussing season 2 finale laquo multipleverses vault'

distance = 404
spam score = 18
title = 'chuck 8211 episode 510 chuck vs bo 8211 preview clips laquo multipleverses vault'

distance = 405
spam score = 21
title = 'sam witwer and mark pellegrino talk about being vampires laquo multipleverses vault'

distance = 406
spam score = 28
title = 'celebrity interviews sly stallone8217s the expendables the ultimate tough guy flick laquo multipleverses vault'

distance = 406
spam score = 28
title = 'hollywood treasures warehouse 13 auction spot laquo multipleverses vault'

distance = 406
spam score = 19
title = 'celebrity interviews eat pray love julia roberts and javier bardem laquo multipleverses vault'

distance = 408
spam score = 27
title = 'ghi ghosts of nicaragua sneak peek laquo multipleverses vault'

distance = 408
spam score = 23
title = 'secret circle cast talks about the show at cw upfronts laquo multipleverses vault'

distance = 408
spam score = 21
title = 'merlin 8211 episode 421504 aithusa sneak peek laquo multipleverses vault'

distance = 411
spam score = 25
title = 'red faction 2011 trailer laquo multipleverses vault'

distance = 444
spam score = 29
title = 'heroes season 3 milo amp masi exclusive interview laquo multipleverses vault'

distance = 444
spam score = 11
title = 'morena baccarin talks firefly serenity and stargate sg1 laquo multipleverses vault'

distance = 445
spam score = 28
title = 'tin man 2007 trailer 8211 with zooey deschanel laquo multipleverses vault'

distance = 445
spam score = 33
title = 'firefly dragon con 2008 panel laquo multipleverses vault'

distance = 446
spam score = 32
title = 'the sarah connor chronicles 8211 syfy premiere promos laquo multipleverses vault'

distance = 448
spam score = 21
title = 'merlin 8211 episode 409 8211 lancelot du lac 8211 promo and sneak peek laquo multipleverses vault'

distance = 448
spam score = 15
title = 'alaina huffman and julia benson wizard world philly 2011 full panel laquo multipleverses vault'

distance = 449
spam score = 19
title = 'salli richardson whitfield allison blake interview for eureka at comic con 2010 laquo multipleverses vault'

distance = 450
spam score = 29
title = 'amazing arizona comic con the walking dead panel 2011 laquo multipleverses vault'

distance = 451
spam score = 32
title = 'beth riesgraf talks leverage laquo multipleverses vault'

distance = 522
spam score = 47
title = 'comic con 2011 8211 30 minutes or less panel highlights laquo multipleverses vault'

distance = 527
spam score = 24
title = 'hybrid 2007 trailer with cory montieth and justine bateman laquo multipleverses vault'

distance = 528
spam score = 31
title = 'star wars the force unleashed ii trailers including boba fett and sam witwer as starkiller laquo multipleverses vault'

distance = 532
spam score = 24
title = 'leonard nimoy 8211 phoenix comic con 2011 panel video laquo multipleverses vault'

distance = 537
spam score = 19
title = 'james callis colin ferguson eureka comic con interviews laquo multipleverses vault'

distance = 537
spam score = 17
title = 'the firm 8211 premiere episode spoiler clips laquo multipleverses vault'

distance = 538
spam score = 15
title = 'the walking dead 8211 jeryl prescott and norman reedus red carpet sightings laquo multipleverses vault'

distance = 540
spam score = 36
title = 'comic con 2011 8211 sony broll from the event laquo multipleverses vault'

distance = 540
spam score = 35
title = 'bruce willis and helen mirren talk red at comic con laquo multipleverses vault'

distance = 540
spam score = 14
title = 'supernatural 8211 episode 705 8211 shut up dr phil previews with james marsters and charisma carpenter laquo superverses vault'

distance = 1045
spam score = 25
title = 'last house on the left 2009 8211 video collection 8211 trailers and tv spots laquo multipleverses vault'

distance = 1049
spam score = 22
title = 'deborah ann woll laquo multipleverses vault'

distance = 1164
spam score = 51
title = 'yankee stadium laquo multipleverses vault'

distance = 1170
spam score = 42
title = 'ghost rider 8211 spirit of vengeance interviews at comic con 2011 laquo multipleverses vault'

distance = 111
spam score = 89
title = 'school pest news volume 3 issue 6 school integrated pest management'

distance = 115
spam score = 90
title = 'school pest news volume 3 issue 6 school integrated pest management'

distance = 129
spam score = 92
title = 'school pest news volume 4 issue 2 school integrated pest management'

distance = 131
spam score = 92
title = 'school pest news volume 3 issue 5 school integrated pest management'

distance = 132
spam score = 92
title = 'school pest news volume 3 issue 5 school integrated pest management'

distance = 134
spam score = 92
title = 'school pest news volume 4 issue 2 school integrated pest management'

distance = 142
spam score = 89
title = 'school pest news volume 5 issue 3 school integrated pest management'

distance = 151
spam score = 89
title = 'school pest news volume 5 issue 3 school integrated pest management'

distance = 151
spam score = 91
title = 'school pest news volume 6 issue 4 school integrated pest management'

distance = 153
spam score = 91
title = 'the national ipm in schools update june 2003 school integrated pest management'

distance = 154
spam score = 94
title = 'school pest news volume 5 issue 4 school integrated pest management'

distance = 155
spam score = 92
title = 'the national ipm in schools update june 2003 school integrated pest management'

distance = 157
spam score = 91
title = 'school pest news volume 8 issue 2 school integrated pest management'

distance = 157
spam score = 93
title = 'school pest news volume 5 issue 4 school integrated pest management'

distance = 165
spam score = 92
title = 'school pest news volume 6 issue 1 school integrated pest management'

distance = 167
spam score = 92
title = 'school pest news volume 6 issue 4 school integrated pest management'

distance = 170
spam score = 92
title = 'school pest news volume 8 issue 2 school integrated pest management'

distance = 171
spam score = 95
title = 'school pest news volume 6 issue 3 school integrated pest management'

distance = 172
spam score = 92
title = 'the swtrc newsletter volume 2 issue 5 school integrated pest management'

distance = 173
spam score = 91
title = 'the swtrc newsletter volume 2 issue 5 school integrated pest management'

distance = 180
spam score = 90
title = 'school pest news volume 5 issue 1 school integrated pest management'

distance = 180
spam score = 92
title = 'school pest news volume 4 issue 3 school integrated pest management'

distance = 181
spam score = 92
title = 'national schools update winter 2004 school integrated pest management'

distance = 185
spam score = 92
title = 'school pest news volume 6 issue 6 school integrated pest management'

distance = 185
spam score = 92
title = 'national schools update winter 2004 school integrated pest management'

distance = 189
spam score = 92
title = 'the swtrc newsletter volume 3 issue 3 school integrated pest management'

distance = 194
spam score = 89
title = 'the swtrc newsletter volume 3 issue 2 school integrated pest management'

distance = 194
spam score = 92
title = 'the swtrc newsletter volume 3 issue 3 school integrated pest management'

distance = 197
spam score = 92
title = 'school pest news volume 6 issue 6 school integrated pest management'

distance = 197
spam score = 93
title = 'the national ipm in schools update july and august 2003 school integrated pest management'

distance = 202
spam score = 91
title = 'the swtrc newsletter volume 3 issue 1 school integrated pest management'

distance = 202
spam score = 92
title = 'the swtrc newsletter volume 3 issue 4 school integrated pest management'

distance = 202
spam score = 90
title = 'the swtrc newsletter volume 2 issue 6 school integrated pest management'

distance = 206
spam score = 93
title = 'the national ipm in schools update july and august 2003 school integrated pest management'

distance = 208
spam score = 87
title = 'school pest news volume 7 issue 2 school integrated pest management'

distance = 210
spam score = 92
title = 'the swtrc newsletter volume 1 issue 1 school integrated pest management'

distance = 210
spam score = 91
title = 'the swtrc newsletter volume 2 issue 3 school integrated pest management'

distance = 212
spam score = 93
title = 'the swtrc newsletter volume 2 issue 1 school integrated pest management'

distance = 212
spam score = 88
title = 'school pest news volume 7 issue 2 school integrated pest management'

distance = 213
spam score = 92
title = 'the swtrc newsletter volume 1 issue 1 school integrated pest management'

distance = 218
spam score = 91
title = 'the swtrc newsletter volume 2 issue 3 school integrated pest management'

distance = 218
spam score = 91
title = 'the swtrc newsletter volume 2 issue 2 school integrated pest management'

distance = 218
spam score = 91
title = 'the swtrc newsletter volume 2 issue 1 school integrated pest management'

distance = 218
spam score = 93
title = 'the swtrc newsletter volume 2 issue 1 school integrated pest management'

distance = 220
spam score = 92
title = 'the swtrc newsletter volume 3 issue 4 school integrated pest management'

distance = 221
spam score = 89
title = 'school pest news volume 7 issue 5 school integrated pest management'

distance = 222
spam score = 91
title = 'the swtrc newsletter volume 2 issue 1 school integrated pest management'

distance = 224
spam score = 91
title = 'school pest news volume 4 issue 5 school integrated pest management'

distance = 227
spam score = 93
title = 'school pest news volume 8 issue 4 school integrated pest management'

distance = 228
spam score = 95
title = 'school pest news volume 7 issue 1 school integrated pest management'

distance = 230
spam score = 93
title = 'school pest news volume 8 issue 4 school integrated pest management'

distance = 230
spam score = 88
title = 'school pest news volume 7 issue 5 school integrated pest management'

distance = 232
spam score = 95
title = 'school pest news volume 7 issue 1 school integrated pest management'

distance = 236
spam score = 92
title = 'school pest news volume 4 issue 1 school integrated pest management'

distance = 243
spam score = 90
title = 'school pest news volume 6 issue 2 school integrated pest management'

distance = 244
spam score = 96
title = 'school pest news volume 9 issue 3 school integrated pest management'

distance = 244
spam score = 96
title = 'school pest news volume 9 issue 3 school integrated pest management'

distance = 246
spam score = 90
title = 'school pest news volume 6 issue 2 school integrated pest management'

distance = 250
spam score = 92
title = 'the swtrc newsletter volume 1 issue 2 school integrated pest management'

distance = 252
spam score = 93
title = 'awards recognition and impact school integrated pest management'

distance = 255
spam score = 93
title = 'school pest news volume 4 issue 4 school integrated pest management'

distance = 257
spam score = 93
title = 'school pest news volume 4 issue 4 school integrated pest management'

distance = 260
spam score = 94
title = 'school pest news volume 6 issue 5 school integrated pest management'

distance = 262
spam score = 89
title = 'school pest news volume 5 issue 2 school integrated pest management'

distance = 262
spam score = 89
title = 'school pest news volume 5 issue 2 school integrated pest management'

distance = 264
spam score = 93
title = 'school pest news volume 9 issue 1 school integrated pest management'

distance = 269
spam score = 93
title = 'school pest news volume 9 issue 1 school integrated pest management'

distance = 272
spam score = 95
title = 'school pest news volume 8 issue 3 school integrated pest management'

distance = 276
spam score = 95
title = 'school pest news volume 6 issue 5 school integrated pest management'

distance = 277
spam score = 93
title = 'more information school integrated pest management'

distance = 322
spam score = 92
title = 'texas school ipm program impact school integrated pest management'

distance = 340
spam score = 93
title = 'pesticide safety school integrated pest management'

distance = 344
spam score = 91
title = 'texas agrilife extension school ipm program achievements school integrated pest management'

distance = 377
spam score = 97
title = 'school pest news volume 7 issue 3 school integrated pest management'

distance = 379
spam score = 92
title = 'ipm pride for texas schools school integrated pest management'

distance = 381
spam score = 97
title = 'school pest news volume 7 issue 3 school integrated pest management'

distance = 416
spam score = 95
title = 'manual and guides school integrated pest management'

distance = 440
spam score = 92
title = 'school integrated pest management teaching research extension and service'

distance = 447
spam score = 92
title = 'ipm star certification program school integrated pest management'

distance = 466
spam score = 90
title = 'school pest news volume 9 issue 2 school integrated pest management'

distance = 508
spam score = 91
title = 'pesticide applicator information school integrated pest management'

distance = 510
spam score = 95
title = 'certified applicator trainers school integrated pest management'

distance = 555
spam score = 88
title = 'praise for another successful statewide school ipm coordinators conference school integrated pest management'

distance = 556
spam score = 89
title = 'praise for another successful statewide school ipm coordinators conference school integrated pest management'

distance = 573
spam score = 94
title = 'ipm cost calculator school integrated pest management'

distance = 587
spam score = 93
title = 'epa encourages verifiable ipm in every school school integrated pest management'

distance = 594
spam score = 97
title = 'ipm training for coordinators school integrated pest management'

distance = 609
spam score = 96
title = 'structural pest control service forms school integrated pest management'

distance = 615
spam score = 94
title = 'public health pests information amp resources school integrated pest management'

distance = 715
spam score = 89
title = 'epa takes next step to cancel 20 mouse and rat control products used in homes school integrated pest management'

distance = 744
spam score = 96
title = '2009 southern region bright idea award announcement school integrated pest management'

distance = 751
spam score = 92
title = '2007 ipm star certified schools school integrated pest management'

distance = 801
spam score = 80
title = 'school pest news volume 10 issue 2 school integrated pest management'

distance = 810
spam score = 80
title = 'school pest news volume 10 issue 2 school integrated pest management'

distance = 861
spam score = 96
title = '2004 ipm pride award winners school integrated pest management'

distance = 890
spam score = 82
title = 'structural pest control service winter update school integrated pest management'

distance = 891
spam score = 81
title = 'structural pest control service winter update school integrated pest management'

distance = 939
spam score = 57
title = 'got ants in your pantry tiny ants can be big bother to many south central texas homeowners school integrated pest management'

distance = 939
spam score = 56
title = 'got ants in your pantry tiny ants can be big bother to many south central texas homeowners school integrated pest management'

distance = 975
spam score = 61
title = 'school pest news volume 10 issue 8 school integrated pest management'

distance = 1044
spam score = 87
title = 'texas pesticide pollutant discharge elimination system permit tpdes school integrated pest management'

distance = 88
spam score = 80
title = 'international imaging industry association raquo blog archive raquo vision 2020'

distance = 90
spam score = 86
title = 'international imaging industry association raquo testform'

distance = 114
spam score = 76
title = 'international imaging industry association raquo blog archive raquo five emerging technologies that are changing the photo industry'

distance = 117
spam score = 81
title = 'international imaging industry association raquo blog archive raquo 10 big science and technology advances to watch'

distance = 120
spam score = 75
title = 'international imaging industry association raquo blog archive raquo next generation world imaging satellite coming up'

distance = 122
spam score = 80
title = 'international imaging industry association raquo blog archive raquo i3a annual conference'

distance = 128
spam score = 77
title = 'international imaging industry association raquo blog archive raquo sony rises to a new level'

distance = 134
spam score = 85
title = 'international imaging industry association raquo i3a bylaws'

distance = 134
spam score = 82
title = 'international imaging industry association raquo blog archive raquo industry perspective can photography save the world'

distance = 135
spam score = 83
title = 'international imaging industry association raquo blog archive raquo combining current and historic images'

distance = 135
spam score = 81
title = 'international imaging industry association raquo blog archive raquo a look into digital imaging8217s future'

distance = 135
spam score = 83
title = 'international imaging industry association raquo blog archive raquo i3a at industry events'

distance = 138
spam score = 87
title = 'international imaging industry association raquo blog archive raquo vision 2020'

distance = 142
spam score = 81
title = 'international imaging industry association raquo blog archive raquo all hail8230analog'

distance = 143
spam score = 80
title = 'international imaging industry association raquo blog archive raquo are the cameras days numbered'

distance = 144
spam score = 81
title = 'international imaging industry association raquo blog archive raquo innovations in photo imaging'

distance = 144
spam score = 84
title = 'international imaging industry association raquo blog archive raquo challenges from prints to pages to screens'

distance = 145
spam score = 64
title = 'international imaging industry association raquo blog archive raquo bar codes come to tv'

distance = 145
spam score = 75
title = 'international imaging industry association raquo blog archive raquo toysize helicopter with two cameras'

distance = 146
spam score = 75
title = 'international imaging industry association raquo blog archive raquo camera phone concerts'

distance = 228
spam score = 86
title = 'international imaging industry association raquo blog archive raquo canon to launch new online photo book service in japan'

distance = 231
spam score = 76
title = 'international imaging industry association raquo blog archive raquo packing more into lithium batteries'

distance = 232
spam score = 78
title = 'international imaging industry association raquo blog archive raquo network with leaders from apple microsoft nokia and sony at ise 2011'

distance = 233
spam score = 61
title = 'international imaging industry association raquo blog archive raquo medical imaging goes mobile'

distance = 233
spam score = 80
title = 'international imaging industry association raquo blog archive raquo using the right metadata to catch criminals'

distance = 234
spam score = 80
title = 'international imaging industry association raquo blog archive raquo aptina delivers innovative new medical image sensor solution'

distance = 234
spam score = 80
title = 'international imaging industry association raquo blog archive raquo 8 hot trends in document imaging scanning and capture'

distance = 237
spam score = 73
title = 'international imaging industry association raquo blog archive raquo new concept for biomedical imaging gets funded'

distance = 237
spam score = 87
title = 'international imaging industry association raquo blog archive raquo photography 8211 iso standard weathers test of time'

distance = 237
spam score = 77
title = 'international imaging industry association raquo blog archive raquo new infrared camera delivers significantly better resolution'

distance = 275
spam score = 75
title = 'international imaging industry association raquo blog archive raquo solar storms may impact finished digital imaging media'

distance = 275
spam score = 81
title = 'international imaging industry association raquo jobs'

distance = 276
spam score = 82
title = 'international imaging industry association raquo blog archive raquo intel in talks to acquire 3d sensing company'

distance = 276
spam score = 83
title = 'international imaging industry association raquo blog archive raquo intel in talks to acquire 3d sensing company'

distance = 277
spam score = 68
title = 'international imaging industry association raquo blog archive raquo dslr category continues to evolve'

distance = 278
spam score = 79
title = 'international imaging industry association raquo blog archive raquo facebook is now the world8217s largest photo library'

distance = 278
spam score = 76
title = 'international imaging industry association raquo blog archive raquo kodak playsport named best mobile imaging device by tipa'

distance = 279
spam score = 75
title = 'international imaging industry association raquo blog archive raquo the future of camera integrated gps systems'

distance = 279
spam score = 74
title = 'international imaging industry association raquo blog archive raquo lens quality is key in machine vision'

distance = 281
spam score = 79
title = 'international imaging industry association raquo blog archive raquo world 3d medical imaging systems market to grow 88 to 2014'

distance = 308
spam score = 84
title = 'international imaging industry association raquo blog archive raquo fujifilm launches business builders program for photo businesses'

distance = 310
spam score = 77
title = 'international imaging industry association raquo blog archive raquo facebook wins patents for tagging in photos'

distance = 311
spam score = 88
title = 'international imaging industry association raquo blog archive raquo a practical way to make invisibility cloaks'

distance = 311
spam score = 84
title = 'international imaging industry association raquo downloads'

distance = 311
spam score = 84
title = 'international imaging industry association raquo blog archive raquo what8217s next for the mobile camera market'

distance = 312
spam score = 73
title = 'international imaging industry association raquo blog archive raquo the mobile photo sharing boom is here'

distance = 312
spam score = 88
title = 'international imaging industry association raquo contact i3a'

distance = 313
spam score = 69
title = 'international imaging industry association raquo blog archive raquo new technology bridges the gap between camera and mobile'

distance = 313
spam score = 80
title = 'international imaging industry association raquo blog archive raquo world imaging agents market to see significant growth'

distance = 314
spam score = 86
title = 'international imaging industry association raquo blog archive raquo andrea de polo'

distance = 344
spam score = 69
title = 'international imaging industry association raquo blog archive raquo us photo merchandise providers challenged to convert nonbuyers'

distance = 344
spam score = 70
title = 'international imaging industry association raquo blog archive raquo industry sees camera growth continuing'

distance = 345
spam score = 83
title = 'international imaging industry association raquo blog archive raquo a biologically inspired visual search engine'

distance = 345
spam score = 83
title = 'international imaging industry association raquo blog archive raquo facebook puts photosharing in the spotlight'

distance = 347
spam score = 80
title = 'international imaging industry association raquo blog archive raquo omnivision slims 5mp sensor'

distance = 347
spam score = 80
title = 'international imaging industry association raquo blog archive raquo omnivision slims 5mp sensor'

distance = 348
spam score = 81
title = 'international imaging industry association raquo blog archive raquo mri maneuvers pill camera'

distance = 348
spam score = 78
title = 'international imaging industry association raquo blog archive raquo consumers choose cameras over camphones for special moments'

distance = 349
spam score = 68
title = 'international imaging industry association raquo blog archive raquo photosharing sites that import from facebook'

distance = 350
spam score = 86
title = 'international imaging industry association raquo blog archive raquo augmented reality glasses 8212 fact or fiction'

distance = 391
spam score = 79
title = 'international imaging industry association raquo blog archive raquo google documents central park views for online tours'

distance = 396
spam score = 73
title = 'international imaging industry association raquo blog archive raquo kodak adds android app for mobile printing'

distance = 396
spam score = 73
title = 'international imaging industry association raquo blog archive raquo kodak adds android app for mobile printing'

distance = 396
spam score = 68
title = 'international imaging industry association raquo blog archive raquo panning through space and time'

distance = 397
spam score = 85
title = 'international imaging industry association raquo blog archive raquo dxo revamps dxomark comparison site for cameras and lenses'

distance = 397
spam score = 85
title = 'international imaging industry association raquo blog archive raquo dxo revamps dxomark comparison site for cameras and lenses'

distance = 398
spam score = 86
title = 'international imaging industry association raquo blog archive raquo welcome'

distance = 400
spam score = 74
title = 'international imaging industry association raquo blog archive raquo goodbye aps film we hardly got to know you'

distance = 401
spam score = 80
title = 'international imaging industry association raquo blog archive raquo google searches via image recognition'

distance = 402
spam score = 71
title = 'international imaging industry association raquo blog archive raquo a camera that lets you shoot first and focus later'

distance = 453
spam score = 82
title = 'international imaging industry association raquo blog archive raquo revenue for ink jet cartridges will increase to 33 billion in 2015'

distance = 454
spam score = 82
title = 'international imaging industry association raquo blog archive raquo mats wernersson sony ericsson to speak at image sensors 2012'

distance = 454
spam score = 82
title = 'international imaging industry association raquo blog archive raquo mats wernersson sony ericsson to speak at image sensors 2012'

distance = 456
spam score = 85
title = 'international imaging industry association raquo blog archive raquo kodak earns three ces innovations awards from consumer electronics association'

distance = 456
spam score = 59
title = 'international imaging industry association raquo blog archive raquo omnivision announces 175um omnibsi2 sensor'

distance = 456
spam score = 59
title = 'international imaging industry association raquo blog archive raquo omnivision announces 175um omnibsi2 sensor'

distance = 458
spam score = 80
title = 'international imaging industry association raquo blog archive raquo tessera names bob roohparvar president of imaging amp optics'

distance = 458
spam score = 86
title = 'international imaging industry association raquo blog archive raquo demand for digital cameras increasing'

distance = 459
spam score = 79
title = 'international imaging industry association raquo blog archive raquo platinum equity breaths new life into kodak8217s former ccd image sensor business'

distance = 459
spam score = 79
title = 'international imaging industry association raquo blog archive raquo platinum equity breaths new life into kodak8217s former ccd image sensor business'

distance = 505
spam score = 67
title = 'international imaging industry association raquo blog archive raquo smartphone market share rises while pointandshoot share drops'

distance = 507
spam score = 95
title = 'international imaging industry association raquo imaging'

distance = 507
spam score = 94
title = 'international imaging industry association raquo imaging'

distance = 507
spam score = 69
title = 'international imaging industry association raquo blog archive raquo infotrends examines digital camera video capture in the european market'

distance = 507
spam score = 76
title = 'international imaging industry association raquo blog archive raquo smartphone adoption growing at astonishing rate'

distance = 508
spam score = 85
title = 'international imaging industry association raquo blog archive raquo reconstructing complex scenes for virtual reality'

distance = 512
spam score = 82
title = 'international imaging industry association raquo blog archive raquo global 3d medical imaging market to reach us59 billion by 2017'

distance = 512
spam score = 71
title = 'international imaging industry association raquo blog archive raquo surveillance video innovative software noninvasive marketing tool'

distance = 512
spam score = 71
title = 'international imaging industry association raquo blog archive raquo surveillance video innovative software noninvasive marketing tool'

distance = 513
spam score = 70
title = 'international imaging industry association raquo blog archive raquo worldwide camera phone installed base to near 2 billion'

distance = 587
spam score = 79
title = 'international imaging industry association raquo blog archive raquo mit camera captures 8220speed of light8221'

distance = 588
spam score = 80
title = 'international imaging industry association raquo blog archive raquo consumer confidence in tech up'

distance = 588
spam score = 67
title = 'international imaging industry association raquo blog archive raquo brazilian market primed for photo merchandise opportunities'

distance = 589
spam score = 87
title = 'international imaging industry association raquo blog archive raquo see the context'

distance = 589
spam score = 85
title = 'international imaging industry association raquo blog archive raquo mobile imaging creates new printing opportunities'

distance = 589
spam score = 73
title = 'international imaging industry association raquo blog archive raquo cell phone microscope honored as best innovation in 2011'

distance = 590
spam score = 63
title = 'international imaging industry association raquo blog archive raquo new sda standard violates patented technology'

distance = 590
spam score = 63
title = 'international imaging industry association raquo blog archive raquo new sda standard violates patented technology'

distance = 596
spam score = 81
title = 'international imaging industry association raquo blog archive raquo mobile impacts cmos camera module industry'

distance = 599
spam score = 72
title = 'international imaging industry association raquo blog archive raquo infotrends urges digital imaging vendors in western europe to keep up with social networking revolution'

distance = 912
spam score = 59
title = 'international imaging industry association raquo blog archive raquo mobile video uploads on the rise'

distance = 916
spam score = 67
title = 'international imaging industry association raquo blog archive raquo survey reveals spike in mobile video enthusiastic use of mobile photo apps and more'

distance = 916
spam score = 67
title = 'international imaging industry association raquo blog archive raquo survey reveals spike in mobile video enthusiastic use of mobile photo apps and more'

distance = 1243
spam score = 90
title = 'international imaging industry association raquo cpiq license agreement'

distance = 1735
spam score = 1
title = 'desktop wallpapers gt entertainment gt movies gt brick 2006 joseph gordonlevitt emilie de ravin nora zehetner free background wallpapers 1024x768 1280x1024'

distance = 133
spam score = 60
title = 'alltel goes shopping laquo laquo telecompetitor telecompetitor'

distance = 133
spam score = 58
title = 'alltel goes shopping laquo laquo telecompetitor telecompetitor'

distance = 150
spam score = 64
title = 'is charter next laquo laquo telecompetitor telecompetitor'

distance = 152
spam score = 62
title = 'sprint launches mobile shopping service laquo laquo telecompetitor telecompetitor'

distance = 154
spam score = 68
title = 'introducing pivot laquo laquo telecompetitor telecompetitor'

distance = 155
spam score = 77
title = 'atampt and cwa kiss and makeup laquo laquo telecompetitor telecompetitor'

distance = 166
spam score = 67
title = 'its official charter files for chapter 11 bankruptcy laquo laquo telecompetitor telecompetitor'

distance = 168
spam score = 72
title = '3 rivers buys bresnan cable properties laquo laquo telecompetitor telecompetitor'

distance = 169
spam score = 68
title = 'iowa telecom to purchases minnesota telecommunications company laquo laquo telecompetitor telecompetitor'

distance = 171
spam score = 66
title = 'nortel breaking up laquo laquo telecompetitor telecompetitor'

distance = 185
spam score = 59
title = 'sprint to carry live nfl network game telecasts via wireless laquo laquo telecompetitor telecompetitor'

distance = 192
spam score = 67
title = 'a onestop shop for hosted ucs deployments telecompetitor'

distance = 193
spam score = 68
title = 'stelera wireless selects ceragon laquo laquo telecompetitor telecompetitor'

distance = 194
spam score = 71
title = 'cables move to iptv accelerating laquo laquo telecompetitor telecompetitor'

distance = 194
spam score = 73
title = 'latest mvno unlimited data amp ip calling 70month laquo laquo telecompetitor telecompetitor'

distance = 197
spam score = 71
title = 'fcc approves windstreampaetec telecompetitor'

distance = 197
spam score = 74
title = 'it8217s getting crowded in here with middleware options laquo laquo telecompetitor telecompetitor'

distance = 198
spam score = 58
title = 'wii brings youtube to the tv laquo laquo telecompetitor telecompetitor'

distance = 202
spam score = 61
title = 'saving nortel laquo laquo telecompetitor telecompetitor'

distance = 203
spam score = 61
title = 'stelera wireless gains 35 million in rus broadband loan laquo laquo telecompetitor telecompetitor'

distance = 259
spam score = 86
title = 'cox outlines initial wireless plans telecompetitor'

distance = 259
spam score = 79
title = 'iowa telecom shareholders approve windstream deal telecompetitor'

distance = 261
spam score = 60
title = 'verizon and nfl partner for glimpse into tv future laquo laquo telecompetitor telecompetitor'

distance = 261
spam score = 57
title = 'cox prevails over verizon voip patent suit laquo laquo telecompetitor telecompetitor'

distance = 261
spam score = 83
title = 'rural broadband consolidation continues with sunflower broadband acquisition telecompetitor'

distance = 262
spam score = 79
title = 'netamerica aims to address rural 4g challenges telecompetitor'

distance = 265
spam score = 77
title = 'rural broadband wireless gaining momentum laquo laquo telecompetitor telecompetitor'

distance = 266
spam score = 78
title = 'open range bidder backs out liquidation looks to be next telecompetitor'

distance = 267
spam score = 67
title = 'vod coming to a smaller time warner market near you laquo laquo telecompetitor telecompetitor'

distance = 270
spam score = 80
title = 'antimunicipal network trend continues with new georgia bill telecompetitor'

distance = 289
spam score = 77
title = 'verizon pitches value fios tier offers 20 ftth broadband telecompetitor'

distance = 293
spam score = 70
title = 'patent suit parade continues qwest is latest to get hit laquo laquo telecompetitor telecompetitor'

distance = 294
spam score = 77
title = 'wireless voip provider zer01 goes nationwide laquo laquo telecompetitor telecompetitor'

distance = 295
spam score = 77
title = 'hickorytech surpasses 10k digital video subscribers telecompetitor'

distance = 299
spam score = 78
title = 'activevideo sues verizon citing patent infringements for fios telecompetitor'

distance = 299
spam score = 63
title = 'canby selects viptv for hd laquo laquo telecompetitor telecompetitor'

distance = 302
spam score = 74
title = 'voip patent suits continue coxs turn laquo laquo telecompetitor telecompetitor'

distance = 303
spam score = 52
title = 'voip patent infringement parade growing laquo laquo telecompetitor telecompetitor'

distance = 303
spam score = 72
title = 'verizon ordered to cease and desist fios tv service telecompetitor'

distance = 304
spam score = 56
title = 'directv raising the bar with new nfl sunday day ticket laquo laquo telecompetitor telecompetitor'

distance = 320
spam score = 59
title = 'comcast to launch online storage and back up laquo laquo telecompetitor telecompetitor'

distance = 326
spam score = 61
title = 'time warner cable expands wimax footprint telecompetitor'

distance = 326
spam score = 78
title = 'super bowl comes to ott telecompetitor'

distance = 326
spam score = 67
title = 'report tv everywhere strategy is working with limits telecompetitor'

distance = 327
spam score = 73
title = 'cox launches smb online data back up telecompetitor'

distance = 328
spam score = 56
title = 'verizon strike illustrates vulnerability of wireline business telecompetitor'

distance = 331
spam score = 67
title = 'ntelos hopes business split will maximize growth history suggests consolidation telecompetitor'

distance = 332
spam score = 68
title = 'ntelos expands midatlantic regional fiber network telecompetitor'

distance = 335
spam score = 76
title = 'chr solutions and martin group merge telecompetitor'

distance = 337
spam score = 48
title = 'comcast looks to take advantage of frontier fios saga telecompetitor'

distance = 361
spam score = 70
title = 'daktel turns to nsn for iptv telecompetitor'

distance = 362
spam score = 80
title = 'paetec acquires quagga telecompetitor'

distance = 362
spam score = 81
title = 'paetec continues acquisition strategy acquires xeta telecompetitor'

distance = 365
spam score = 72
title = 'iowa telecom reports 2q09 results telecompetitor'

distance = 369
spam score = 79
title = 'nctc comcast renew agreement for content transport telecompetitor'

distance = 369
spam score = 73
title = 'paetec to open major midatlantic data center telecompetitor'

distance = 384
spam score = 61
title = 'fcc approves historic deal between verizon and frontier all necessary approvals now granted telecompetitor'

distance = 385
spam score = 72
title = 'cox successfully tests lte 4g wireless telecompetitor'

distance = 388
spam score = 81
title = 'digitalbridge partners with schurz to expand rural wimax telecompetitor'

distance = 390
spam score = 65
title = 'report home wifi usage to double by 2015 telecompetitor'

distance = 422
spam score = 47
title = 'time warner cable goes on offensive over ipad app telecompetitor'

distance = 427
spam score = 71
title = 'epb sees first takers for 1 gbs residential broadband service telecompetitor'

distance = 428
spam score = 59
title = 'ntelos selects tellabs for fiber iptvtripleplay efforts telecompetitor'

distance = 431
spam score = 65
title = 'verizon toying with their own ott fios service telecompetitor'

distance = 435
spam score = 69
title = 'texas cable mso launches tv everywhere telecompetitor'

distance = 438
spam score = 78
title = 'google to begin construction on ultrahighspeed network telecompetitor'

distance = 442
spam score = 72
title = 'fcc may take action on 700 mhz device interoperability telecompetitor'

distance = 443
spam score = 73
title = 'comcast039s version of tv everywhere goes live with nationwide beta telecompetitor'

distance = 450
spam score = 67
title = 'the five most interesting things heard at todays senate ott video hearing telecompetitor'

distance = 452
spam score = 61
title = 'tv integration with facebook gaining momentum telecompetitor'

distance = 484
spam score = 87
title = 'new fcc working group to tackle universal service fund reforms telecompetitor'

distance = 487
spam score = 80
title = 'report average advertised 4g max speed is 14 mbps telecompetitor'

distance = 487
spam score = 70
title = 'verizon updates rural 4g lte progress telecompetitor'

distance = 489
spam score = 86
title = 'report forecasts increased mobile tv viewing on tablets telecompetitor'

distance = 489
spam score = 64
title = 'smartgrid do consumers get it telecompetitor'

distance = 492
spam score = 72
title = 'lightsquared freedompop promise free mobile broadband service telecompetitor'

distance = 492
spam score = 67
title = 'surewest exploits mediaroom 20 to upgrade dvr future iptv capability telecompetitor'

distance = 496
spam score = 74
title = 'fairpoint files for chapter 11 bankruptcy telecompetitor'

distance = 496
spam score = 80
title = 'national broadband map unveiled anchor institutions underserved telecompetitor'

distance = 501
spam score = 72
title = 'calore moves to 365 ghz wimax telecompetitor'

distance = 524
spam score = 78
title = 'surewest to be acquired by consolidated communications telecompetitor'

distance = 525
spam score = 89
title = '300 million up for grabs in first fcc mobility reverse auction telecompetitor'

distance = 527
spam score = 64
title = 'cablevision sees strong video game use on io tv telecompetitor'

distance = 528
spam score = 74
title = 'comcast adds free text messaging to xfinity voice telecompetitor'

distance = 533
spam score = 59
title = 'report ott video viewing nearly doubles quartertoquarter telecompetitor'

distance = 537
spam score = 84
title = 'rural telco associations ask fcc to reconsider usf reforms telecompetitor'

distance = 537
spam score = 58
title = 'sprint provides more details on 4g lte footprint telecompetitor'

distance = 540
spam score = 67
title = 'start up aereo delivers local tv stations from the cloud telecompetitor'

distance = 548
spam score = 63
title = 'suddenlink expands docsis 30 more 107 mbs markets telecompetitor'

distance = 550
spam score = 73
title = 'new kansas broadband network seeks local investors telecompetitor'

distance = 569
spam score = 69
title = 'centurylink taps pgi for web conferencing offering telecompetitor'

distance = 571
spam score = 90
title = 'latest broadband stimulus awards total over 700 million telecompetitor'

distance = 574
spam score = 74
title = 'cable industry disputes rus claims about impact of usf reform on loan portfolio telecompetitor'

distance = 577
spam score = 75
title = 'report nearly half of american adults own smartphones telecompetitor telecompetitor'

distance = 580
spam score = 74
title = 'report nearly half of american adults own smartphones telecompetitor telecompetitor'

distance = 583
spam score = 77
title = 'first us white spaces broadband network launches today ceo explains telecompetitor'

distance = 584
spam score = 58
title = 'boxee takes ott fight to the fcc telecompetitor'

distance = 584
spam score = 71
title = 'freedompop takes free mobile broadband strategy to clearwire telecompetitor'

distance = 596
spam score = 80
title = 'whats behind sprint plans to rely more on roaming telecompetitor'

distance = 598
spam score = 72
title = 'fcc issues rural call completion ruling telecompetitor'

distance = 658
spam score = 77
title = 'does usf reform put rus loans at risk of default telecompetitor'

distance = 660
spam score = 62
title = 'boxee the ott gloves are off telecompetitor'

distance = 671
spam score = 64
title = 'is google iptv middleware on the way telecompetitor'

distance = 697
spam score = 85
title = 'calix wins 12 more stimulus projects just before earnings call telecompetitor'

distance = 727
spam score = 56
title = 'calix exec on new report rural broadband users are heavy video streamers telecompetitor'

distance = 737
spam score = 64
title = 'latest use of national broadband map leaves a lot to be desired telecompetitor'

distance = 749
spam score = 62
title = 'another iptv middleware exit telecompetitor'

distance = 24
spam score = 38
title = ''

distance = 33
spam score = 37
title = ''

distance = 36
spam score = 37
title = ''

distance = 251
spam score = 41
title = ''

distance = 253
spam score = 39
title = ''

distance = 257
spam score = 39
title = ''

distance = 258
spam score = 40
title = ''

distance = 261
spam score = 41
title = ''

distance = 307
spam score = 40
title = ''

distance = 1148
spam score = 63
title = ''

distance = 98
spam score = 91
title = 'current and former student travelers center for global engagement'

distance = 99
spam score = 87
title = 'apply center for global engagement'

distance = 107
spam score = 91
title = 'current and former student travelers center for global engagement'

distance = 113
spam score = 88
title = 'apply center for global engagement'

distance = 118
spam score = 87
title = 'calendar center for global engagement'

distance = 123
spam score = 87
title = 'calendar center for global engagement'

distance = 138
spam score = 88
title = 'programs center for global engagement'

distance = 139
spam score = 88
title = 'programs center for global engagement'

distance = 160
spam score = 89
title = 'featured student study abroad photosblogs center for global engagement'

distance = 166
spam score = 90
title = 'accepted student travelers center for global engagement'

distance = 167
spam score = 89
title = 'featured student study abroad photosblogs center for global engagement'

distance = 175
spam score = 90
title = 'accepted student travelers center for global engagement'

distance = 186
spam score = 91
title = 'deferwithdraw from a program center for global engagement'

distance = 202
spam score = 91
title = 'deferwithdraw from a program center for global engagement'

distance = 206
spam score = 89
title = 'accepted students day center for global engagement'

distance = 206
spam score = 88
title = 'accepted students day center for global engagement'

distance = 206
spam score = 89
title = 'accepted students day center for global engagement'

distance = 206
spam score = 89
title = 'accepted students day center for global engagement'

distance = 209
spam score = 90
title = 'ravi shahflorence italy center for global engagement'

distance = 209
spam score = 90
title = 'application deadline for study abroad during the spring 2013 semesterfriday september 21 2012 center for global engagement'

distance = 209
spam score = 90
title = 'application deadline for study abroad during the spring 2013 semesterfriday september 21 2012 center for global engagement'

distance = 209
spam score = 90
title = 'application deadline for study abroad during the spring 2013 semesterfriday september 21 2012 center for global engagement'

distance = 209
spam score = 90
title = 'application deadline for study abroad during the spring 2013 semesterfriday september 21 2012 center for global engagement'

distance = 215
spam score = 91
title = 'nj reentry conference center for global engagement'

distance = 219
spam score = 91
title = 'prospective student travelers center for global engagement'

distance = 220
spam score = 90
title = 'prospective student travelers center for global engagement'

distance = 221
spam score = 90
title = 'ravi shahflorence italy center for global engagement'

distance = 221
spam score = 91
title = 'nj reentry conference center for global engagement'

distance = 235
spam score = 90
title = 'north america center for global engagement'

distance = 235
spam score = 90
title = 'north america center for global engagement'

distance = 238
spam score = 86
title = 'jason reidspring 2012 semester abroadcosta del sur spain center for global engagement'

distance = 238
spam score = 87
title = 'jason reidspring 2012 semester abroadcosta del sur spain center for global engagement'

distance = 239
spam score = 87
title = 'jason reidspring 2012 semester abroadcosta del sur spain center for global engagement'

distance = 239
spam score = 87
title = 'jason reidspring 2012 semester abroadcosta del sur spain center for global engagement'

distance = 249
spam score = 92
title = 'billing and cost center for global engagement'

distance = 256
spam score = 93
title = 'billing and cost center for global engagement'

distance = 268
spam score = 90
title = 'gary betheabeijing china center for global engagement'

distance = 273
spam score = 95
title = 'new study abroad course center for global engagement'

distance = 275
spam score = 90
title = 'gary betheabeijing china center for global engagement'

distance = 276
spam score = 88
title = 'provider scholarships center for global engagement'

distance = 277
spam score = 95
title = 'new study abroad course center for global engagement'

distance = 283
spam score = 86
title = 'bonner nicaragua program maymester 2012 center for global engagement'

distance = 283
spam score = 86
title = 'bonner nicaragua program maymester 2012 center for global engagement'

distance = 284
spam score = 86
title = 'bonner nicaragua program maymester 2012 center for global engagement'

distance = 284
spam score = 86
title = 'bonner nicaragua program maymester 2012 center for global engagement'

distance = 287
spam score = 88
title = 'provider scholarships center for global engagement'

distance = 290
spam score = 97
title = 'tcnjnewcastleaustralia exchange program center for global engagement'

distance = 292
spam score = 89
title = 'ravi shahfall 2011 semester abroadstonehenge england center for global engagement'

distance = 292
spam score = 89
title = 'ravi shahfall 2011 semester abroadstonehenge england center for global engagement'

distance = 292
spam score = 89
title = 'ravi shahfall 2011 semester abroadstonehenge england center for global engagement'

distance = 292
spam score = 89
title = 'ravi shahfall 2011 semester abroadstonehenge england center for global engagement'

distance = 297
spam score = 96
title = 'tcnjnewcastleaustralia exchange program center for global engagement'

distance = 298
spam score = 78
title = 'return on investment center for global engagement'

distance = 302
spam score = 89
title = 'kaitlyn capelakosswansea wales center for global engagement'

distance = 304
spam score = 94
title = 'salzburg college austria center for global engagement'

distance = 307
spam score = 77
title = 'return on investment center for global engagement'

distance = 308
spam score = 89
title = 'capa florence offers great price and scholarships to tcnj students center for global engagement'

distance = 308
spam score = 89
title = 'capa florence offers great price and scholarships to tcnj students center for global engagement'

distance = 308
spam score = 88
title = 'capa florence offers great price and scholarships to tcnj students center for global engagement'

distance = 308
spam score = 94
title = 'cls scholarships for students of critical languages center for global engagement'

distance = 308
spam score = 88
title = 'capa florence offers great price and scholarships to tcnj students center for global engagement'

distance = 310
spam score = 94
title = 'salzburg college austria center for global engagement'

distance = 312
spam score = 94
title = 'cls scholarships for students of critical languages center for global engagement'

distance = 312
spam score = 88
title = 'kaitlyn capelakosswansea wales center for global engagement'

distance = 318
spam score = 87
title = 'gary betheafall 2011 semester abroadbeijing china center for global engagement'

distance = 318
spam score = 88
title = 'gary betheafall 2011 semester abroadbeijing china center for global engagement'

distance = 318
spam score = 87
title = 'gary betheafall 2011 semester abroadbeijing china center for global engagement'

distance = 318
spam score = 87
title = 'gary betheafall 2011 semester abroadbeijing china center for global engagement'

distance = 334
spam score = 97
title = 'tcnjtajikistan exchange program center for global engagement'

distance = 335
spam score = 87
title = 'jessica phansummer 2011 semester abroadvenice italy center for global engagement'

distance = 335
spam score = 87
title = 'jessica phansummer 2011 semester abroadvenice italy center for global engagement'

distance = 335
spam score = 87
title = 'jessica phansummer 2011 semester abroadvenice italy center for global engagement'

distance = 335
spam score = 87
title = 'jessica phansummer 2011 semester abroadvenice italy center for global engagement'

distance = 338
spam score = 96
title = 'tcnjtajikistan exchange program center for global engagement'

distance = 348
spam score = 91
title = 'caitlyn curtindisney college program florida center for global engagement'

distance = 356
spam score = 89
title = 'janika berridgespring 2012 semester abroadguanacaste costa rica center for global engagement'

distance = 356
spam score = 88
title = 'janika berridgespring 2012 semester abroadguanacaste costa rica center for global engagement'

distance = 359
spam score = 91
title = 'caitlyn curtindisney college program florida center for global engagement'

distance = 360
spam score = 88
title = 'janika berridgespring 2012 semester abroadguanacaste costa rica center for global engagement'

distance = 360
spam score = 89
title = 'janika berridgespring 2012 semester abroadguanacaste costa rica center for global engagement'

distance = 371
spam score = 93
title = 'tcnj direct center for global engagement'

distance = 387
spam score = 91
title = 'gaining academic credit for internships center for global engagement'

distance = 398
spam score = 85
title = 'alessandra pierracinithessaloniki greece center for global engagement'

distance = 404
spam score = 77
title = 'while you are thereculture shock center for global engagement'

distance = 408
spam score = 85
title = 'alessandra pierracinithessaloniki greece center for global engagement'

distance = 420
spam score = 77
title = 'while you are thereculture shock center for global engagement'

distance = 427
spam score = 89
title = 'middle east center for global engagement'

distance = 427
spam score = 88
title = 'middle east center for global engagement'

distance = 443
spam score = 83
title = 'janika berridgesan jose costa rica center for global engagement'

distance = 449
spam score = 83
title = 'janika berridgesan jose costa rica center for global engagement'

distance = 475
spam score = 94
title = 'tcnj harlaxton center for global engagement'

distance = 480
spam score = 94
title = 'tcnj harlaxton center for global engagement'

distance = 484
spam score = 85
title = 'aimee graybuenos aires argentina center for global engagement'

distance = 489
spam score = 85
title = 'aimee graybuenos aires argentina center for global engagement'

distance = 553
spam score = 95
title = 'tcnj cornwall center for global engagement'

distance = 587
spam score = 90
title = 'jessica phanflorence italy center for global engagement'

distance = 592
spam score = 92
title = 'tcnj italy center for global engagement'

distance = 600
spam score = 90
title = 'jessica phanflorence italy center for global engagement'

distance = 694
spam score = 76
title = 'jason reidgranada spain center for global engagement'

distance = 696
spam score = 76
title = 'jason reidgranada spain center for global engagement'

distance = 765
spam score = 91
title = 'peer advisors center for global engagement'

distance = 770
spam score = 90
title = 'peer advisors center for global engagement'

distance = 782
spam score = 76
title = 'preparing to leave center for global engagement'

distance = 1613
spam score = 17
title = '20132014 fulbright teacher exchange program for us and indian students usa and india undergraduate and postgraduate scholarship'

distance = 1854
spam score = 49
title = 'central virginia waste management authority cvwma'

distance = 50
spam score = 75
title = ''

distance = 52
spam score = 72
title = ''

distance = 54
spam score = 74
title = ''

distance = 55
spam score = 69
title = ''

distance = 57
spam score = 73
title = ''

distance = 59
spam score = 76
title = ''

distance = 64
spam score = 73
title = ''

distance = 65
spam score = 76
title = ''

distance = 65
spam score = 77
title = ''

distance = 66
spam score = 72
title = ''

distance = 71
spam score = 75
title = ''

distance = 71
spam score = 75
title = ''

distance = 72
spam score = 76
title = ''

distance = 72
spam score = 74
title = ''

distance = 74
spam score = 75
title = ''

distance = 80
spam score = 74
title = ''

distance = 84
spam score = 76
title = ''

distance = 87
spam score = 72
title = ''

distance = 97
spam score = 75
title = ''

distance = 99
spam score = 75
title = ''

distance = 102
spam score = 75
title = ''

distance = 149
spam score = 71
title = ''

distance = 150
spam score = 71
title = ''

distance = 156
spam score = 75
title = ''

distance = 158
spam score = 72
title = ''

distance = 245
spam score = 81
title = ''

distance = 259
spam score = 78
title = ''

distance = 264
spam score = 71
title = ''

distance = 271
spam score = 73
title = ''

distance = 276
spam score = 58
title = ''

distance = 299
spam score = 77
title = ''

distance = 307
spam score = 72
title = ''

distance = 308
spam score = 72
title = ''

distance = 308
spam score = 69
title = ''

distance = 310
spam score = 68
title = ''

distance = 311
spam score = 74
title = ''

distance = 327
spam score = 77
title = ''

distance = 332
spam score = 64
title = ''

distance = 338
spam score = 79
title = ''

distance = 348
spam score = 70
title = ''

distance = 353
spam score = 87
title = ''

distance = 359
spam score = 75
title = ''

distance = 360
spam score = 85
title = ''

distance = 363
spam score = 74
title = ''

distance = 364
spam score = 74
title = ''

distance = 368
spam score = 77
title = ''

distance = 370
spam score = 79
title = ''

distance = 374
spam score = 57
title = ''

distance = 376
spam score = 76
title = ''

distance = 377
spam score = 79
title = ''

distance = 385
spam score = 86
title = ''

distance = 419
spam score = 73
title = ''

distance = 419
spam score = 82
title = ''

distance = 420
spam score = 58
title = ''

distance = 421
spam score = 64
title = ''

distance = 452
spam score = 81
title = ''

distance = 454
spam score = 64
title = ''

distance = 469
spam score = 80
title = ''

distance = 470
spam score = 60
title = ''

distance = 473
spam score = 75
title = ''

distance = 483
spam score = 76
title = ''

distance = 485
spam score = 80
title = ''

distance = 508
spam score = 84
title = ''

distance = 522
spam score = 83
title = ''

distance = 523
spam score = 72
title = ''

distance = 530
spam score = 76
title = ''

distance = 537
spam score = 78
title = ''

distance = 553
spam score = 82
title = ''

distance = 597
spam score = 61
title = ''

distance = 604
spam score = 70
title = ''

distance = 622
spam score = 73
title = ''

distance = 676
spam score = 62
title = ''

distance = 760
spam score = 88
title = ''

distance = 790
spam score = 76
title = ''

distance = 981
spam score = 74
title = ''

distance = 1205
spam score = 87
title = ''

distance = 1226
spam score = 84
title = ''

distance = 74
spam score = 90
title = 'sermon january 24 2010 trinity united methodist church trinity united methodist church sermon january 24 2010 trinity united methodist church daring to be different'

distance = 75
spam score = 88
title = 'sermon february 21 2010 trinity united methodist church trinity united methodist church sermon february 21 2010 trinity united methodist church daring to be different'

distance = 76
spam score = 89
title = 'sermon september 6 2009 trinity united methodist church trinity united methodist church sermon september 6 2009 trinity united methodist church daring to be different'

distance = 78
spam score = 88
title = 'sermon september 13 2009 trinity united methodist church trinity united methodist church sermon september 13 2009 trinity united methodist church daring to be different'

distance = 80
spam score = 89
title = 'sermon january 17 2010 trinity united methodist church trinity united methodist church sermon january 17 2010 trinity united methodist church daring to be different'

distance = 80
spam score = 90
title = 'sermon december 27 2009 trinity united methodist church trinity united methodist church sermon december 27 2009 trinity united methodist church daring to be different'

distance = 81
spam score = 93
title = 'programs trinity united methodist church trinity united methodist church programs trinity united methodist church daring to be different'

distance = 81
spam score = 89
title = 'sermon february 7 2010 trinity united methodist church trinity united methodist church sermon february 7 2010 trinity united methodist church daring to be different'

distance = 82
spam score = 89
title = 'sermon november 15 2009 trinity united methodist church trinity united methodist church sermon november 15 2009 trinity united methodist church daring to be different'

distance = 82
spam score = 89
title = 'sermon november 8 2009 trinity united methodist church trinity united methodist church sermon november 8 2009 trinity united methodist church daring to be different'

distance = 83
spam score = 89
title = 'sermon january 3 2010 trinity united methodist church trinity united methodist church sermon january 3 2010 trinity united methodist church daring to be different'

distance = 84
spam score = 90
title = 'sermon january 31 2010 trinity united methodist church trinity united methodist church sermon january 31 2010 trinity united methodist church daring to be different'

distance = 85
spam score = 89
title = 'sermon december 24 2009 trinity united methodist church trinity united methodist church sermon december 24 2009 trinity united methodist church daring to be different'

distance = 86
spam score = 89
title = 'united methodist women 8211 58 trinity united methodist church trinity united methodist church united methodist women 8211 58 trinity united methodist church daring to be different'

distance = 86
spam score = 90
title = 'sermon november 22 2009 trinity united methodist church trinity united methodist church sermon november 22 2009 trinity united methodist church daring to be different'

distance = 87
spam score = 89
title = 'sermon december 13 2009 trinity united methodist church trinity united methodist church sermon december 13 2009 trinity united methodist church daring to be different'

distance = 87
spam score = 90
title = 'sermon december 6 2009 trinity united methodist church trinity united methodist church sermon december 6 2009 trinity united methodist church daring to be different'

distance = 91
spam score = 86
title = 'trinity games night 8211 32 trinity united methodist church trinity united methodist church trinity games night 8211 32 trinity united methodist church daring to be different'

distance = 91
spam score = 88
title = 'sermon november 1 2009 trinity united methodist church trinity united methodist church sermon november 1 2009 trinity united methodist church daring to be different'

distance = 102
spam score = 89
title = 'women crossing over trinity united methodist church trinity united methodist church women crossing over trinity united methodist church daring to be different'

distance = 197
spam score = 89
title = 'laura still039s new blog trinity united methodist church trinity united methodist church laura still039s new blog trinity united methodist church daring to be different'

distance = 197
spam score = 89
title = 'laura still8217s new blog trinity united methodist church trinity united methodist church laura still8217s new blog trinity united methodist church daring to be different'

distance = 199
spam score = 87
title = 'umw bake sale 8211 dec 4 trinity united methodist church trinity united methodist church umw bake sale 8211 dec 4 trinity united methodist church daring to be different'

distance = 200
spam score = 91
title = 'women amp fair trade festival 8211 nov 1213 trinity united methodist church trinity united methodist church women amp fair trade festival 8211 nov 1213 trinity united methodist church daring to be different'

distance = 203
spam score = 94
title = 'youth trinity united methodist church trinity united methodist church youth trinity united methodist church daring to be different'

distance = 206
spam score = 92
title = 'honey do list trinity united methodist church trinity united methodist church honey do list trinity united methodist church daring to be different'

distance = 206
spam score = 88
title = 'maundy thursday service 8211 630 pm trinity united methodist church trinity united methodist church maundy thursday service 8211 630 pm trinity united methodist church daring to be different'

distance = 209
spam score = 90
title = 'powerpoint presentation from laura still trinity united methodist church trinity united methodist church powerpoint presentation from laura still trinity united methodist church daring to be different'

distance = 209
spam score = 88
title = 'new wednesday night prayer group trinity united methodist church trinity united methodist church new wednesday night prayer group trinity united methodist church daring to be different'

distance = 210
spam score = 89
title = 'sunday meditations palm sunday trinity united methodist church trinity united methodist church sunday meditations palm sunday trinity united methodist church daring to be different'

distance = 246
spam score = 89
title = 'last chance silent auction 8211 dec 4 trinity united methodist church trinity united methodist church last chance silent auction 8211 dec 4 trinity united methodist church daring to be different'

distance = 247
spam score = 89
title = 'sunday meditations respecting different faith traditions trinity united methodist church trinity united methodist church sunday meditations respecting different faith traditions trinity united methodist church daring to be different'

distance = 248
spam score = 89
title = 'sunday meditations inclusivity trinity united methodist church trinity united methodist church sunday meditations inclusivity trinity united methodist church daring to be different'

distance = 250
spam score = 91
title = 'calling all trinity members 8211 glbt and allies trinity united methodist church trinity united methodist church calling all trinity members 8211 glbt and allies trinity united methodist church daring to be different'

distance = 251
spam score = 87
title = 'a moment of 8220hope8221 trinity united methodist church trinity united methodist church a moment of 8220hope8221 trinity united methodist church daring to be different'

distance = 252
spam score = 91
title = 'update regarding trinity8217s potential move trinity united methodist church trinity united methodist church update regarding trinity8217s potential move trinity united methodist church daring to be different'

distance = 252
spam score = 91
title = 'update regarding trinity039s potential move trinity united methodist church trinity united methodist church update regarding trinity039s potential move trinity united methodist church daring to be different'

distance = 254
spam score = 93
title = 'are you a techno sapien trinity united methodist church trinity united methodist church are you a techno sapien trinity united methodist church daring to be different'

distance = 255
spam score = 89
title = 'special guest this sunday july 17 trinity united methodist church trinity united methodist church special guest this sunday july 17 trinity united methodist church daring to be different'

distance = 258
spam score = 87
title = 'christmas baskets for ridgetop families 8211 1218 trinity united methodist church trinity united methodist church christmas baskets for ridgetop families 8211 1218 trinity united methodist church daring to be different'

distance = 272
spam score = 88
title = 'fundraising last chance for the armoire raffle trinity united methodist church trinity united methodist church fundraising last chance for the armoire raffle trinity united methodist church daring to be different'

distance = 273
spam score = 92
title = 'sunday meditations panentheism trinity united methodist church trinity united methodist church sunday meditations panentheism trinity united methodist church daring to be different'

distance = 278
spam score = 88
title = 'an evening of hope feed your neighbors feed your soul 8211 226 trinity united methodist church trinity united methodist church an evening of hope feed your neighbors feed your soul 8211 226 trinity united methodist church daring to be different'

distance = 279
spam score = 90
title = 'total body blast donationbased community fitness program at trinity trinity united methodist church trinity united methodist church total body blast donationbased community fitness program at trinity trinity united methodist church daring to be different'

distance = 279
spam score = 88
title = 'free music class for infants amp toddlers 8211 wednesdays at 10 starting 914 trinity united methodist church trinity united methodist church free music class for infants amp toddlers 8211 wednesdays at 10 starting 914 trinity united methodist church daring to be different'

distance = 279
spam score = 87
title = 'free music class for infants amp toddlers 8211 wednesdays at 10 starting 914 trinity united methodist church trinity united methodist church free music class for infants amp toddlers 8211 wednesdays at 10 starting 914 trinity united methodist church daring to be different'

distance = 280
spam score = 82
title = 'vote results trinity united methodist church trinity united methodist church vote results trinity united methodist church daring to be different'

distance = 283
spam score = 85
title = 'sunday meditations mythology history faith trinity united methodist church trinity united methodist church sunday meditations mythology history faith trinity united methodist church daring to be different'

distance = 287
spam score = 93
title = 'peter marsh 8211 teacher trinity united methodist church trinity united methodist church peter marsh 8211 teacher trinity united methodist church daring to be different'

distance = 287
spam score = 89
title = 'thanksgiving for the homeless 8211 nov 20 trinity united methodist church trinity united methodist church thanksgiving for the homeless 8211 nov 20 trinity united methodist church daring to be different'

distance = 303
spam score = 90
title = 'volunteer teachers trinity united methodist church trinity united methodist church volunteer teachers trinity united methodist church daring to be different'

distance = 303
spam score = 92
title = 'trinity8217s concert amp silent auction at jovita8217s 8211 this sunday nov 6 trinity united methodist church trinity united methodist church trinity8217s concert amp silent auction at jovita8217s 8211 this sunday nov 6 trinity united methodist church daring to be different'

distance = 309
spam score = 88
title = 'natural grocers matching program 8211 hope food pantry austin trinity united methodist church trinity united methodist church natural grocers matching program 8211 hope food pantry austin trinity united methodist church daring to be different'

distance = 310
spam score = 89
title = 'caritas thanks trinity trinity united methodist church trinity united methodist church caritas thanks trinity trinity united methodist church daring to be different'

distance = 311
spam score = 89
title = 'mfsa chapter meeting thursday february 10 trinity united methodist church trinity united methodist church mfsa chapter meeting thursday february 10 trinity united methodist church daring to be different'

distance = 313
spam score = 90
title = '100 of apportionments paid trinity united methodist church trinity united methodist church 100 of apportionments paid trinity united methodist church daring to be different'

distance = 314
spam score = 91
title = 'rsvp 8211 gold party global on march 24th trinity united methodist church trinity united methodist church rsvp 8211 gold party global on march 24th trinity united methodist church daring to be different'

distance = 315
spam score = 96
title = 'combined celebration trinity united methodist church trinity united methodist church combined celebration trinity united methodist church daring to be different'

distance = 317
spam score = 91
title = 'austin interfaith delegates assembly 8211 april 29 trinity united methodist church trinity united methodist church austin interfaith delegates assembly 8211 april 29 trinity united methodist church daring to be different'

distance = 323
spam score = 90
title = 'national week of prayer for the healing of aids 8211 34 8211 310 trinity united methodist church trinity united methodist church national week of prayer for the healing of aids 8211 34 8211 310 trinity united methodist church daring to be different'

distance = 365
spam score = 97
title = 'united methodist 101 online class through united methodist communications trinity united methodist church trinity united methodist church united methodist 101 online class through united methodist communications trinity united methodist church daring to be different'

distance = 367
spam score = 91
title = 'for the bible tells me so 8211 sept 25 at saint john8217s umc trinity united methodist church trinity united methodist church for the bible tells me so 8211 sept 25 at saint john8217s umc trinity united methodist church daring to be different'

distance = 367
spam score = 89
title = 'feed the homeless 8211 christmas day trinity united methodist church trinity united methodist church feed the homeless 8211 christmas day trinity united methodist church daring to be different'

distance = 367
spam score = 92
title = 'for the bible tells me so 8211 sept 25 at saint john039s umc trinity united methodist church trinity united methodist church for the bible tells me so 8211 sept 25 at saint john039s umc trinity united methodist church daring to be different'

distance = 370
spam score = 94
title = 'trinity member raises for the hill country ride for aids trinity united methodist church trinity united methodist church trinity member raises for the hill country ride for aids trinity united methodist church daring to be different'

distance = 373
spam score = 94
title = 'transgender day of remembrance 8211 1120 trinity united methodist church trinity united methodist church transgender day of remembrance 8211 1120 trinity united methodist church daring to be different'

distance = 385
spam score = 96
title = 'one last chance to help trinity make a difference trinity united methodist church trinity united methodist church one last chance to help trinity make a difference trinity united methodist church daring to be different'

distance = 389
spam score = 93
title = 'sunday schedule trinity united methodist church trinity united methodist church sunday schedule trinity united methodist church daring to be different'

distance = 392
spam score = 87
title = 'sunday meditations whatever became of sin trinity united methodist church trinity united methodist church sunday meditations whatever became of sin trinity united methodist church daring to be different'

distance = 396
spam score = 91
title = 'trinity united methodist church daring to be different'

distance = 432
spam score = 90
title = 'calendar trinity united methodist church trinity united methodist church calendar trinity united methodist church daring to be different'

distance = 446
spam score = 92
title = 'north central caregivers amp first cumberland presbyterian church garage amp bake sale 8211 519 trinity united methodist church trinity united methodist church north central caregivers amp first cumberland presbyterian church garage amp bake sale 8211 519 trinity united methodist church daring to be different'

distance = 447
spam score = 91
title = 'sunday supper survey trinity united methodist church trinity united methodist church sunday supper survey trinity united methodist church daring to be different'

distance = 448
spam score = 88
title = 'staff trinity united methodist church trinity united methodist church staff trinity united methodist church daring to be different'

distance = 451
spam score = 91
title = 'thank you from reconciling ministries network trinity united methodist church trinity united methodist church thank you from reconciling ministries network trinity united methodist church daring to be different'

distance = 453
spam score = 97
title = 'creating an integrated approach to addressing homelessness 8211 community forum 114 trinity united methodist church trinity united methodist church creating an integrated approach to addressing homelessness 8211 community forum 114 trinity united methodist church daring to be different'

distance = 454
spam score = 92
title = 'update childrens and youth programs trinity united methodist church trinity united methodist church update childrens and youth programs trinity united methodist church daring to be different'

distance = 455
spam score = 93
title = 'first sundays for children amp youth trinity united methodist church trinity united methodist church first sundays for children amp youth trinity united methodist church daring to be different'

distance = 463
spam score = 92
title = 'update regarding potential move additional qampa039s and tours trinity united methodist church trinity united methodist church update regarding potential move additional qampa039s and tours trinity united methodist church daring to be different'

distance = 463
spam score = 92
title = 'update regarding potential move additional qampa8217s and tours trinity united methodist church trinity united methodist church update regarding potential move additional qampa8217s and tours trinity united methodist church daring to be different'

distance = 506
spam score = 96
title = 'methodist federation for social action news trinity united methodist church trinity united methodist church methodist federation for social action news trinity united methodist church daring to be different'

distance = 509
spam score = 91
title = 'incompatible with christian teaching film screening 8211 oct 30 trinity united methodist church trinity united methodist church incompatible with christian teaching film screening 8211 oct 30 trinity united methodist church daring to be different'

distance = 510
spam score = 90
title = 'incompatible with christian teaching film screening 8211 oct 30 trinity united methodist church trinity united methodist church incompatible with christian teaching film screening 8211 oct 30 trinity united methodist church daring to be different'

distance = 510
spam score = 95
title = 'amy duncan 8211 administrator trinity united methodist church trinity united methodist church amy duncan 8211 administrator trinity united methodist church daring to be different'

distance = 511
spam score = 95
title = 'hyde park homes tour 2011 trinity united methodist church trinity united methodist church hyde park homes tour 2011 trinity united methodist church daring to be different'

distance = 512
spam score = 96
title = 'volunteer request trinity to provide meals to clergy families at 8220phoenix8221 church trinity united methodist church trinity united methodist church volunteer request trinity to provide meals to clergy families at 8220phoenix8221 church trinity united methodist church daring to be different'

distance = 513
spam score = 95
title = 'commitment to lgbt inclusion trinity united methodist church trinity united methodist church commitment to lgbt inclusion trinity united methodist church daring to be different'

distance = 514
spam score = 87
title = 'umc making peace after 911 trinity united methodist church trinity united methodist church umc making peace after 911 trinity united methodist church daring to be different'

distance = 520
spam score = 87
title = 'jimmy creech weekend 8211 may 7 amp 8 trinity united methodist church trinity united methodist church jimmy creech weekend 8211 may 7 amp 8 trinity united methodist church daring to be different'

distance = 520
spam score = 87
title = 'jimmy creech weekend 8211 may 7 amp 8 trinity united methodist church trinity united methodist church jimmy creech weekend 8211 may 7 amp 8 trinity united methodist church daring to be different'

distance = 576
spam score = 87
title = 'events trinity united methodist church trinity united methodist church events trinity united methodist church daring to be different'

distance = 579
spam score = 88
title = 'hope food pantry hunger meal 8211 feb 20th trinity united methodist church trinity united methodist church hope food pantry hunger meal 8211 feb 20th trinity united methodist church daring to be different'

distance = 587
spam score = 79
title = 'trinity039s christmas letter 2010 trinity united methodist church trinity united methodist church trinity039s christmas letter 2010 trinity united methodist church daring to be different'

distance = 600
spam score = 94
title = 'sunday meditation history of mother8217s day trinity united methodist church trinity united methodist church sunday meditation history of mother8217s day trinity united methodist church daring to be different'

distance = 600
spam score = 94
title = 'sunday meditation history of mother039s day trinity united methodist church trinity united methodist church sunday meditation history of mother039s day trinity united methodist church daring to be different'

distance = 604
spam score = 96
title = 'creationspirituality trinity united methodist church trinity united methodist church creationspirituality trinity united methodist church daring to be different'

distance = 606
spam score = 97
title = 'wna 8211 spring session 3 starts april 25 trinity united methodist church trinity united methodist church wna 8211 spring session 3 starts april 25 trinity united methodist church daring to be different'

distance = 615
spam score = 95
title = 'children trinity united methodist church trinity united methodist church children trinity united methodist church daring to be different'

distance = 618
spam score = 95
title = 'national campaign yields tree planting at garner state park trinity united methodist church trinity united methodist church national campaign yields tree planting at garner state park trinity united methodist church daring to be different'

distance = 619
spam score = 98
title = 'pastors for peace caravan update trinity united methodist church trinity united methodist church pastors for peace caravan update trinity united methodist church daring to be different'

distance = 1146
spam score = 98
title = 'wna 8211 spring session 3 trinity united methodist church trinity united methodist church wna 8211 spring session 3 trinity united methodist church daring to be different'

distance = 1146
spam score = 97
title = 'wna 8211 spring session 3 trinity united methodist church trinity united methodist church wna 8211 spring session 3 trinity united methodist church daring to be different'

distance = 1146
spam score = 98
title = 'wna 8211 spring session 3 trinity united methodist church trinity united methodist church wna 8211 spring session 3 trinity united methodist church daring to be different'

distance = 1146
spam score = 98
title = 'wna 8211 spring session 3 trinity united methodist church trinity united methodist church wna 8211 spring session 3 trinity united methodist church daring to be different'

distance = 1241
spam score = 97
title = 'wna 8211 spring session 3 trinity united methodist church trinity united methodist church wna 8211 spring session 3 trinity united methodist church daring to be different'

distance = 145
spam score = 20
title = 'cruisefaneu 124 blog 124 change is in the waters the age'

distance = 160
spam score = 18
title = 'cruisefaneu 124 blog 124 dream of being discovered'

distance = 179
spam score = 17
title = 'cruisefaneu 124 blog 124 people on the move sunsentinel'

distance = 179
spam score = 17
title = 'cruisefaneu 124 blog 124 people on the move sunsentinel'

distance = 188
spam score = 24
title = 'cruisefaneu 124 blog 124 princess cruises to enter japanese market focus on travel news'

distance = 191
spam score = 11
title = 'cruisefaneu 124 blog 124 it039s official cruises are for lovers travel market report'

distance = 198
spam score = 16
title = 'cruisefaneu 124 blog 124 what039s not included in 039allinclusive039 vancouver sun'

distance = 205
spam score = 22
title = 'cruisefaneu 124 blog 124 gibraltar at cruise shipping miami panorama'

distance = 206
spam score = 16
title = 'cruisefaneu 124 blog 124 cruise ship passengers in nz to soar new zealand herald'

distance = 209
spam score = 26
title = 'cruisefaneu 124 blog 124 jamaican news amp announcements jamaicanscom'

distance = 218
spam score = 20
title = 'cruisefaneu 124 blog 124 the passengers have spoken vancouver sun'

distance = 218
spam score = 18
title = 'cruisefaneu 124 blog 124 change of plan for stricken liner daily post north wales'

distance = 221
spam score = 12
title = 'cruisefaneu 124 blog 124 new ships hit seas and rivers the province'

distance = 221
spam score = 12
title = 'cruisefaneu 124 blog 124 new ships hit seas and rivers the province'

distance = 222
spam score = 14
title = 'cruisefaneu 124 blog 124 best cruise deals of the week adelaide now'

distance = 222
spam score = 14
title = 'cruisefaneu 124 blog 124 best cruise deals of the week adelaide now'

distance = 225
spam score = 20
title = 'cruisefaneu 124 blog 124 change is in the waters sydney morning herald'

distance = 226
spam score = 21
title = 'cruisefaneu 124 blog 124 video small businesses big stress globe and mail'

distance = 229
spam score = 19
title = 'cruisefaneu 124 blog 124 showdown in glacierbaynp'

distance = 230
spam score = 10
title = 'cruisefaneu 124 blog 124 cruises in crisis around the tip of south america as political disputes chicago tribune'

distance = 247
spam score = 16
title = 'cruisefaneu 124 blog 124 how i met neil patrick harris about news amp issues'

distance = 247
spam score = 16
title = 'cruisefaneu 124 blog 124 europe039s old wealth seeks new home in asia reuters'

distance = 247
spam score = 19
title = 'cruisefaneu 124 blog 124 new restaurants for regent seven seas compareaway'

distance = 249
spam score = 16
title = 'cruisefaneu 124 blog 124 europe039s old wealth seeks new home in asia msnbccom'

distance = 249
spam score = 5
title = 'cruisefaneu 124 blog 124 a15 million cruise package on sale yahoo7 news'

distance = 249
spam score = 18
title = 'cruisefaneu 124 blog 124 cruise lines to screen euro 2012 matches telegraphcouk'

distance = 250
spam score = 17
title = 'cruisefaneu 124 blog 124 carnival can right the ship barron039s'

distance = 250
spam score = 14
title = 'cruisefaneu 124 blog 124 royal ship to grace our shores tvnz'

distance = 250
spam score = 17
title = 'cruisefaneu 124 blog 124 carnival can right the ship barron039s'

distance = 251
spam score = 18
title = 'cruisefaneu 124 blog 124 retire with fred olsen039s special dedicated package cruise ship news'

distance = 268
spam score = 17
title = 'cruisefaneu 124 blog 124 oman looks to attract cruise ship business arabianbusinesscom'

distance = 269
spam score = 22
title = 'cruisefaneu 124 blog 124 cruise giant arrives on the tyne shields gazette'

distance = 269
spam score = 17
title = 'cruisefaneu 124 blog 124 sick ship now clean ready to depart cbs local'

distance = 272
spam score = 17
title = 'cruisefaneu 124 blog 124 stricken cruise liner towed to safety discovery news'

distance = 274
spam score = 15
title = 'cruisefaneu 124 blog 124 sick ship now clean departs s fla cbs local'

distance = 278
spam score = 16
title = 'cruisefaneu 124 blog 124 yellow shoes walks off with addy armful orlando sentinel'

distance = 278
spam score = 14
title = 'cruisefaneu 124 blog 124 yellow shoes walks off with addy armful orlando sentinel'

distance = 279
spam score = 23
title = 'cruisefaneu 124 blog 124 land of the rising sun princess etravelblackboard asia edition'

distance = 279
spam score = 22
title = 'cruisefaneu 124 blog 124 mexico tourism board promotes cruise destinations in miami eturbonews'

distance = 280
spam score = 20
title = 'cruisefaneu 124 blog 124 cruise travellers are welcomed to the telegraph cruise show by millennium marketwatch press release'

distance = 291
spam score = 18
title = 'cruisefaneu 124 blog 124 final glance leisure companies cbs news'

distance = 293
spam score = 19
title = 'cruisefaneu 124 blog 124 yoga cruises salute the sun in the mediterranean telegraphcouk'

distance = 293
spam score = 16
title = 'cruisefaneu 124 blog 124 bank bosses lap up luxury lifestyle while the rest suffer herald sun'

distance = 293
spam score = 19
title = 'cruisefaneu 124 blog 124 yoga cruises salute the sun in the mediterranean telegraphcouk'

distance = 294
spam score = 13
title = 'cruisefaneu 124 blog 124 dynamite entertainment previews this weeks new comics the fandom post'

distance = 295
spam score = 13
title = 'cruisefaneu 124 blog 124 johnson gb039s cruise growth did not happen by chance the freeport news'

distance = 295
spam score = 13
title = 'cruisefaneu 124 blog 124 johnson gb039s cruise growth did not happen by chance the freeport news'

distance = 295
spam score = 13
title = 'cruisefaneu 124 blog 124 celebrity boosts alaska fleet vancouver sun'

distance = 295
spam score = 17
title = 'cruisefaneu 124 blog 124 5 troubles on carnival cruises cbcca'

distance = 295
spam score = 16
title = 'cruisefaneu 124 blog 124 5 troubles on carnival cruises cbcca'

distance = 306
spam score = 20
title = 'cruisefaneu 124 blog 124 silversea offers new food and wine shore excursions travel agent'

distance = 307
spam score = 17
title = 'cruisefaneu 124 blog 124 regent seven seas039 profit dips 25 in 2011 travel weeekly'

distance = 309
spam score = 18
title = 'cruisefaneu 124 blog 124 costa cruises liner towed to seychelles039 main island moneycontrolcom'

distance = 309
spam score = 18
title = 'cruisefaneu 124 blog 124 costa cruises liner towed to seychelles039 main island moneycontrolcom'

distance = 311
spam score = 15
title = 'cruisefaneu 124 blog 124 regent seven seas to launch new restaurant fleetwide baltimore sun'

distance = 312
spam score = 16
title = 'cruisefaneu 124 blog 124 hurtigruten smadret kai lofotposten'

distance = 313
spam score = 21
title = 'cruisefaneu 124 blog 124 cruise travellers are welcomed to the telegraph cruise show by millennium syscon media press release'

distance = 313
spam score = 21
title = 'cruisefaneu 124 blog 124 cruise travellers are welcomed to the telegraph cruise show by millennium syscon media press release'

distance = 318
spam score = 29
title = 'cruisefaneu 124 blog 124 luxury liner brings tourism boost itv news'

distance = 319
spam score = 23
title = 'cruisefaneu 124 blog 124 capsized costa concordia to be refloated zee news'

distance = 327
spam score = 13
title = 'cruisefaneu 124 blog 124 new cheapism research finds the best cheap cruises for frugal travelers pr web press release'

distance = 327
spam score = 13
title = 'cruisefaneu 124 blog 124 new cheapism research finds the best cheap cruises for frugal travelers pr web press release'

distance = 327
spam score = 15
title = 'cruisefaneu 124 blog 124 disney names its latest cruise ship as costa039s troubles rumble on yahoo philippines news'

distance = 329
spam score = 10
title = 'cruisefaneu 124 blog 124 royal caribbean presents plans for new cruise terminal in uruguay royal caribbean blog blog'

distance = 331
spam score = 13
title = 'cruisefaneu 124 blog 124 new cheapism research finds the best cheap cruises for frugal travelers virtualstrategy magazine'

distance = 332
spam score = 12
title = 'cruisefaneu 124 blog 124 a new pete dye golf course isn039t all that039s waiting for you in roatan globe and mail'

distance = 332
spam score = 11
title = 'cruisefaneu 124 blog 124 survivors coast guard and cruise industry execs testify before us house committee travel agent'

distance = 332
spam score = 12
title = 'cruisefaneu 124 blog 124 survivors coast guard and cruise industry execs testify before us house committee travel agent'

distance = 333
spam score = 21
title = 'cruisefaneu 124 blog 124 rep gabby giffords and astronaut mark kelly land on crystal cruises this summer sacramento bee'

distance = 334
spam score = 21
title = 'cruisefaneu 124 blog 124 second cruise line confirms prince rupert stop for 2013 season cjfw'

distance = 341
spam score = 24
title = 'cruisefaneu 124 blog 124 royal caribbean wins cruise line brand of the year award royal caribbean blog blog'

distance = 341
spam score = 24
title = 'cruisefaneu 124 blog 124 royal caribbean wins cruise line brand of the year award royal caribbean blog blog'

distance = 343
spam score = 20
title = 'cruisefaneu 124 blog 124 gioco viaggi l039agenzia di viaggi'

distance = 344
spam score = 21
title = 'cruisefaneu 124 blog 124 carnival names new head of costa group as unit039s ceo retires 4traders'

distance = 344
spam score = 13
title = 'cruisefaneu 124 blog 124 princess cruises puts royal princess inaugural cruise tickets up for auction marketwatch press release'

distance = 344
spam score = 16
title = 'cruisefaneu 124 blog 124 disney cruise line putting tea cups back in the cupboard baltimore sun'

distance = 344
spam score = 13
title = 'cruisefaneu 124 blog 124 princess cruises puts royal princess inaugural cruise tickets up for auction marketwatch press release'

distance = 344
spam score = 23
title = 'cruisefaneu 124 blog 124 star clippers l039agenzia di viaggi'

distance = 344
spam score = 15
title = 'cruisefaneu 124 blog 124 disney cruise line putting tea cups back in the cupboard baltimore sun'

distance = 346
spam score = 13
title = 'cruisefaneu 124 blog 124 costa cruises boss to step down six months after concordia tragedy travelmole'

distance = 352
spam score = 12
title = 'cruisefaneu 124 blog 124 globetrekking couple sets sail with princess scvnewscom'

distance = 358
spam score = 20
title = 'cruisefaneu 124 blog 124 lankan ports to play vital role in tourism dr wickrama nation on sunday'

distance = 359
spam score = 15
title = 'cruisefaneu 124 blog 124 celebrity millennium ushers in second asia itinerary ttg asia'

distance = 361
spam score = 13
title = 'cruisefaneu 124 blog 124 travel club complaints inspired sea to ski vacations to offer access to the albany times union'

distance = 366
spam score = 25
title = 'cruisefaneu 124 blog 124 sced visits cruise liner and data centre 7thspace interactive press release'

distance = 366
spam score = 15
title = 'cruisefaneu 124 blog 124 tycoons accused of corruption thaksin039s new year party in laos burma rising phuketwan'

distance = 366
spam score = 15
title = 'cruisefaneu 124 blog 124 tycoons accused of corruption thaksin039s new year party in laos burma rising phuketwan'

distance = 367
spam score = 14
title = 'cruisefaneu 124 blog 124 love boat star hosts lucky couple auckland stuffconz'

distance = 367
spam score = 14
title = 'cruisefaneu 124 blog 124 royal circumnavigation sparks influx of australasian booking scoopconz press release'

distance = 370
spam score = 9
title = 'cruisefaneu 124 blog 124 disney fantasy arrives in new york baltimore sun'

distance = 396
spam score = 20
title = 'cruisefaneu 124 blog 124 hebridean receives queen039s royal warrant as sister operator plans to add new ship travel weekly uk'

distance = 405
spam score = 10
title = 'cruisefaneu 124 blog 124 pier luigi foschi to retire as ceo of costa group will continue to serve as marketwatch press release'

distance = 406
spam score = 7
title = 'cruisefaneu 124 blog 124 royal caribbean ship emerges from massive makeover usa today'

distance = 406
spam score = 7
title = 'cruisefaneu 124 blog 124 royal caribbean ship emerges from massive makeover usa today'

distance = 410
spam score = 17
title = 'cruisefaneu 124 blog 124 aida cara atracar en santander con 1144 pasajeros la mayora alemanes y ques'

distance = 411
spam score = 16
title = 'cruisefaneu 124 blog 124 azamara journey maiden call nyc and titanic memorial voyage examinercom'

distance = 416
spam score = 15
title = 'cruisefaneu 124 blog 124 silversea appoints cecilia s blevins to corporate and incentive sales director travel agent'

distance = 417
spam score = 22
title = 'cruisefaneu 124 blog 124 royal caribbean believes impact of costa concordia is normalizing royal caribbean blog blog'

distance = 422
spam score = 14
title = 'cruisefaneu 124 blog 124 royal caribbean cruises ltd first quarter earnings sneak peek wall st cheat sheet'

distance = 426
spam score = 12
title = 'cruisefaneu 124 blog 124 agents to win a cruise a day 039don039t wait book now039 with royal caribbean itcm'

distance = 1504
spam score = 24
title = 'silver whisper silver whisper ship silver whisper ship deals'

distance = 1510
spam score = 25
title = 'silver spirit silver spirit ship silver spirit ship deals'

distance = 1524
spam score = 16
title = 'silversea cruises ships silversea cruise ships silversea cruise ship deals'

distance = 1535
spam score = 22
title = 'seabourn spirit seabourn spirit ship seabourn spirit ship deals'

distance = 257
spam score = 13
title = ''

distance = 278
spam score = 6
title = ''

distance = 332
spam score = 7
title = ''

distance = 341
spam score = 4
title = ''

distance = 397
spam score = 3
title = ''

distance = 397
spam score = 3
title = ''

distance = 462
spam score = 4
title = ''

distance = 487
spam score = 6
title = ''

distance = 515
spam score = 5
title = ''

distance = 525
spam score = 4
title = ''

distance = 545
spam score = 3
title = ''

distance = 548
spam score = 3
title = ''

distance = 83
spam score = 86
title = 'becoming a what ellison chair in international floriculture'

distance = 83
spam score = 90
title = 'i039l like it in the arm please ellison chair in international floriculture'

distance = 113
spam score = 88
title = 'what are we teaching the next generation ellison chair in international floriculture'

distance = 115
spam score = 87
title = 'light at the end of a long tunnel ellison chair in international floriculture'

distance = 119
spam score = 87
title = 'transition time ellison chair in international floriculture'

distance = 123
spam score = 88
title = 'the longrun stock perspective ellison chair in international floriculture'

distance = 129
spam score = 88
title = 'on the road again ellison chair in international floriculture'

distance = 136
spam score = 86
title = 'where will it all go ellison chair in international floriculture'

distance = 136
spam score = 87
title = 'hmmm8230 ellison chair in international floriculture'

distance = 137
spam score = 92
title = 'do price increases reflect value ellison chair in international floriculture'

distance = 138
spam score = 87
title = 'mother039s day radio segment ellison chair in international floriculture'

distance = 138
spam score = 89
title = 'economy amp housing roundup ellison chair in international floriculture'

distance = 139
spam score = 88
title = 'fire yourself today ellison chair in international floriculture'

distance = 140
spam score = 83
title = 'starbucks vs the little guy ellison chair in international floriculture'

distance = 143
spam score = 89
title = 'why companies should not compete on price ellison chair in international floriculture'

distance = 144
spam score = 89
title = 'sorry couldn039t resist ellison chair in international floriculture'

distance = 147
spam score = 87
title = 'more market commentary8230 ellison chair in international floriculture'

distance = 152
spam score = 86
title = 'who won039t be around in 10 years ellison chair in international floriculture'

distance = 157
spam score = 83
title = 'mostly good news8230 ellison chair in international floriculture'

distance = 162
spam score = 88
title = 'american consumption and the new normal ellison chair in international floriculture'

distance = 264
spam score = 83
title = 'backofknapkin health care ellison chair in international floriculture'

distance = 264
spam score = 85
title = 'farm bill sidebyside comparison ellison chair in international floriculture'

distance = 266
spam score = 86
title = 'the effect of the depreciating dollar ellison chair in international floriculture'

distance = 266
spam score = 84
title = 'make your email count ellison chair in international floriculture'

distance = 268
spam score = 90
title = 'more info to factor into your voting decisions ellison chair in international floriculture'

distance = 269
spam score = 89
title = 'companies change strategies for different reasons ellison chair in international floriculture'

distance = 269
spam score = 86
title = 'fuel costs continue to influence driving behavior ellison chair in international floriculture'

distance = 270
spam score = 85
title = 'fight of the century keynes vs hayek round two ellison chair in international floriculture'

distance = 272
spam score = 92
title = 'new agrlite training available ellison chair in international floriculture'

distance = 275
spam score = 86
title = 'cut costs not customer experience ellison chair in international floriculture'

distance = 292
spam score = 71
title = 'gas prices actually do influence driving behavior ellison chair in international floriculture'

distance = 294
spam score = 85
title = 'customer service christmas ellison chair in international floriculture'

distance = 298
spam score = 88
title = 'spanish immersion study program a success ellison chair in international floriculture'

distance = 301
spam score = 75
title = 'why the auto industry is in trouble ellison chair in international floriculture'

distance = 303
spam score = 86
title = 'improvement still slow in coming ellison chair in international floriculture'

distance = 305
spam score = 90
title = 'how to sell services more profitably ellison chair in international floriculture'

distance = 305
spam score = 81
title = 'some good news on the housing front ellison chair in international floriculture'

distance = 306
spam score = 83
title = 'better benchmark for gas prices ellison chair in international floriculture'

distance = 308
spam score = 89
title = 'one small step8230 ellison chair in international floriculture'

distance = 309
spam score = 85
title = 'beware of scorchedearth strategies in climate debates ellison chair in international floriculture'

distance = 336
spam score = 90
title = 'quote of the week ellison chair in international floriculture'

distance = 337
spam score = 83
title = 'say goodbye to the mcmansion ellison chair in international floriculture'

distance = 338
spam score = 84
title = 'quote of the week ellison chair in international floriculture'

distance = 338
spam score = 88
title = 'pay me now or pay me later ellison chair in international floriculture'

distance = 339
spam score = 83
title = '2009 outlook for landscape services ellison chair in international floriculture'

distance = 340
spam score = 82
title = 'latest labor data doesn039t support recession scenario ellison chair in international floriculture'

distance = 344
spam score = 82
title = 'back to the drawing board8230for now ellison chair in international floriculture'

distance = 348
spam score = 87
title = 'valuable data tool available ellison chair in international floriculture'

distance = 349
spam score = 91
title = 'charlie8217s angle ellison chair in international floriculture'

distance = 351
spam score = 85
title = 'seeley conference begins today ellison chair in international floriculture'

distance = 377
spam score = 85
title = 'housing report carries a mixed message ellison chair in international floriculture'

distance = 377
spam score = 87
title = 'identify your employee039s hidden talents ellison chair in international floriculture'

distance = 379
spam score = 78
title = 'free fallin039 ellison chair in international floriculture'

distance = 379
spam score = 79
title = 'comparison of subprime devastation and sampl collapse ellison chair in international floriculture'

distance = 382
spam score = 93
title = 'many thanks to the 2011 nff sponsors ellison chair in international floriculture'

distance = 382
spam score = 83
title = 'register now for water webinar series ellison chair in international floriculture'

distance = 383
spam score = 81
title = 'special national geographic water issue ellison chair in international floriculture'

distance = 383
spam score = 82
title = 'who said economists aren039t funny ellison chair in international floriculture'

distance = 387
spam score = 88
title = 'the nature of extension service delivery and partnerships in the future ellison chair in international floriculture'

distance = 387
spam score = 86
title = 'doing more with fewer ellison chair in international floriculture'

distance = 414
spam score = 83
title = 'what goes up must come down and back up again ellison chair in international floriculture'

distance = 417
spam score = 94
title = 'imf world economic outlook available ellison chair in international floriculture'

distance = 419
spam score = 77
title = 'profitability in a maturing marketplace ellison chair in international floriculture'

distance = 422
spam score = 85
title = 'fertilizer price volatility ellison chair in international floriculture'

distance = 428
spam score = 88
title = 'super bowls ads disappoint ellison chair in international floriculture'

distance = 429
spam score = 86
title = 'lean flow workshops scheduled ellison chair in international floriculture'

distance = 429
spam score = 91
title = 'register now for the 2008 southwest growers conference ellison chair in international floriculture'

distance = 429
spam score = 92
title = 'real versus perceived value ellison chair in international floriculture'

distance = 431
spam score = 86
title = 'walmart and an analysis of sustainability index hiccups ellison chair in international floriculture'

distance = 437
spam score = 82
title = 'how to create jobs ellison chair in international floriculture'

distance = 477
spam score = 80
title = 'ca vineyard tried to hire americans but it was a total failure a 8220social experiment gone awry8221 ellison chair in international floriculture'

distance = 478
spam score = 84
title = 'water issues webinars ellison chair in international floriculture'

distance = 481
spam score = 78
title = 'commentary on last week039s market performance ellison chair in international floriculture'

distance = 486
spam score = 79
title = 'who039s right ellison chair in international floriculture'

distance = 486
spam score = 92
title = 'housing highlights ellison chair in international floriculture'

distance = 488
spam score = 72
title = 'steps businesses should take in the midst of financial crisis ellison chair in international floriculture'

distance = 490
spam score = 86
title = 'existing home sales take off ellison chair in international floriculture'

distance = 491
spam score = 84
title = 'pickup truck sales a green industry indicator ellison chair in international floriculture'

distance = 493
spam score = 76
title = 'stimulus for small business ellison chair in international floriculture'

distance = 493
spam score = 93
title = 'multimedia ellison chair in international floriculture'

distance = 530
spam score = 80
title = 'everybody has an off day ellison chair in international floriculture'

distance = 530
spam score = 84
title = '2007 nga study is available ellison chair in international floriculture'

distance = 532
spam score = 85
title = 'effects of flowering and foliage plants in hospital rooms ellison chair in international floriculture'

distance = 534
spam score = 83
title = 'the cost of quotreformquot ellison chair in international floriculture'

distance = 536
spam score = 72
title = 'proposal on table to tax wealthy to pay for health care ellison chair in international floriculture'

distance = 540
spam score = 85
title = 'biopackaging solutions for horticulture ellison chair in international floriculture'

distance = 542
spam score = 80
title = 'this week039s highlights8230 ellison chair in international floriculture'

distance = 545
spam score = 83
title = 'water webinar series continues ellison chair in international floriculture'

distance = 551
spam score = 88
title = 'housing affordability at record high ellison chair in international floriculture'

distance = 551
spam score = 67
title = 'consumers reducing debt ellison chair in international floriculture'

distance = 609
spam score = 72
title = 'will the real trade issues please stand up ellison chair in international floriculture'

distance = 619
spam score = 87
title = 'pawlow to address water management issues ellison chair in international floriculture'

distance = 625
spam score = 94
title = 'exofficio members ellison chair in international floriculture'

distance = 625
spam score = 84
title = 'columbian free trade debate ellison chair in international floriculture'

distance = 629
spam score = 83
title = 'gdp positive in 2nd quarter but disappoints some ellison chair in international floriculture'

distance = 632
spam score = 85
title = 'greenhouse crop production training course offered online ellison chair in international floriculture'

distance = 633
spam score = 77
title = 'recessionary demographics ellison chair in international floriculture'

distance = 635
spam score = 88
title = 'last call for this year8217s national floriculture forum ellison chair in international floriculture'

distance = 636
spam score = 76
title = 'forecasting retail sales via satellite ellison chair in international floriculture'

distance = 644
spam score = 79
title = 'water webinar series continues ellison chair in international floriculture'

distance = 740
spam score = 93
title = 'advisory committee ellison chair in international floriculture'

distance = 758
spam score = 54
title = 'protectionism doesn039t work folks ellison chair in international floriculture'

distance = 812
spam score = 79
title = 'weather brings retailers a golden egg this easter weekend ellison chair in international floriculture'

distance = 867
spam score = 81
title = 'bus trip to quotpack trialsquot planned ellison chair in international floriculture'

distance = 872
spam score = 75
title = 'the effect of immigration on productivity ellison chair in international floriculture'

distance = 874
spam score = 58
title = 'number of the week ellison chair in international floriculture'

distance = 926
spam score = 93
title = 'distinguished lecture series ellison chair in international floriculture'

distance = 942
spam score = 82
title = 'role of immigrants in us labor market ellison chair in international floriculture'

distance = 109
spam score = 85
title = 'gsc 08112010 nrt processing problems'

distance = 123
spam score = 84
title = 'gsc 04022011 maintenance on eolisa system'

distance = 135
spam score = 83
title = 'gsc 29062010 envisat1 unavailability report'

distance = 140
spam score = 90
title = 'gsc 18162010 alos production status update'

distance = 142
spam score = 87
title = 'gsc 20100305 ers2 ami unavailability'

distance = 150
spam score = 85
title = 'gsc 19102011 cds unexpected downtime'

distance = 150
spam score = 87
title = 'gsc 20100512 ukdmc1 unavailability'

distance = 152
spam score = 85
title = 'gsc 08022011 maintenance on eolisa system'

distance = 156
spam score = 86
title = 'gsc 19102010 kompsat2 interruption to operations'

distance = 156
spam score = 86
title = 'gsc 10052011 ers2 unavailability report ra unavailability start'

distance = 158
spam score = 86
title = 'gsc 17082010 update on cds'

distance = 159
spam score = 88
title = 'gsc 26032012 download issue'

distance = 159
spam score = 89
title = 'gsc 25102010 alos data dissemination'

distance = 160
spam score = 87
title = 'gsc 30032011 ers2 ra instrument unavailability'

distance = 161
spam score = 87
title = 'gsc 30092010 ers2 unavailability report ami unavailability start'

distance = 162
spam score = 86
title = 'gsc 08072010 ers2 unavailability report 2010019'

distance = 162
spam score = 86
title = 'gsc 19032012 maintenance on eolisa system'

distance = 163
spam score = 83
title = 'gsc 04012011 ers2 ami planned unavailability'

distance = 163
spam score = 84
title = 'gsc 04012011 ers2 ami planned unavailability'

distance = 170
spam score = 86
title = 'gsc 13022012 cdsoda unavailability'

distance = 204
spam score = 85
title = 'gsc 13022012 cosmoskymed sar3 unavailability report'

distance = 205
spam score = 90
title = 'gsc 15032012 anomaly in 27 core01 coverage 2 delivered products'

distance = 206
spam score = 89
title = 'gsc 20052010 new release of eolisa v 706 available on line'

distance = 207
spam score = 85
title = 'gsc 24012012 oda maintenance on 26012012'

distance = 207
spam score = 83
title = 'gsc 28062010 dpac dpaf downtime'

distance = 208
spam score = 85
title = 'gsc 09032012 cosmoskymed sar2 unavailability report'

distance = 208
spam score = 87
title = 'gsc 29042009 interruption of envisat satellite data transmission'

distance = 208
spam score = 85
title = 'gsc 13032012 cosmoskymed sar3 unavailability report'

distance = 209
spam score = 86
title = 'gsc 06102010 network downtime at esrin completed'

distance = 210
spam score = 88
title = 'gsc 21072009 gscda web portal maintenance'

distance = 238
spam score = 88
title = 'gsc 05052010 pdhse esrin online archive operations resumed'

distance = 240
spam score = 82
title = 'gsc 22022011 landsat5 engineering activities tm outgas'

distance = 241
spam score = 89
title = 'gsc 18112010 maintenance at pdhsk kiruna thursday 18 november 2010'

distance = 242
spam score = 87
title = 'gsc 17012011 envisat mipas instrument unavailability'

distance = 245
spam score = 87
title = 'gsc 18062010 hyderabad se india ers2 station unavailability'

distance = 246
spam score = 88
title = 'gsc 14122010 alos nrt dissemination suspended at tromsoe'

distance = 246
spam score = 85
title = 'gsc 10052011 gscda services fully recovered after power maintenance'

distance = 247
spam score = 86
title = 'gsc 24032011 envisat mipas instrument unavailability'

distance = 248
spam score = 84
title = 'gsc 21062010 cosmo skymed unavailability icugs'

distance = 248
spam score = 88
title = 'gsc 03012011 envisat mipas instrument unavailability'

distance = 271
spam score = 85
title = 'gsc 27102010 envisat mipas instrument planned unavailability'

distance = 272
spam score = 84
title = 'gsc 09032011 envisat mipas instrument return to operation'

distance = 272
spam score = 88
title = 'gsc 13042010 april 2010 mipas planned instrument decontamination between 2028 april 2010'

distance = 272
spam score = 84
title = 'gsc 20122010 envisat mipas instrument return to operation'

distance = 272
spam score = 83
title = 'gsc 28032011 envisat mipas instrument return to operation'

distance = 273
spam score = 91
title = 'gsc 14122010 envisat catalogue and data ordering'

distance = 275
spam score = 84
title = 'gsc 06042011 envisat mipas instrument return to operation'

distance = 275
spam score = 87
title = 'gsc 08112010 mipas level 2 nrt processing problems'

distance = 275
spam score = 83
title = 'gsc 20091221 pdhse esrin ra2 production degraded'

distance = 275
spam score = 83
title = 'gsc 11032011 envisat mipas instrument return to operation'

distance = 304
spam score = 87
title = 'gsc latest new 08022011 eusi integration status'

distance = 304
spam score = 88
title = 'gsc 04102010 maintenance at pdhsk kiruna 04 and 06 october 2010'

distance = 306
spam score = 89
title = 'gsc 28042010 mipas instrument decontamination 0512 may 2010'

distance = 306
spam score = 77
title = 'gsc 07012009 envisat maintenance'

distance = 306
spam score = 83
title = 'gsc 04052011 spotimage momentary interruption of the 247 emergency service'

distance = 306
spam score = 86
title = 'gsc 28012011 extension of esajaxa agreement for alos data distribution'

distance = 307
spam score = 87
title = 'gsc ccd'

distance = 307
spam score = 84
title = 'gsc 21102010 modis rolling archive missing products update from cqc'

distance = 307
spam score = 91
title = 'gsc 16042010 eolisa alos future ordering disabled'

distance = 313
spam score = 86
title = 'gsc 23032011 envisat scia instrument unavailability'

distance = 346
spam score = 91
title = 'gsc 06092010 rapideye orr successfully passed'

distance = 348
spam score = 89
title = 'gsc latest new 27042011 interruption of kompsat2 mission availability via gscda'

distance = 349
spam score = 84
title = 'gsc 16072009 spot4 and spot5 nonprogramming zone due to sun eclipse'

distance = 350
spam score = 85
title = 'gsc 05102010cds online data access nonavailability'

distance = 350
spam score = 78
title = 'gsc 23072010 ers2 unavailability report er2una20100025'

distance = 351
spam score = 91
title = 'gsc 15112010 enhanced contribution from egeos to the gmes emergency satellite tasking service'

distance = 352
spam score = 87
title = 'gsc 24062010 sentinel1 pdgs contract award and kickoff'

distance = 352
spam score = 87
title = 'gsc 12052011 alos operations completed'

distance = 353
spam score = 88
title = 'gsc rsi'

distance = 353
spam score = 84
title = 'gsc 08072010 envisat unavailability report enuna20100108'

distance = 402
spam score = 82
title = 'gsc 20100310 planned asar antenna maintenance'

distance = 402
spam score = 82
title = 'gsc 03092009 maintenance at pdhsk kiruna back to operation'

distance = 413
spam score = 86
title = 'gsc 02092009 maintenance at pdhsk kiruna wednesday 2 september 2009 update'

distance = 420
spam score = 85
title = 'gsc 23072009 pdhse esrin envisat nrt service resumed'

distance = 420
spam score = 86
title = 'gsc latest new 08032011 gscda operations workshop announcement'

distance = 420
spam score = 89
title = 'gsc 29062010 nrt processing problems'

distance = 421
spam score = 85
title = 'gsc 28072009 pdhsk kiruna nrt service'

distance = 421
spam score = 85
title = 'gsc 29072009 pdhsk kiruna nrt services resumed'

distance = 421
spam score = 91
title = 'gsc latest new 20102011 data warehouse offer dap v22 now available'

distance = 422
spam score = 89
title = 'gsc latest 20090909 new gcm contracts kicked off'

distance = 469
spam score = 92
title = 'gsc latest new 07062011 data warehouse offer dap v2 now available'

distance = 469
spam score = 95
title = 'gsc avnir2'

distance = 470
spam score = 90
title = 'gsc 27102010 imagesat orr successfully passed'

distance = 481
spam score = 87
title = 'gsc 03032010 web news odadns schedule maintenance esrin 0607mar2010'

distance = 482
spam score = 94
title = 'gsc landsat tm'

distance = 486
spam score = 90
title = 'gsc latest new 26092011 qa4eo workshop on providing harmonised quality information in earth observation data by 2015'

distance = 488
spam score = 88
title = 'gsc 22012009 envisat orbit control manoeuvre'

distance = 496
spam score = 86
title = 'gsc 20012009 envisat pdhsk kiruna nrt operations'

distance = 501
spam score = 89
title = 'gsc latest new 04102011 access to terrasarx data according to german satellite data security law'

distance = 502
spam score = 87
title = 'gsc 05012010 asar disclaimer antenna gain problem'

distance = 548
spam score = 93
title = 'gsc quickbird2'

distance = 552
spam score = 95
title = 'gsc worldview2'

distance = 554
spam score = 86
title = 'gsc downstream services'

distance = 558
spam score = 89
title = 'gsc lissiv'

distance = 559
spam score = 95
title = 'gsc resource details'

distance = 576
spam score = 85
title = 'gsc 19032010 envisat atmospheric data availability'

distance = 592
spam score = 86
title = 'gsc news 06022009'

distance = 611
spam score = 86
title = 'gsc 09062010 mipas processor version 505 activation schedule'

distance = 613
spam score = 88
title = 'gsc irs p5 cartosat 1'

distance = 617
spam score = 89
title = 'gsc latest 20091112 all gcms contracts kickedoff'

distance = 80
spam score = 85
title = ''

distance = 98
spam score = 84
title = ''

distance = 124
spam score = 85
title = ''

distance = 135
spam score = 85
title = ''

distance = 135
spam score = 84
title = ''

distance = 171
spam score = 86
title = ''

distance = 186
spam score = 82
title = ''

distance = 193
spam score = 84
title = ''

distance = 204
spam score = 92
title = ''

distance = 208
spam score = 86
title = ''

distance = 238
spam score = 85
title = ''

distance = 259
spam score = 84
title = ''

distance = 286
spam score = 84
title = ''

distance = 306
spam score = 86
title = ''

distance = 307
spam score = 84
title = ''

distance = 308
spam score = 52
title = ''

distance = 309
spam score = 89
title = ''

distance = 334
spam score = 43
title = ''

distance = 348
spam score = 83
title = ''

distance = 355
spam score = 91
title = ''

distance = 363
spam score = 81
title = ''

distance = 371
spam score = 60
title = ''

distance = 383
spam score = 90
title = ''

distance = 401
spam score = 88
title = ''

distance = 427
spam score = 85
title = ''

distance = 431
spam score = 90
title = ''

distance = 455
spam score = 71
title = ''

distance = 500
spam score = 85
title = ''

distance = 543
spam score = 85
title = ''

distance = 558
spam score = 62
title = ''

distance = 638
spam score = 50
title = ''

distance = 698
spam score = 86
title = ''

distance = 710
spam score = 87
title = ''

distance = 1493
spam score = 96
title = ''

distance = 131
spam score = 37
title = 'may 2009 animesunday at dragons lair raquo animesundayorg'

distance = 131
spam score = 35
title = 'may 2010 animesunday at dragons lair raquo animesundayorg'

distance = 131
spam score = 35
title = 'may 2011 animesunday at dragons lair raquo animesundayorg'

distance = 136
spam score = 36
title = 'august 2009 animesunday at dragons lair raquo animesundayorg'

distance = 136
spam score = 32
title = 'august 2008 animesunday at dragons lair raquo animesundayorg'

distance = 138
spam score = 34
title = 'july 2011 animesunday at dragons lair raquo animesundayorg'

distance = 140
spam score = 41
title = 'january 2009 animesunday at dragons lair raquo animesundayorg'

distance = 140
spam score = 38
title = 'january 2012 animesunday at dragons lair raquo animesundayorg'

distance = 142
spam score = 37
title = 'july 2009 animesunday at dragons lair raquo animesundayorg'

distance = 143
spam score = 34
title = 'june 2010 animesunday at dragons lair raquo animesundayorg'

distance = 144
spam score = 36
title = 'december 2010 animesunday at dragons lair raquo animesundayorg'

distance = 144
spam score = 35
title = 'december 2011 animesunday at dragons lair raquo animesundayorg'

distance = 144
spam score = 37
title = 'december 2009 animesunday at dragons lair raquo animesundayorg'

distance = 145
spam score = 35
title = 'september 2010 animesunday at dragons lair raquo animesundayorg'

distance = 145
spam score = 34
title = 'september 2011 animesunday at dragons lair raquo animesundayorg'

distance = 145
spam score = 35
title = 'september 2009 animesunday at dragons lair raquo animesundayorg'

distance = 146
spam score = 36
title = 'march 2012 animesunday at dragons lair raquo animesundayorg'

distance = 147
spam score = 35
title = 'august 2010 animesunday at dragons lair raquo animesundayorg'

distance = 149
spam score = 35
title = 'july 2010 animesunday at dragons lair raquo animesundayorg'

distance = 150
spam score = 35
title = 'november 2008 animesunday at dragons lair raquo animesundayorg'

distance = 181
spam score = 35
title = 'november 2010 animesunday at dragons lair raquo animesundayorg'

distance = 182
spam score = 38
title = 'february 2011 animesunday at dragons lair raquo animesundayorg'

distance = 182
spam score = 42
title = 'february 2009 animesunday at dragons lair raquo animesundayorg'

distance = 185
spam score = 30
title = 'may 2008 animesunday at dragons lair raquo animesundayorg'

distance = 190
spam score = 40
title = 'may animesunday at dragon8217s lair 8211 may 15 2005 raquo animesundayorg'

distance = 197
spam score = 36
title = 'february 2010 animesunday at dragons lair raquo animesundayorg'

distance = 199
spam score = 35
title = 'april 2008 animesunday at dragons lair 8211 april 20th 2008 raquo animesundayorg'

distance = 206
spam score = 34
title = 'november animesunday at dragons lair 8211 november 20 2005 raquo animesundayorg'

distance = 206
spam score = 41
title = 'august animesunday at dragons lair 8211 august 20th 2006 raquo animesundayorg'

distance = 206
spam score = 40
title = 'august 2007 animesunday at dragon8217s lair 8211 august 19th 2007 raquo animesundayorg'

distance = 222
spam score = 37
title = 'march 2008 animesunday at dragons lair 8211 march 16th 2008 raquo animesundayorg'

distance = 223
spam score = 40
title = 'december 2007 animesunday at dragons lair 8211 december 16th 2007 raquo animesundayorg'

distance = 224
spam score = 40
title = 'december animesunday at dragons lair 8211 december 18 2005 raquo animesundayorg'

distance = 225
spam score = 43
title = 'february animesunday at dragons lair 8211 february 19 2006 raquo animesundayorg'

distance = 229
spam score = 40
title = 'october animesunday at dragon8217s lair 8211 october 15th 2006 raquo animesundayorg'

distance = 229
spam score = 43
title = 'december animesunday at dragons lair 8211 december 17th 2006 raquo animesundayorg'

distance = 233
spam score = 35
title = 'july animesunday at dragons lair 8211 july 17 2005 raquo animesundayorg'

distance = 235
spam score = 41
title = 'march animesunday at dragons lair 8211 march 18th 2007 raquo animesundayorg'

distance = 237
spam score = 33
title = 'june animesunday at dragons lair 8211 june 19 2005 raquo animesundayorg'

distance = 242
spam score = 39
title = 'october animesunday at dragons lair 8211 october 16 2005 raquo animesundayorg'

distance = 370
spam score = 34
title = '2012 march raquo animesundayorg'

distance = 386
spam score = 37
title = 'june animesunday at dragons lair 8211 june 19 2005 raquo animesundayorg'

distance = 393
spam score = 40
title = '2011 february 19 raquo animesundayorg'

distance = 396
spam score = 38
title = '2012 january raquo animesundayorg'

distance = 396
spam score = 39
title = '2012 january 4 raquo animesundayorg'

distance = 397
spam score = 35
title = '2011 february 24 raquo animesundayorg'

distance = 397
spam score = 38
title = '2012 february 17 raquo animesundayorg'

distance = 397
spam score = 39
title = '2012 february raquo animesundayorg'

distance = 401
spam score = 38
title = '2011 april 17 raquo animesundayorg'

distance = 401
spam score = 39
title = '2011 april raquo animesundayorg'

distance = 422
spam score = 42
title = '2010 december raquo animesundayorg'

distance = 422
spam score = 41
title = '2010 december 4 raquo animesundayorg'

distance = 428
spam score = 36
title = '2011 august raquo animesundayorg'

distance = 428
spam score = 29
title = 'animesunday schedule raquo animesundayorg'

distance = 428
spam score = 37
title = '2011 august 5 raquo animesundayorg'

distance = 431
spam score = 37
title = '2010 november raquo animesundayorg'

distance = 431
spam score = 37
title = '2010 november 15 raquo animesundayorg'

distance = 431
spam score = 44
title = 'february animesunday at dragon8217s lair 8211 february 19th 2006 raquo animesundayorg'

distance = 432
spam score = 39
title = 'march animesunday at dragons lair 8211 march 19th 2006 raquo animesundayorg'

distance = 433
spam score = 35
title = '2011 june raquo animesundayorg'

distance = 457
spam score = 35
title = 'may animesunday at dragons lair 8211 may 21st 2006 raquo animesundayorg'

distance = 464
spam score = 43
title = 'september animesunday at dragon8217s lair 8211 september 17 2006 raquo animesundayorg'

distance = 467
spam score = 45
title = 'july animesunday at dragons lair 8211 july 16th 2006 raquo animesundayorg'

distance = 469
spam score = 39
title = 'august animesunday at dragons lair 8211 august 20th 2006 raquo animesundayorg'

distance = 470
spam score = 34
title = 'november 2007 animesunday at dragons lair 8211 november 18th 2007 raquo animesundayorg'

distance = 470
spam score = 39
title = 'april animesunday at dragons lair 8211 april 9th 2006 raquo animesundayorg'

distance = 472
spam score = 36
title = 'november animesunday at dragons lair 8211 november 20 2005 raquo animesundayorg'

distance = 473
spam score = 37
title = 'september animesunday at dragons lair 8211 september 18 2005 raquo animesundayorg'

distance = 475
spam score = 41
title = 'february animesunday at dragons lair 8211 february 18th 2007 raquo animesundayorg'

distance = 477
spam score = 40
title = 'august animesunday at dragons lair 8211 august 21 2005 raquo animesundayorg'

distance = 494
spam score = 35
title = 'february 2008 animesunday at dragons lair 8211 february 17th 2008 raquo animesundayorg'

distance = 497
spam score = 34
title = 'january 2008 animesunday at dragons lair 8211 january 20th 2008 raquo animesundayorg'

distance = 499
spam score = 24
title = 'calendar raquo animesundayorg'

distance = 499
spam score = 39
title = 'november animesunday at dragons lair 8211 november 19 2006 raquo animesundayorg'

distance = 503
spam score = 42
title = 'january animesunday at dragons lair 8211 january 21st 2007 raquo animesundayorg'

distance = 508
spam score = 39
title = 'january 2012 animesunday at dragons lair 8211 january 18th 2012 raquo animesundayorg'

distance = 511
spam score = 34
title = 'october 2007 animesunday at dragons lair 8211 october 21st 2007 raquo animesundayorg'

distance = 513
spam score = 39
title = 'february 2012 animesunday at dragons lair 8211 february 19th 2012 raquo animesundayorg'

distance = 517
spam score = 38
title = 'december 2011 animesunday at dragons lair 8211 december 18th 2011 raquo animesundayorg'

distance = 519
spam score = 41
title = 'march 2012 animesunday at dragons lair 8211 march 18th 2012 raquo animesundayorg'

distance = 543
spam score = 22
title = 'older schedules raquo animesundayorg'

distance = 543
spam score = 37
title = 'september 2011 animesunday at dragons lair 8211 september 18th 2011 raquo animesundayorg'

distance = 545
spam score = 40
title = 'august 2010 animesunday at dragons lair 8211 august 15th 2010 raquo animesundayorg'

distance = 545
spam score = 36
title = 'july 2010 animesunday at dragons lair 8211 july 18th 2010 raquo animesundayorg'

distance = 545
spam score = 38
title = 'march animesunday at dragons lair 8211 march 18th 2007 raquo animesundayorg'

distance = 545
spam score = 41
title = 'april 2009 animesunday at dragons lair 8211 april 19th 2009 raquo animesundayorg'

distance = 546
spam score = 31
title = 'june 2007 animesunday at dragon8217s lair 8211 june 17th 2007 raquo animesundayorg'

distance = 547
spam score = 37
title = 'may 2011 animesunday at dragons lair 8211 may 15th 2011 raquo animesundayorg'

distance = 548
spam score = 37
title = 'july 2011 animesunday at dragons lair 8211 july 17th 2011 raquo animesundayorg'

distance = 548
spam score = 40
title = 'february 2011 animesunday at dragons lair 8211 february 20th 2011 raquo animesundayorg'

distance = 571
spam score = 42
title = 'january 2009 animesunday at dragons lair 8211 january 18th 2009 raquo animesundayorg'

distance = 572
spam score = 34
title = 'november 2008 animesunday at dragons lair 8211 november 16th 2008 raquo animesundayorg'

distance = 572
spam score = 40
title = 'april 2010 animesunday at dragons lair 8211 april 18th 2010 raquo animesundayorg'

distance = 579
spam score = 40
title = 'june 2009 animesunday at dragons lair 8211 june 21st 2009 raquo animesundayorg'

distance = 580
spam score = 44
title = 'january 2010 animesunday at dragons lair 8211 january 17th 2010 raquo animesundayorg'

distance = 582
spam score = 36
title = 'may 2010 animesunday at dragons lair 8211 may 16th 2010 raquo animesundayorg'

distance = 582
spam score = 38
title = 'september 2009 animesunday at dragons lair 8211 september 20th 2009 raquo animesundayorg'

distance = 587
spam score = 35
title = 'june 2010 animesunday at dragons lair 8211 june 20th 2010 raquo animesundayorg'

distance = 588
spam score = 40
title = 'october 2009 animesunday at dragons lair 8211 october 18th 2009 raquo animesundayorg'

distance = 588
spam score = 33
title = 'july 2008 animesunday at dragons lair 8211 july 20th 2008 raquo animesundayorg'

distance = 701
spam score = 35
title = '2010 june raquo animesundayorg'

distance = 712
spam score = 29
title = 'uncategorized raquo animesundayorg'

distance = 720
spam score = 38
title = '2011 september raquo animesundayorg'

distance = 823
spam score = 37
title = 'relayer raquo animesundayorg'

distance = 838
spam score = 31
title = 'animesundayorg raquo page 8'

distance = 1667
spam score = 32
title = 'jeremys 60th anniversary xj'

distance = 1700
spam score = 44
title = 'chriss 60th anniversary xj'

distance = 106
spam score = 92
title = '2009 oneyear out arts and communication the career center at tcnj'

distance = 106
spam score = 92
title = '2009 oneyear out arts and communication the career center at tcnj'

distance = 112
spam score = 95
title = '2007 business report the career center at tcnj'

distance = 112
spam score = 94
title = '2007 business report the career center at tcnj'

distance = 115
spam score = 92
title = '2009 oneyear out arts and communication the career center at tcnj'

distance = 115
spam score = 92
title = '2009 oneyear out arts and communication the career center at tcnj'

distance = 118
spam score = 94
title = '2009 oneyear out business report the career center at tcnj'

distance = 118
spam score = 94
title = '2009 oneyear out business report the career center at tcnj'

distance = 119
spam score = 95
title = '2007 education report the career center at tcnj'

distance = 119
spam score = 95
title = '2007 education report the career center at tcnj'

distance = 122
spam score = 93
title = '2009 oneyear out science report the career center at tcnj'

distance = 122
spam score = 93
title = '2009 oneyear out science report the career center at tcnj'

distance = 122
spam score = 95
title = '2007 business report the career center at tcnj'

distance = 122
spam score = 95
title = '2007 business report the career center at tcnj'

distance = 122
spam score = 93
title = '2009 oneyear out science report the career center at tcnj'

distance = 124
spam score = 95
title = '2008 oneyear out business report the career center at tcnj'

distance = 124
spam score = 95
title = '2008 oneyear out business report the career center at tcnj'

distance = 124
spam score = 95
title = '2007 engineering report the career center at tcnj'

distance = 124
spam score = 95
title = '2007 engineering report the career center at tcnj'

distance = 125
spam score = 94
title = '2009 oneyear out business report the career center at tcnj'

distance = 142
spam score = 95
title = '2007 humanities and social sciences the career center at tcnj'

distance = 142
spam score = 95
title = '2007 humanities and social sciences the career center at tcnj'

distance = 144
spam score = 95
title = '2009 oneyear out survey education report the career center at tcnj'

distance = 144
spam score = 95
title = '2009 oneyear out survey education report the career center at tcnj'

distance = 145
spam score = 94
title = '2009 oneyear out engineering report the career center at tcnj'

distance = 145
spam score = 94
title = '2009 oneyear out engineering report the career center at tcnj'

distance = 146
spam score = 94
title = '2008 oneyear out science report the career center at tcnj'

distance = 146
spam score = 94
title = '2008 oneyear out science report the career center at tcnj'

distance = 152
spam score = 95
title = '2009 oneyear out survey education report the career center at tcnj'

distance = 152
spam score = 95
title = '2009 oneyear out survey education report the career center at tcnj'

distance = 184
spam score = 92
title = '2010 oneyear out survey results the career center at tcnj'

distance = 189
spam score = 92
title = '2010 oneyear out survey results the career center at tcnj'

distance = 189
spam score = 92
title = '2010 oneyear out survey results the career center at tcnj'

distance = 192
spam score = 93
title = '2009 oneyear out survey results the career center at tcnj'

distance = 192
spam score = 93
title = '2009 oneyear out survey results the career center at tcnj'

distance = 196
spam score = 92
title = '2005 oneyear out survey results the career center at tcnj'

distance = 196
spam score = 92
title = '2005 oneyear out survey results the career center at tcnj'

distance = 200
spam score = 93
title = '2009 oneyear out survey results the career center at tcnj'

distance = 200
spam score = 93
title = '2009 oneyear out survey results the career center at tcnj'

distance = 201
spam score = 92
title = '2005 oneyear out survey results the career center at tcnj'

distance = 232
spam score = 94
title = '2008 oneyear out nursing health amp exercise science report the career center at tcnj'

distance = 232
spam score = 94
title = '2009 oneyear out nursing health amp exercise science report the career center at tcnj'

distance = 237
spam score = 95
title = '2007 nursing health and exercise science report the career center at tcnj'

distance = 237
spam score = 95
title = '2007 nursing health and exercise science report the career center at tcnj'

distance = 241
spam score = 94
title = '2008 oneyear out nursing health amp exercise science report the career center at tcnj'

distance = 241
spam score = 94
title = '2008 oneyear out nursing health amp exercise science report the career center at tcnj'

distance = 241
spam score = 94
title = '2009 oneyear out nursing health amp exercise science report the career center at tcnj'

distance = 241
spam score = 94
title = '2009 oneyear out nursing health amp exercise science report the career center at tcnj'

distance = 246
spam score = 96
title = 'about the career center at tcnj'

distance = 251
spam score = 96
title = 'engineering the career center at tcnj'

distance = 316
spam score = 96
title = 'internshipsusa the career center at tcnj'

distance = 319
spam score = 95
title = 'tcnj yearout surveys the career center at tcnj'

distance = 320
spam score = 96
title = 'immgaming the career center at tcnj'

distance = 323
spam score = 97
title = 'dining out in professional style the career center at tcnj'

distance = 323
spam score = 97
title = 'dining out in professional style the career center at tcnj'

distance = 323
spam score = 97
title = 'dining out in professional style the career center at tcnj'

distance = 323
spam score = 97
title = 'dining out in professional style the career center at tcnj'

distance = 325
spam score = 97
title = 'artjobonline the career center at tcnj'

distance = 333
spam score = 96
title = 'graduate survey the career center at tcnj'

distance = 336
spam score = 96
title = 'internshipsusa the career center at tcnj'

distance = 372
spam score = 97
title = 'entertainment jobs the career center at tcnj'

distance = 373
spam score = 96
title = 'tie the international educator the career center at tcnj'

distance = 376
spam score = 94
title = 'nonprofitgovernment the career center at tcnj'

distance = 379
spam score = 96
title = 'resume open hours the career center at tcnj'

distance = 380
spam score = 96
title = 'education the career center at tcnj'

distance = 380
spam score = 98
title = 'need a workshop the career center at tcnj'

distance = 383
spam score = 96
title = 'differing abilities the career center at tcnj'

distance = 383
spam score = 98
title = 'current jobs for graduates the career center at tcnj'

distance = 387
spam score = 94
title = 'nonprofitgovernment the career center at tcnj'

distance = 388
spam score = 98
title = 'need a workshop the career center at tcnj'

distance = 439
spam score = 98
title = 'alternatives inc job fair amp open house the career center at tcnj'

distance = 439
spam score = 98
title = 'alternatives inc job fair amp open house the career center at tcnj'

distance = 447
spam score = 96
title = 'accounting meetngreet the career center at tcnj'

distance = 447
spam score = 96
title = 'accounting meetngreet the career center at tcnj'

distance = 447
spam score = 96
title = 'accounting meetngreet the career center at tcnj'

distance = 447
spam score = 96
title = 'accounting meetngreet the career center at tcnj'

distance = 450
spam score = 98
title = 'focus the career center at tcnj'

distance = 451
spam score = 99
title = 'faculty amp staff the career center at tcnj'

distance = 453
spam score = 98
title = 'career library the career center at tcnj'

distance = 455
spam score = 98
title = 'intro to lionslink sessions the career center at tcnj'

distance = 484
spam score = 98
title = 'what can i do with my major the career center at tcnj'

distance = 484
spam score = 97
title = 'staff directory the career center at tcnj'

distance = 488
spam score = 97
title = 'staff directory the career center at tcnj'

distance = 501
spam score = 96
title = 'events the career center at tcnj'

distance = 506
spam score = 97
title = 'subscriptions the career center at tcnj'

distance = 510
spam score = 97
title = 'subscriptions the career center at tcnj'

distance = 512
spam score = 96
title = 'events the career center at tcnj'

distance = 532
spam score = 97
title = 'explore majors amp careers the career center at tcnj'

distance = 540
spam score = 97
title = 'explore majors amp careers the career center at tcnj'

distance = 543
spam score = 98
title = 'mission the career center at tcnj'

distance = 681
spam score = 97
title = 'why recruit at tcnj the career center at tcnj'

distance = 706
spam score = 96
title = 'engineering network breakfast amp opportunities fair the career center at tcnj'

distance = 706
spam score = 96
title = 'engineering network breakfast amp opportunities fair the career center at tcnj'

distance = 708
spam score = 98
title = 'educational programmes abroad internships the career center at tcnj'

distance = 715
spam score = 96
title = 'engineering network breakfast amp opportunities fair the career center at tcnj'

distance = 715
spam score = 96
title = 'engineering network breakfast amp opportunities fair the career center at tcnj'

distance = 720
spam score = 98
title = 'educational programmes abroad internships the career center at tcnj'

distance = 738
spam score = 97
title = 'visit tcnj the career center at tcnj'

distance = 738
spam score = 97
title = 'visit tcnj the career center at tcnj'

distance = 739
spam score = 97
title = 'visit tcnj the career center at tcnj'

distance = 1233
spam score = 96
title = 'eid march 23rd interviewers the career center at tcnj'

distance = 1774
spam score = 53
title = 'search results for invertebrate zoology nmnh invertebrate zoology dept collections search center smithsonian institution'

distance = 7
spam score = 71
title = ''

distance = 11
spam score = 73
title = ''

distance = 20
spam score = 74
title = ''

distance = 28
spam score = 74
title = ''

distance = 30
spam score = 71
title = ''

distance = 34
spam score = 77
title = ''

distance = 41
spam score = 74
title = ''

distance = 43
spam score = 73
title = ''

distance = 44
spam score = 73
title = ''

distance = 45
spam score = 74
title = ''

distance = 50
spam score = 73
title = ''

distance = 51
spam score = 74
title = ''

distance = 53
spam score = 73
title = ''

distance = 54
spam score = 73
title = ''

distance = 54
spam score = 73
title = ''

distance = 54
spam score = 74
title = ''

distance = 56
spam score = 76
title = ''

distance = 57
spam score = 73
title = ''

distance = 58
spam score = 74
title = ''

distance = 58
spam score = 74
title = ''

distance = 58
spam score = 73
title = ''

distance = 59
spam score = 77
title = ''

distance = 60
spam score = 73
title = ''

distance = 60
spam score = 77
title = ''

distance = 65
spam score = 72
title = ''

distance = 66
spam score = 74
title = ''

distance = 68
spam score = 73
title = ''

distance = 68
spam score = 72
title = ''

distance = 70
spam score = 74
title = ''

distance = 74
spam score = 73
title = ''

distance = 81
spam score = 73
title = ''

distance = 82
spam score = 73
title = ''

distance = 84
spam score = 73
title = ''

distance = 84
spam score = 72
title = ''

distance = 87
spam score = 73
title = ''

distance = 88
spam score = 77
title = ''

distance = 91
spam score = 73
title = ''

distance = 92
spam score = 72
title = ''

distance = 100
spam score = 74
title = ''

distance = 116
spam score = 74
title = ''

distance = 149
spam score = 77
title = ''

distance = 184
spam score = 85
title = ''

distance = 204
spam score = 77
title = ''

distance = 217
spam score = 77
title = ''

distance = 219
spam score = 82
title = ''

distance = 224
spam score = 72
title = ''

distance = 234
spam score = 78
title = ''

distance = 243
spam score = 79
title = ''

distance = 244
spam score = 77
title = ''

distance = 247
spam score = 77
title = ''

distance = 264
spam score = 77
title = ''

distance = 265
spam score = 79
title = ''

distance = 265
spam score = 77
title = ''

distance = 297
spam score = 77
title = ''

distance = 305
spam score = 79
title = ''

distance = 327
spam score = 80
title = ''

distance = 372
spam score = 79
title = ''

distance = 392
spam score = 82
title = ''

distance = 392
spam score = 83
title = ''

distance = 417
spam score = 81
title = ''

distance = 417
spam score = 82
title = ''

distance = 422
spam score = 81
title = ''

distance = 434
spam score = 82
title = ''

distance = 454
spam score = 78
title = ''

distance = 509
spam score = 81
title = ''

distance = 532
spam score = 89
title = ''

distance = 534
spam score = 94
title = ''

distance = 539
spam score = 75
title = ''

distance = 540
spam score = 79
title = ''

distance = 589
spam score = 88
title = ''

distance = 600
spam score = 78
title = ''

distance = 600
spam score = 89
title = ''

distance = 625
spam score = 87
title = ''

distance = 632
spam score = 75
title = ''

distance = 639
spam score = 76
title = ''

distance = 683
spam score = 84
title = ''

distance = 693
spam score = 86
title = ''

distance = 702
spam score = 73
title = ''

distance = 702
spam score = 90
title = ''

distance = 758
spam score = 89
title = ''

distance = 771
spam score = 88
title = ''

distance = 787
spam score = 86
title = ''

distance = 787
spam score = 82
title = ''

distance = 798
spam score = 89
title = ''

distance = 801
spam score = 81
title = ''

distance = 813
spam score = 70
title = ''

distance = 868
spam score = 76
title = ''

distance = 928
spam score = 89
title = ''

distance = 932
spam score = 83
title = ''

distance = 1837
spam score = 11
title = ''

distance = 116
spam score = 56
title = 'django 095 the scoop'

distance = 132
spam score = 66
title = 'been busy lately the scoop'

distance = 151
spam score = 54
title = 'galaxql the scoop'

distance = 158
spam score = 54
title = 'pycon 2006 the scoop'

distance = 160
spam score = 60
title = 'turning data over to sources the scoop'

distance = 173
spam score = 57
title = 'document centric the scoop'

distance = 183
spam score = 64
title = 'the data web the scoop'

distance = 184
spam score = 59
title = 'thoughts on the future the scoop'

distance = 184
spam score = 57
title = 'house of lies follow the scoop'

distance = 185
spam score = 62
title = 'ire 2005 the scoop'

distance = 186
spam score = 51
title = 'garbage in the scoop'

distance = 187
spam score = 56
title = 'house of lies followup the scoop'

distance = 192
spam score = 55
title = 'business report wcar skills the scoop'

distance = 193
spam score = 50
title = 'e coli records the scoop'

distance = 196
spam score = 64
title = 'ire 2004 awards the scoop'

distance = 204
spam score = 59
title = 'instiki 011 the scoop'

distance = 206
spam score = 55
title = 'richmond crime the scoop'

distance = 207
spam score = 52
title = 'data farming not data mining the scoop'

distance = 208
spam score = 55
title = 'why we still need serious journalism the scoop'

distance = 210
spam score = 61
title = 'batten finalist the scoop'

distance = 302
spam score = 65
title = 'two state campaign finance stories the scoop'

distance = 303
spam score = 54
title = 'denver city council attendance the scoop'

distance = 303
spam score = 55
title = 'college dreams the scoop'

distance = 303
spam score = 57
title = 'kansas school funding the scoop'

distance = 304
spam score = 64
title = 'colorado mine safety the scoop'

distance = 307
spam score = 62
title = 'npr archive internship the scoop'

distance = 307
spam score = 55
title = 'poughkeepsie nea grants the scoop'

distance = 307
spam score = 43
title = 'new orleans recovery loans the scoop'

distance = 308
spam score = 54
title = 'indiana state employee salaries the scoop'

distance = 309
spam score = 56
title = 'hawaii arrest warrant backlog the scoop'

distance = 349
spam score = 52
title = 'illinois securities fraud settlement the scoop'

distance = 350
spam score = 59
title = 'oregon rural health care program the scoop'

distance = 353
spam score = 53
title = 'iowa lottery sales the scoop'

distance = 354
spam score = 55
title = 'alabama hurricane protection the scoop'

distance = 354
spam score = 46
title = 'jackson county tax breaks the scoop'

distance = 354
spam score = 49
title = 'west virginia state aircraft the scoop'

distance = 354
spam score = 41
title = 'allen county water systems the scoop'

distance = 355
spam score = 51
title = 'broward county8217s secret docket the scoop'

distance = 357
spam score = 52
title = 'bringing more weapons to the airport the scoop'

distance = 358
spam score = 46
title = 'la firefighter discipline the scoop'

distance = 378
spam score = 44
title = 'minnesota state workers the scoop'

distance = 378
spam score = 53
title = 'washington outstanding warrants the scoop'

distance = 379
spam score = 51
title = 'georgia recruiting expenses the scoop'

distance = 380
spam score = 55
title = 'mapping south florida8217s housing boom the scoop'

distance = 380
spam score = 47
title = 'florida gasoline leaks the scoop'

distance = 381
spam score = 46
title = 'pirates8217 profit the scoop'

distance = 383
spam score = 49
title = 'buffalo parking tickets the scoop'

distance = 383
spam score = 46
title = 'new jersey megan8217s law enforcement the scoop'

distance = 383
spam score = 55
title = 'rich college poor college the scoop'

distance = 384
spam score = 52
title = 'landrieu office updates raise eyebrows the scoop'

distance = 411
spam score = 56
title = 'nursing home care the scoop'

distance = 411
spam score = 49
title = 'suburban black wealth the scoop'

distance = 412
spam score = 58
title = 'illinois nursing home sex offenders the scoop'

distance = 412
spam score = 55
title = 'louisiana accident data the scoop'

distance = 412
spam score = 51
title = 'marine corps body armor the scoop'

distance = 412
spam score = 56
title = 'a blog for every hack the scoop'

distance = 413
spam score = 52
title = 'bart employee salaries the scoop'

distance = 413
spam score = 51
title = 'guinea pig kids the scoop'

distance = 414
spam score = 58
title = 'some django notes the scoop'

distance = 414
spam score = 56
title = 'federal farm subsidy payments the scoop'

distance = 440
spam score = 60
title = 'oregon campaigns the scoop'

distance = 441
spam score = 63
title = 'dining at mia the scoop'

distance = 441
spam score = 56
title = 'canadian journalism the scoop'

distance = 442
spam score = 45
title = 'virginia game amp fisheries spending the scoop'

distance = 443
spam score = 57
title = 'delaware sex offenders the scoop'

distance = 445
spam score = 46
title = 'arizona payday loans the scoop'

distance = 446
spam score = 48
title = 'indiana interstate highway deaths the scoop'

distance = 448
spam score = 61
title = 'new jersey property taxes the scoop'

distance = 448
spam score = 54
title = 'affordable housing bond falling short the scoop'

distance = 448
spam score = 45
title = 'massachusetts fake worker ids the scoop'

distance = 474
spam score = 54
title = 'southlake hardware spending the scoop'

distance = 476
spam score = 42
title = 'ontario place free ride the scoop'

distance = 476
spam score = 76
title = 'oregon appointment diversity the scoop'

distance = 476
spam score = 48
title = 'wasteful medicare spending the scoop'

distance = 477
spam score = 51
title = 'construction industry deaths the scoop'

distance = 477
spam score = 43
title = 'utah public pools the scoop'

distance = 477
spam score = 53
title = 'maine8217s tax burden the scoop'

distance = 477
spam score = 50
title = 'florida8217s secret fundraising the scoop'

distance = 480
spam score = 58
title = 'indiana school testing scores the scoop'

distance = 480
spam score = 48
title = 'small college debt the scoop'

distance = 513
spam score = 58
title = 'microsoftsponsored trips the scoop'

distance = 514
spam score = 63
title = 'nicar 2011 lightning talks the scoop'

distance = 514
spam score = 59
title = 'sla presentations the scoop'

distance = 515
spam score = 61
title = 'new mexico donors the scoop'

distance = 515
spam score = 36
title = 'bexar county cell phones the scoop'

distance = 516
spam score = 32
title = 'untaxed art the scoop'

distance = 516
spam score = 47
title = 'erie properties the scoop'

distance = 517
spam score = 58
title = 'teacher layoffs the scoop'

distance = 518
spam score = 58
title = 'alabama computer consultants the scoop'

distance = 518
spam score = 53
title = 'florida felon list votes the scoop'

distance = 593
spam score = 60
title = 'public records for a price the scoop'

distance = 596
spam score = 55
title = 'texas reading tests the scoop'

distance = 601
spam score = 51
title = 'protecting our children the scoop'

distance = 602
spam score = 57
title = 'tracking iowa8217s sexual offenders the scoop'

distance = 607
spam score = 60
title = 'eastern iowa landlords the scoop'

distance = 608
spam score = 78
title = 'florida8217s corporate tax loophole the scoop'

distance = 620
spam score = 64
title = 'nicar conference feedback the scoop'

distance = 622
spam score = 65
title = 'the troubles at kingdrew the scoop'

distance = 623
spam score = 59
title = 'colorado school violence the scoop'

distance = 625
spam score = 68
title = 'collier county sheriff overtime the scoop'

distance = 905
spam score = 52
title = 'mapping the scoop'

distance = 907
spam score = 42
title = 'state data the scoop'

distance = 913
spam score = 50
title = 'foia the scoop'

distance = 927
spam score = 64
title = 'state data the scoop'

distance = 928
spam score = 54
title = 'measuring vocabulary richness or trying out django on heroku the scoop'

distance = 118
spam score = 82
title = ''

distance = 132
spam score = 80
title = ''

distance = 132
spam score = 81
title = ''

distance = 145
spam score = 82
title = ''

distance = 147
spam score = 75
title = ''

distance = 197
spam score = 79
title = ''

distance = 197
spam score = 79
title = ''

distance = 217
spam score = 74
title = ''

distance = 217
spam score = 79
title = ''

distance = 219
spam score = 81
title = ''

distance = 234
spam score = 79
title = ''

distance = 281
spam score = 79
title = ''

distance = 285
spam score = 69
title = ''

distance = 296
spam score = 73
title = ''

distance = 299
spam score = 79
title = ''

distance = 334
spam score = 78
title = ''

distance = 347
spam score = 85
title = ''

distance = 355
spam score = 66
title = ''

distance = 356
spam score = 87
title = ''

distance = 358
spam score = 91
title = ''

distance = 360
spam score = 89
title = ''

distance = 362
spam score = 69
title = ''

distance = 363
spam score = 89
title = ''

distance = 364
spam score = 71
title = ''

distance = 365
spam score = 87
title = ''

distance = 368
spam score = 88
title = ''

distance = 369
spam score = 87
title = ''

distance = 370
spam score = 87
title = ''

distance = 371
spam score = 83
title = ''

distance = 372
spam score = 84
title = ''

distance = 373
spam score = 85
title = ''

distance = 375
spam score = 87
title = ''

distance = 375
spam score = 88
title = ''

distance = 375
spam score = 83
title = ''

distance = 378
spam score = 88
title = ''

distance = 382
spam score = 80
title = ''

distance = 383
spam score = 86
title = ''

distance = 383
spam score = 82
title = ''

distance = 383
spam score = 87
title = ''

distance = 383
spam score = 81
title = ''

distance = 384
spam score = 88
title = ''

distance = 384
spam score = 87
title = ''

distance = 385
spam score = 81
title = ''

distance = 385
spam score = 81
title = ''

distance = 387
spam score = 80
title = ''

distance = 389
spam score = 92
title = ''

distance = 391
spam score = 80
title = ''

distance = 392
spam score = 86
title = ''

distance = 394
spam score = 88
title = ''

distance = 400
spam score = 83
title = ''

distance = 402
spam score = 79
title = ''

distance = 403
spam score = 83
title = ''

distance = 410
spam score = 84
title = ''

distance = 420
spam score = 68
title = ''

distance = 422
spam score = 83
title = ''

distance = 424
spam score = 62
title = ''

distance = 427
spam score = 91
title = ''

distance = 428
spam score = 84
title = ''

distance = 430
spam score = 89
title = ''

distance = 432
spam score = 85
title = ''

distance = 433
spam score = 71
title = ''

distance = 435
spam score = 78
title = ''

distance = 436
spam score = 76
title = ''

distance = 441
spam score = 89
title = ''

distance = 443
spam score = 86
title = ''

distance = 447
spam score = 84
title = ''

distance = 460
spam score = 79
title = ''

distance = 484
spam score = 81
title = ''

distance = 488
spam score = 76
title = ''

distance = 507
spam score = 79
title = ''

distance = 518
spam score = 83
title = ''

distance = 528
spam score = 86
title = ''

distance = 537
spam score = 79
title = ''

distance = 539
spam score = 79
title = ''

distance = 548
spam score = 80
title = ''

distance = 564
spam score = 80
title = ''

distance = 572
spam score = 75
title = ''

distance = 604
spam score = 58
title = ''

distance = 610
spam score = 79
title = ''

distance = 617
spam score = 85
title = ''

distance = 621
spam score = 72
title = ''

distance = 708
spam score = 45
title = ''

distance = 999
spam score = 70
title = ''

distance = 1119
spam score = 80
title = ''

distance = 1296
spam score = 73
title = ''

distance = 89
spam score = 69
title = 'archives 8211 lil8217 duck duck'

distance = 108
spam score = 69
title = 'sitemap 8211 lil8217 duck duck'

distance = 109
spam score = 69
title = 'widget 8211 lil8217 duck duck'

distance = 118
spam score = 72
title = 'holiday photo cards 2010 8211 lil8217 duck duck'

distance = 153
spam score = 58
title = 'the mischievous squeeball8230'

distance = 159
spam score = 62
title = 'wow presents'

distance = 161
spam score = 61
title = 'the discovery of the second duck8230'

distance = 168
spam score = 68
title = 'family photo christmas cards 8211 lil8217 duck duck'

distance = 174
spam score = 51
title = 'motorcycle company party invitation'

distance = 175
spam score = 56
title = 'butterfly dreams thank you card'

distance = 181
spam score = 65
title = 'sharing the lil8217 duck8217s christmas joy'

distance = 185
spam score = 66
title = '2012 new home new year photo card'

distance = 185
spam score = 58
title = 'sweet 16 new year8217s party invitation'

distance = 186
spam score = 54
title = 'chic snowfall birthday photo invitation'

distance = 186
spam score = 55
title = 'bouquet pink photo wedding thank you'

distance = 187
spam score = 63
title = 'square photo thanksgiving love card'

distance = 189
spam score = 64
title = 'festive irish blessings photo card'

distance = 191
spam score = 55
title = 'engagement photo film card'

distance = 191
spam score = 58
title = 'winter 50th birthday surprise invitation'

distance = 193
spam score = 59
title = 'farm kids birthday photo invitation'

distance = 242
spam score = 59
title = 'just married modern damask announcement'

distance = 243
spam score = 58
title = 'sweet sage 30th anniversary invitation'

distance = 244
spam score = 61
title = 'ruby amp gold damask anniversary card'

distance = 244
spam score = 55
title = 'modern blue amp silver photo christmas card'

distance = 244
spam score = 60
title = 'posh sweet 16 photo invitation'

distance = 244
spam score = 55
title = 'striped engagement fiesta invitation'

distance = 245
spam score = 58
title = 'little lady8217s baptism thank you card'

distance = 245
spam score = 61
title = 'silver dust anniversary photo invitation'

distance = 246
spam score = 57
title = 'merry christmas from lil8217 duck'

distance = 246
spam score = 51
title = 'twins yellow amp black christening invitation'

distance = 263
spam score = 64
title = 'double 50th anniversary formal invitation'

distance = 263
spam score = 59
title = 'pumpkin birth photo holiday card'

distance = 264
spam score = 57
title = 'valentine hearts family greeting card'

distance = 264
spam score = 52
title = 'photo hunt 8211 plush'

distance = 265
spam score = 52
title = 'easy italian bread'

distance = 265
spam score = 55
title = 'fine frost engagement party card'

distance = 265
spam score = 58
title = 'vintage wedding photo 50th anniversary card'

distance = 266
spam score = 62
title = 'boy8217s 1st birthday handwriting notecard'

distance = 266
spam score = 61
title = 'green enchantment 15th birthday invitation'

distance = 266
spam score = 51
title = 'photo hunt 8211 plush'

distance = 283
spam score = 56
title = 'extra nice christmas three photo card'

distance = 283
spam score = 55
title = 'butterfly blush christening photo card'

distance = 283
spam score = 58
title = 'customcolored quinceanera reply card'

distance = 284
spam score = 60
title = 'fresh blooms newborn party invitation'

distance = 284
spam score = 59
title = 'pink blossom christening invitation'

distance = 284
spam score = 59
title = 'seashore wedding reception invitation 8211 seashells photo destination'

distance = 285
spam score = 66
title = 'new year blessings snowflake family card'

distance = 285
spam score = 68
title = 'a year with the christmas puppy'

distance = 286
spam score = 67
title = 'july freedom quote for independence day'

distance = 286
spam score = 63
title = 'back to school quote for september'

distance = 311
spam score = 63
title = 'masked mardi gras party invitation 8211 green amp gold'

distance = 312
spam score = 66
title = 'inspirational quote for thanksgiving'

distance = 312
spam score = 64
title = 'valentine inspirational quote for february'

distance = 314
spam score = 63
title = 'mmmm tasty christmas moose'

distance = 315
spam score = 59
title = 'bows on our heads and monkeys and ducks oh my'

distance = 315
spam score = 53
title = 'fluttery owl girl birthday invitation'

distance = 316
spam score = 61
title = 'personalized golden party reply card'

distance = 316
spam score = 55
title = 'colorful twins8217 winter fun party invitation'

distance = 318
spam score = 62
title = 'luau siblings photo birthday invitation'

distance = 319
spam score = 59
title = 'irish babe 1st birthday invitation 8211 pink girl st patrick8217s day'

distance = 362
spam score = 61
title = 'crockpot lemon pepper chicken'

distance = 363
spam score = 50
title = 'look mama beach'

distance = 366
spam score = 60
title = 'custom breast cancer research support card'

distance = 366
spam score = 58
title = 'the ducks and sliding fun'

distance = 370
spam score = 62
title = 'super simple meatloaf'

distance = 372
spam score = 62
title = 'pink butterfly spring baptism invitation'

distance = 373
spam score = 60
title = 'on waffle laying and sneaky riddles8230'

distance = 375
spam score = 50
title = 'girly babycakes birthday invitation'

distance = 379
spam score = 71
title = 'the 5 things you need to survive a toddler'

distance = 380
spam score = 55
title = 'butterfly wonderland communion invitation'

distance = 447
spam score = 59
title = 'pineapple party punch'

distance = 448
spam score = 51
title = 'love me love my crocs8230'

distance = 454
spam score = 56
title = 'graduation rubber ducky party favors'

distance = 454
spam score = 61
title = 'easter ham special from honey baked ham'

distance = 456
spam score = 65
title = 'don8217t forget the carnivals amp sickness update8230'

distance = 457
spam score = 59
title = 're tv as a parenting tool'

distance = 457
spam score = 56
title = 'rocket ship birthday blast outer space thank you card'

distance = 462
spam score = 61
title = 'a joyful rain dance'

distance = 470
spam score = 63
title = 'alli8217s custom sterling silver jewelry 8211 wfmw'

distance = 470
spam score = 56
title = 'eggnog fruit salad'

distance = 550
spam score = 55
title = 'because i know you want to caption this8230'

distance = 551
spam score = 61
title = 'little squirt water fun gallery'

distance = 551
spam score = 54
title = 'oh no ducky'

distance = 552
spam score = 48
title = 'toy of the week 8211 little einstein8217s 8220pat pat rocket8221'

distance = 552
spam score = 60
title = 'creamy red potatoes and chicken'

distance = 554
spam score = 65
title = 'simple pasta melt 8211 recipe 8211 lil8217 duck duck'

distance = 556
spam score = 62
title = 'turtle shell treats'

distance = 558
spam score = 48
title = 'household management getting daily priorities done'

distance = 560
spam score = 79
title = 'contact information for lil duck duck'

distance = 562
spam score = 52
title = 'grocery savings help 8211 get back to the table'

distance = 661
spam score = 44
title = 'no no tired no nap'

distance = 672
spam score = 57
title = 'using up easter eggs 8211 ham amp cheese style'

distance = 690
spam score = 50
title = 'because i know you want to caption this8230'

distance = 690
spam score = 52
title = 'paper bag easter bunny craft'

distance = 695
spam score = 52
title = 'paper bag easter bunny craft'

distance = 705
spam score = 60
title = 'lil duck duck sales amp promotions 8211 lil8217 duck duck'

distance = 706
spam score = 54
title = 'thirteen crazy captions8230'

distance = 715
spam score = 66
title = 'triplecorn chowder'

distance = 716
spam score = 47
title = 'tacofilled pasta shells'

distance = 723
spam score = 62
title = 'picnic potato salad'

distance = 1744
spam score = 8
title = 'made for each other cards'

distance = 1746
spam score = 21
title = 'invenes chinesasinvenes chinesas antigas raquo chinese playing cardschinese inventions'

distance = 1890
spam score = 0
title = 'marathi film cinema chitrapat actors marathi actress'

distance = 53
spam score = 98
title = 'john mark ministries christ who owns the universe'

distance = 54
spam score = 94
title = 'john mark ministries bad day'

distance = 57
spam score = 98
title = 'john mark ministries the seasons'

distance = 59
spam score = 97
title = 'john mark ministries you are blessed'

distance = 61
spam score = 94
title = 'john mark ministries suffering'

distance = 65
spam score = 95
title = 'john mark ministries regrets'

distance = 70
spam score = 97
title = 'john mark ministries challenging video'

distance = 74
spam score = 96
title = 'john mark ministries shopping'

distance = 75
spam score = 98
title = 'john mark ministries prayer for the new year'

distance = 76
spam score = 97
title = 'john mark ministries humans survive in amazing places'

distance = 79
spam score = 97
title = 'john mark ministries how to get to heaven'

distance = 80
spam score = 97
title = 'john mark ministries fasting'

distance = 80
spam score = 97
title = 'john mark ministries quotations christian of the day'

distance = 82
spam score = 94
title = 'john mark ministries what to do with your doubts'

distance = 82
spam score = 97
title = 'john mark ministries church and state'

distance = 82
spam score = 97
title = 'john mark ministries conversion'

distance = 86
spam score = 98
title = 'john mark ministries 8216embrace christ not religion82308217'

distance = 87
spam score = 96
title = 'john mark ministries today8217s riddle for seniors'

distance = 88
spam score = 98
title = 'john mark ministries wisdom for life'

distance = 88
spam score = 95
title = 'john mark ministries 8216seriously8217 quotes'

distance = 165
spam score = 95
title = 'john mark ministries comic relief'

distance = 165
spam score = 98
title = 'john mark ministries brethren roger shuff'

distance = 166
spam score = 97
title = 'john mark ministries riddle'

distance = 166
spam score = 98
title = 'john mark ministries j m m website'

distance = 166
spam score = 98
title = 'john mark ministries when penguins die'

distance = 166
spam score = 95
title = 'john mark ministries christmas and war'

distance = 166
spam score = 96
title = 'john mark ministries most popular articles'

distance = 166
spam score = 95
title = 'john mark ministries humour'

distance = 167
spam score = 97
title = 'john mark ministries simplicity and complexity a little exercise in philosophy'

distance = 167
spam score = 97
title = 'john mark ministries business praise 31 growth 8211 manufacturing'

distance = 201
spam score = 91
title = 'john mark ministries the old missionary and his wife8230'

distance = 201
spam score = 97
title = 'john mark ministries jesus8217 disciples'

distance = 202
spam score = 97
title = 'john mark ministries online counselling'

distance = 202
spam score = 98
title = 'john mark ministries liberals and liturgy'

distance = 204
spam score = 97
title = 'john mark ministries jesus is all you need'

distance = 205
spam score = 96
title = 'john mark ministries mug shots'

distance = 205
spam score = 95
title = 'john mark ministries two naughty boys'

distance = 208
spam score = 98
title = 'john mark ministries my god turns my darkness into light'

distance = 208
spam score = 95
title = 'john mark ministries free biblical training classes'

distance = 208
spam score = 96
title = 'john mark ministries shame richard rohr'

distance = 253
spam score = 98
title = 'john mark ministries do nothing out of favouritism'

distance = 253
spam score = 97
title = 'john mark ministries word 8211 drawing a curve'

distance = 253
spam score = 97
title = 'john mark ministries psalms on sundays 149 8211 praise and vengeance'

distance = 253
spam score = 98
title = 'john mark ministries choose life richard rohr'

distance = 254
spam score = 90
title = 'john mark ministries humour'

distance = 254
spam score = 95
title = 'john mark ministries humour be sure your sins will find you out8230'

distance = 254
spam score = 91
title = 'john mark ministries and this one was obviously put together by a male8230'

distance = 256
spam score = 95
title = 'john mark ministries computer passwords'

distance = 258
spam score = 98
title = 'john mark ministries international day of prayer for persecuted christians'

distance = 258
spam score = 95
title = 'john mark ministries francis and the leper'

distance = 300
spam score = 89
title = 'john mark ministries old catskill jokes'

distance = 301
spam score = 96
title = 'john mark ministries trusting or driven it8217s a tough call'

distance = 306
spam score = 96
title = 'john mark ministries history looking back in anger'

distance = 307
spam score = 90
title = 'john mark ministries humour'

distance = 308
spam score = 87
title = 'john mark ministries story of a recovered alcoholic8230'

distance = 309
spam score = 90
title = 'john mark ministries spirituality and the twelve steps making amends richard rohr'

distance = 310
spam score = 97
title = 'john mark ministries interview with rowland'

distance = 310
spam score = 95
title = 'john mark ministries weightloss there8217s more to weight than measures'

distance = 313
spam score = 93
title = 'john mark ministries stress fitness'

distance = 314
spam score = 98
title = 'john mark ministries leadership for success'

distance = 368
spam score = 88
title = 'john mark ministries articles by boreham in 8216sunday at home8217'

distance = 368
spam score = 84
title = 'john mark ministries the ticket'

distance = 370
spam score = 97
title = 'john mark ministries iranian pastor sentenced to death8230'

distance = 371
spam score = 98
title = 'john mark ministries a response on homosexuality'

distance = 371
spam score = 94
title = 'john mark ministries relationshipsfamilykids'

distance = 372
spam score = 99
title = 'john mark ministries the jesus driven life'

distance = 373
spam score = 90
title = 'john mark ministries australians at war'

distance = 373
spam score = 97
title = 'john mark ministries subject abp 8220wounded heroes8221 retreats texas evangelist sponsoring 8216wounded heroes8217 retreats'

distance = 374
spam score = 97
title = 'john mark ministries april website news'

distance = 375
spam score = 94
title = 'john mark ministries prayers for help in times of trouble'

distance = 428
spam score = 98
title = 'john mark ministries review abraham joshua heschel essential writings'

distance = 430
spam score = 97
title = 'john mark ministries government religion and contraception'

distance = 435
spam score = 85
title = 'john mark ministries sonic boom in gaza 8211 what you won8217t read in the press'

distance = 436
spam score = 95
title = 'john mark ministries counseling 8211 transition'

distance = 438
spam score = 92
title = 'john mark ministries wallis colson trade barbs in columns'

distance = 439
spam score = 96
title = 'john mark ministries muslims in australia'

distance = 440
spam score = 87
title = 'john mark ministries humour'

distance = 442
spam score = 99
title = 'john mark ministries atheism in america'

distance = 445
spam score = 98
title = 'john mark ministries jesus in the manger a story of transformation richard rohr'

distance = 446
spam score = 95
title = 'john mark ministries jade8217s story a twoway street'

distance = 511
spam score = 95
title = 'john mark ministries how to cope with trouble'

distance = 512
spam score = 96
title = 'john mark ministries evolutionary christianity and brian mclaren'

distance = 519
spam score = 96
title = 'john mark ministries leaving nothing undone'

distance = 520
spam score = 97
title = 'john mark ministries churches and christian homes torched by mob in pakistan'

distance = 524
spam score = 93
title = 'john mark ministries 4 in 10 americans still hold creationist views'

distance = 531
spam score = 96
title = 'john mark ministries muslims and mormons in america'

distance = 531
spam score = 93
title = 'john mark ministries the lord is meant for the body'

distance = 532
spam score = 95
title = 'john mark ministries pastor amp six family members burnt to death in nigeria'

distance = 536
spam score = 97
title = 'john mark ministries aboriginal people need the fires of reconciliation to be relit'

distance = 536
spam score = 99
title = 'john mark ministries theologians on science and reductionism'

distance = 715
spam score = 83
title = 'john mark ministries the vatican 8211 a 8216rogue state8217 geoffrey robertson'

distance = 716
spam score = 83
title = 'john mark ministries egypt the gross insecurity of the dhimmi'

distance = 718
spam score = 95
title = 'john mark ministries india tensions soaring as christians charged in kashmir'

distance = 721
spam score = 78
title = 'john mark ministries international news 26th july 2010'

distance = 724
spam score = 97
title = 'john mark ministries ethiopia'

distance = 725
spam score = 92
title = 'john mark ministries fatherlessness'

distance = 728
spam score = 97
title = 'john mark ministries uzbekistan baptist church rejects officials8217 closure campaign'

distance = 729
spam score = 77
title = 'john mark ministries they died in vain deal with it war in afghanistan'

distance = 730
spam score = 71
title = 'john mark ministries religion amp ethics australia daily 11'

distance = 738
spam score = 89
title = 'john mark ministries nelson mandela8217s speech'

distance = 93
spam score = 11
title = 'roof safety'

distance = 95
spam score = 10
title = 'leaky roof'

distance = 96
spam score = 11
title = 'emergency roofing repair'

distance = 98
spam score = 10
title = 'roofing specialist'

distance = 100
spam score = 11
title = 'siding repair'

distance = 101
spam score = 11
title = 'roofing contractor'

distance = 102
spam score = 11
title = 'contractor'

distance = 103
spam score = 10
title = 'roofing magic'

distance = 108
spam score = 11
title = 'vents'

distance = 112
spam score = 11
title = 'flashing repair'

distance = 114
spam score = 11
title = 'chimney repair'

distance = 121
spam score = 10
title = 'roof tuneup'

distance = 124
spam score = 11
title = 'skylight repair'

distance = 126
spam score = 10
title = 'save money'

distance = 132
spam score = 10
title = 'ladder safety'

distance = 138
spam score = 10
title = 'pipe flange'

distance = 145
spam score = 11
title = 'mrrooftuneupca'

distance = 150
spam score = 9
title = 'repairs'

distance = 166
spam score = 11
title = 'elvis benoit'

distance = 166
spam score = 9
title = 'business'

distance = 173
spam score = 9
title = 'box'

distance = 174
spam score = 9
title = 'reflective'

distance = 174
spam score = 9
title = 'hips'

distance = 176
spam score = 9
title = 'heating'

distance = 181
spam score = 9
title = 'uv'

distance = 181
spam score = 9
title = 'panels'

distance = 183
spam score = 9
title = 'timber'

distance = 186
spam score = 14
title = 'howto'

distance = 186
spam score = 9
title = 'tiles'

distance = 187
spam score = 9
title = 'kingspan'

distance = 190
spam score = 10
title = 'guttering'

distance = 190
spam score = 9
title = 'gutter'

distance = 191
spam score = 9
title = 'fascias'

distance = 198
spam score = 13
title = 'changing roofs'

distance = 199
spam score = 13
title = 'polyroof 185'

distance = 199
spam score = 13
title = 'flat roof solutions'

distance = 201
spam score = 9
title = 'treelike'

distance = 202
spam score = 9
title = 'rotted'

distance = 205
spam score = 12
title = 'rubberbond'

distance = 205
spam score = 14
title = 'video'

distance = 212
spam score = 15
title = 'south'

distance = 217
spam score = 15
title = 'diy'

distance = 220
spam score = 15
title = 'avenir'

distance = 220
spam score = 14
title = 'seal'

distance = 228
spam score = 15
title = 'plytech'

distance = 230
spam score = 15
title = 'rubba'

distance = 234
spam score = 15
title = 'rubercover'

distance = 236
spam score = 14
title = 'sketchup'

distance = 239
spam score = 14
title = 'measurement'

distance = 247
spam score = 15
title = 'permaroof'

distance = 250
spam score = 14
title = 'parapet'

distance = 252
spam score = 14
title = 'vcb'

distance = 254
spam score = 14
title = 'offset'

distance = 258
spam score = 14
title = 'tutorial'

distance = 259
spam score = 13
title = 'pushpull'

distance = 260
spam score = 14
title = 'extrude'

distance = 273
spam score = 13
title = 'dummies'

distance = 286
spam score = 14
title = 'aidanchopra'

distance = 303
spam score = 11
title = 'coolflatroof'

distance = 308
spam score = 11
title = 'newenglandmetalroof'

distance = 317
spam score = 11
title = 'arizona roofing company'

distance = 318
spam score = 13
title = 'topseal'

distance = 330
spam score = 11
title = 'tile roof leak repair'

distance = 331
spam score = 17
title = 'roofing part 2'

distance = 334
spam score = 10
title = 'roof leaks nobody could find'

distance = 340
spam score = 12
title = 'phoenix arizona'

distance = 341
spam score = 11
title = 'scottsdale'

distance = 345
spam score = 18
title = 'paddington'

distance = 350
spam score = 13
title = 'dereklyallgrp'

distance = 351
spam score = 11
title = 'trades unlimited'

distance = 360
spam score = 17
title = 'zink'

distance = 362
spam score = 17
title = 'chiswick'

distance = 373
spam score = 18
title = 'minral'

distance = 375
spam score = 11
title = 'valley repair'

distance = 381
spam score = 11
title = 'eavestrough repair'

distance = 386
spam score = 11
title = 'mississauga'

distance = 391
spam score = 11
title = 'shingle repair'

distance = 410
spam score = 12
title = 'flat roof repair'

distance = 576
spam score = 11
title = 'flat roof coating'

distance = 650
spam score = 4
title = 'flat roof installation 8211 drip edge pvc clad metal installation'

distance = 669
spam score = 4
title = 'flat roof installation 8211 drip edge pvc clad metal installation'

distance = 681
spam score = 11
title = 'polyroof flat roof solutions'

distance = 753
spam score = 10
title = 'eternabond perfect for fixing chicagos leaking flat roofs'

distance = 785
spam score = 4
title = 'flat roof repair'

distance = 799
spam score = 4
title = 'what is epdm rubber flat roofing'

distance = 799
spam score = 3
title = 'what is epdm rubber flat roofing'

distance = 802
spam score = 18
title = 'chicago flat roof flat roofing repair roof coatings'

distance = 818
spam score = 4
title = 'flat roof repair'

distance = 831
spam score = 4
title = 'sketchup building flat roofs with parapets'

distance = 835
spam score = 7
title = 'tile and flat roof repair in phoenix arizona'

distance = 852
spam score = 5
title = 'sketchup building flat roofs with parapets'

distance = 858
spam score = 4
title = 'topseal grp flat roofing system by derek lyall roofing services ltd'

distance = 859
spam score = 7
title = 'tile and flat roof repair in phoenix arizona'

distance = 866
spam score = 4
title = 'topseal grp flat roofing system by derek lyall roofing services ltd'

distance = 868
spam score = 3
title = 'flat roof repair'

distance = 869
spam score = 1
title = 'old felt flat roof being replaced with a new epdm rubber roof'

distance = 880
spam score = 10
title = 'flat roof coating'

distance = 882
spam score = 10
title = 'types of flat roofing systems'

distance = 883
spam score = 4
title = 'flat roof installtion 8211 fully adhered'

distance = 893
spam score = 4
title = 'flat roof installtion 8211 fully adhered'

distance = 1019
spam score = 2
title = 'flat roof installation 8211 hot air welding pvc flat roof seams'

distance = 1020
spam score = 1
title = 'old felt flat roof being replaced with a new epdm rubber roof'

distance = 1083
spam score = 7
title = 'chicago flat roof coating'

distance = 67
spam score = 8
title = 'reforming the reformers choice media tv education reform homepage'

distance = 76
spam score = 7
title = 'over 40 atlanta schools lose accreditation choice media tv education reform homepage'

distance = 77
spam score = 7
title = 'ky district under investigation choice media tv education reform homepage'

distance = 88
spam score = 11
title = 'archive choice media tv education reform homepage'

distance = 101
spam score = 6
title = 'new hampshire debates school funding choice media tv education reform homepage'

distance = 104
spam score = 6
title = 'schools explore corporate partnerships choice media tv education reform homepage'

distance = 104
spam score = 7
title = 'school choice empowering ed entrepreneurs choice media tv education reform homepage'

distance = 107
spam score = 8
title = 'principal helped herself to school funds choice media tv education reform homepage'

distance = 108
spam score = 8
title = 'unions want to stop online learning choice media tv education reform homepage'

distance = 112
spam score = 8
title = 'denver school board race heats up choice media tv education reform homepage'

distance = 120
spam score = 8
title = 'only 13 of ca students pass pe test choice media tv education reform homepage'

distance = 121
spam score = 10
title = 'chester pa schools are broke amp might close choice media tv education reform homepage'

distance = 129
spam score = 8
title = 'a closer look at charter practices choice media tv education reform homepage'

distance = 130
spam score = 6
title = 'catfight board pres vs teacher choice media tv education reform homepage'

distance = 131
spam score = 7
title = 'hawaii toughens graduation standards choice media tv education reform homepage'

distance = 132
spam score = 8
title = 'how8217s this for change do nothing choice media tv education reform homepage'

distance = 133
spam score = 12
title = 'nh considers constitutional amendment choice media tv education reform homepage'

distance = 133
spam score = 7
title = 'ca districts 8216budgetary abyss8217 choice media tv education reform homepage'

distance = 134
spam score = 11
title = 'teacher8217s choice promo choice media tv education reform homepage'

distance = 135
spam score = 11
title = 'what8217s missing from ed reform debate choice media tv education reform homepage'

distance = 215
spam score = 12
title = 'worst ga schools get 19m from feds choice media tv education reform homepage'

distance = 216
spam score = 16
title = 'neglecting roots of the achievement gap choice media tv education reform homepage'

distance = 222
spam score = 8
title = 'tn to publish teacher ratings choice media tv education reform homepage'

distance = 222
spam score = 12
title = 'ct gov plans ed reform road show choice media tv education reform homepage'

distance = 222
spam score = 7
title = 'school tax fight in boise idaho choice media tv education reform homepage'

distance = 223
spam score = 9
title = 'nyc posts 18000 teacher ratings online choice media tv education reform homepage'

distance = 223
spam score = 12
title = 'why principals don8217t fire bad teachers choice media tv education reform homepage'

distance = 226
spam score = 11
title = 'fort worth teachers given up to 10k to quit choice media tv education reform homepage'

distance = 229
spam score = 11
title = 'iowa house passes education reform bill choice media tv education reform homepage'

distance = 229
spam score = 12
title = 'tensions rising as indy schools compete choice media tv education reform homepage'

distance = 250
spam score = 8
title = 'nyc teacher arrested for sexual abuse choice media tv education reform homepage'

distance = 253
spam score = 10
title = 'mn board oks 64 million in budget cuts choice media tv education reform homepage'

distance = 253
spam score = 12
title = 'ok bill for teacher 8216certifications8217 choice media tv education reform homepage'

distance = 254
spam score = 13
title = 'ok board considers longer school days choice media tv education reform homepage'

distance = 254
spam score = 5
title = 'superintendent recall effort in california choice media tv education reform homepage'

distance = 255
spam score = 7
title = 'co dist cuts instruction to 4 daysweek choice media tv education reform homepage'

distance = 256
spam score = 7
title = 'assistant principal convicted of bank fraud choice media tv education reform homepage'

distance = 256
spam score = 10
title = 'al legislature joins gov in support of charters choice media tv education reform homepage'

distance = 259
spam score = 8
title = 'cmtv store choice media tv education reform homepage'

distance = 260
spam score = 9
title = 'la rep calls treatment of teachers 8216atrocity8217 choice media tv education reform homepage'

distance = 276
spam score = 11
title = 'judge orders school remove prayer mural choice media tv education reform homepage'

distance = 278
spam score = 8
title = 'students discover teacher8217s porn star past choice media tv education reform homepage'

distance = 278
spam score = 11
title = 'wi board 8216concerned8217 about parental choice choice media tv education reform homepage'

distance = 278
spam score = 11
title = 'wyoming ed reform bill goes to house floor choice media tv education reform homepage'

distance = 279
spam score = 8
title = 'virginia mother fined for kids8217 tardies choice media tv education reform homepage'

distance = 281
spam score = 10
title = '6th teacher charged in nyc for sex abuse choice media tv education reform homepage'

distance = 281
spam score = 6
title = 'la union layoffs must be senioritybased choice media tv education reform homepage'

distance = 281
spam score = 10
title = 'ok city super takeover could be 8216fatal8217 choice media tv education reform homepage'

distance = 281
spam score = 5
title = 'ed services tax money yes oversight no choice media tv education reform homepage'

distance = 282
spam score = 15
title = 'stunning level of test dishonesty choice media tv education reform homepage'

distance = 308
spam score = 15
title = 'alabama union balks at 8216flexibility8217 choice media tv education reform homepage'

distance = 308
spam score = 14
title = 'what charters mean to me choice media tv education reform homepage'

distance = 308
spam score = 6
title = 'alleged 8216severe8217 cheating at st louis school choice media tv education reform homepage'

distance = 309
spam score = 11
title = '3 reasons school choice is growing choice media tv education reform homepage'

distance = 309
spam score = 15
title = 'la dist cuts 182 positions saves 45m choice media tv education reform homepage'

distance = 309
spam score = 8
title = 'khan academy the future of education choice media tv education reform homepage'

distance = 309
spam score = 10
title = 'co literacy bill sparks debate on flunking choice media tv education reform homepage'

distance = 310
spam score = 10
title = 'protests over sex ed bill in utah choice media tv education reform homepage'

distance = 311
spam score = 7
title = 'school accountant files whistleblower suit choice media tv education reform homepage'

distance = 313
spam score = 9
title = 'nh scholarship tax credit bill introduced choice media tv education reform homepage'

distance = 341
spam score = 10
title = 'harlem charter recruits autistic students choice media tv education reform homepage'

distance = 341
spam score = 13
title = 'teacher8217s choice choice media tv education reform homepage'

distance = 342
spam score = 21
title = 'florida virtual school 8211 leading a quiet revolution choice media tv education reform homepage'

distance = 344
spam score = 14
title = 'rise and fall of the first statewide voucher law choice media tv education reform homepage'

distance = 344
spam score = 14
title = 'texas ontime college grad rate 20 choice media tv education reform homepage'

distance = 346
spam score = 10
title = 'hiphop science show tours country choice media tv education reform homepage'

distance = 354
spam score = 16
title = 'charter school group chooses wrong side choice media tv education reform homepage'

distance = 359
spam score = 12
title = 'massachusetts okays four new charters choice media tv education reform homepage'

distance = 359
spam score = 16
title = 'students for education reform choice media tv education reform homepage'

distance = 361
spam score = 12
title = 'la senate panel approves jindal8217s reforms choice media tv education reform homepage'

distance = 409
spam score = 10
title = 'what about the kids who behave choice media tv education reform homepage'

distance = 416
spam score = 25
title = 'whistleblower choice media tv education reform homepage'

distance = 418
spam score = 14
title = 'bob bowdon with michelle rhee on teacher evaluations choice media tv education reform homepage'

distance = 422
spam score = 9
title = 'response to the 8216for profit8217 charter attack choice media tv education reform homepage'

distance = 429
spam score = 22
title = 'contact choice media tv education reform homepage'

distance = 434
spam score = 20
title = 'michelle rhee8217s false dichotomies choice media tv education reform homepage'

distance = 434
spam score = 20
title = 'cmtv store choice media tv education reform homepage'

distance = 460
spam score = 15
title = 'indoctrination with kyle olson choice media tv education reform homepage'

distance = 463
spam score = 16
title = 'competition is good for schools choice media tv education reform homepage'

distance = 477
spam score = 9
title = 'nebraska choice media tv education reform homepage'

distance = 617
spam score = 21
title = 'district to rehire teacher who viewed porn choice media tv education reform homepage'

distance = 622
spam score = 18
title = 'education spending made simple choice media tv education reform homepage'

distance = 646
spam score = 29
title = 'occupy education in new york city choice media tv education reform homepage'

distance = 646
spam score = 13
title = 'dead teacher8217s wife pockets 218k pension choice media tv education reform homepage'

distance = 664
spam score = 5
title = 'south carolina choice media tv education reform homepage'

distance = 667
spam score = 27
title = 'cnn on the politics of education choice media tv education reform homepage'

distance = 672
spam score = 18
title = 'ny gov launches ads on tenure reform choice media tv education reform homepage'

distance = 672
spam score = 33
title = 'rutgers to review nj8217s teacher eval plan choice media tv education reform homepage'

distance = 687
spam score = 53
title = 'choice calendar 8211 one month view choice media tv education reform homepage'

distance = 691
spam score = 25
title = '366 ft worth teachers take buyout choice media tv education reform homepage'

distance = 773
spam score = 36
title = 'ct gov vows to veto a weak ed reform bill choice media tv education reform homepage'

distance = 778
spam score = 20
title = 'charlotte board requests 275m budget hike choice media tv education reform homepage'

distance = 787
spam score = 19
title = 'gop presidential candidates on ed reform choice media tv education reform homepage'

distance = 790
spam score = 39
title = 'new orleans charter lotteries go digital choice media tv education reform homepage'

distance = 793
spam score = 27
title = 'federal suit over abuse of special ed kid choice media tv education reform homepage'

distance = 793
spam score = 20
title = 'tn house denies referendum on new districts choice media tv education reform homepage'

distance = 795
spam score = 29
title = 'wi gov to union what are you hiding choice media tv education reform homepage'

distance = 799
spam score = 36
title = 'how 8216reform8217 is harming public schools choice media tv education reform homepage'

distance = 800
spam score = 25
title = 'reverse discrimination charter lawsuit choice media tv education reform homepage'

distance = 803
spam score = 27
title = 'nh senate tax credit hearing scheduled choice media tv education reform homepage'

distance = 1043
spam score = 42
title = 'parent trigger showdown set for florida senate choice media tv education reform homepage'

distance = 1079
spam score = 3
title = 'arkansas choice media tv education reform homepage'

distance = 1215
spam score = 2
title = 'steven brill on 8220class warfare8221 choice media tv education reform homepage'

distance = 1537
spam score = 97
title = 'news pa school choice'

distance = 1637
spam score = 63
title = 'memorymap news raquo 2009 raquo april'

distance = 238
spam score = 79
title = ''

distance = 256
spam score = 79
title = ''

distance = 265
spam score = 79
title = ''

distance = 276
spam score = 81
title = ''

distance = 299
spam score = 76
title = ''

distance = 303
spam score = 76
title = ''

distance = 308
spam score = 76
title = ''

distance = 333
spam score = 74
title = ''

distance = 334
spam score = 71
title = ''

distance = 341
spam score = 72
title = ''

distance = 345
spam score = 67
title = ''

distance = 350
spam score = 68
title = ''

distance = 355
spam score = 68
title = ''

distance = 360
spam score = 72
title = ''

distance = 378
spam score = 79
title = ''

distance = 382
spam score = 79
title = ''

distance = 384
spam score = 80
title = ''

distance = 394
spam score = 79
title = ''

distance = 399
spam score = 80
title = ''

distance = 406
spam score = 72
title = ''

distance = 409
spam score = 79
title = ''

distance = 435
spam score = 78
title = ''

distance = 481
spam score = 78
title = ''

distance = 561
spam score = 73
title = ''

distance = 569
spam score = 70
title = ''

distance = 575
spam score = 71
title = ''

distance = 657
spam score = 70
title = ''

distance = 671
spam score = 76
title = ''

distance = 689
spam score = 56
title = ''

distance = 733
spam score = 83
title = ''

distance = 755
spam score = 66
title = ''

distance = 896
spam score = 57
title = ''

distance = 183
spam score = 80
title = 'testimonials dog supplement with glucosamine pooch and mutt dog health supplements'

distance = 195
spam score = 80
title = 'show winning spaniel dog supplements pooch and mutt dog health supplements'

distance = 200
spam score = 77
title = 'bbc radios jo good help bulldog with skin problems pooch and mutt dog health supplements'

distance = 200
spam score = 76
title = 'bbc radios jo good help bulldog with skin problems pooch and mutt dog health supplements'

distance = 214
spam score = 80
title = 'maltese glossy coat pooch and mutt dog health supplements'

distance = 219
spam score = 85
title = 'health supplement probiotic for dogs pooch and mutt dog health supplements'

distance = 219
spam score = 85
title = 'health supplement probiotic for dogs pooch and mutt dog health supplements'

distance = 220
spam score = 80
title = 'cla game fair pooch and mutt dog health supplements'

distance = 220
spam score = 78
title = 'german shepherd with skin condition bionic biotic pooch and mutt dog health supplements'

distance = 220
spam score = 78
title = 'german shepherd with skin condition bionic biotic pooch and mutt dog health supplements'

distance = 230
spam score = 86
title = 'golden retriever helped by condition supplement pooch and mutt dog health supplements'

distance = 230
spam score = 86
title = 'golden retriever helped by condition supplement pooch and mutt dog health supplements'

distance = 232
spam score = 83
title = 'mini dachshund coat brightener healthy skin supplement for dogs pooch and mutt dog health supplements'

distance = 232
spam score = 82
title = 'mini dachshund coat brightener healthy skin supplement for dogs pooch and mutt dog health supplements'

distance = 237
spam score = 71
title = 'video review bionic biotic to help runny stools pooch and mutt dog health supplements'

distance = 244
spam score = 72
title = 'video review joint supplement for 13 year old pug pooch and mutt dog health supplements'

distance = 245
spam score = 74
title = 'cairn terrier dog with runny stools pooch and mutt dog health supplements'

distance = 245
spam score = 84
title = 'bulldog with sore paws natural remedies for dogs pooch and mutt dog health supplements'

distance = 245
spam score = 91
title = 'old terrier itchy skin runny stools pooch and mutt dog health supplements'

distance = 245
spam score = 74
title = 'cairn terrier dog with runny stools pooch and mutt dog health supplements'

distance = 317
spam score = 84
title = 'lurcher delicate digestion loss of appetite pooch and mutt dog health supplements'

distance = 318
spam score = 78
title = 'westie west highland terrier runny stools pooch and mutt dog health supplements'

distance = 318
spam score = 82
title = 'itchy jack russell dog natural remedy pooch and mutt dog health supplements'

distance = 318
spam score = 78
title = 'westie west highland terrier runny stools pooch and mutt dog health supplements'

distance = 318
spam score = 83
title = 'itchy jack russell dog natural remedy pooch and mutt dog health supplements'

distance = 319
spam score = 78
title = 'old dog stiff joints joint supplement pooch and mutt dog health supplements'

distance = 319
spam score = 86
title = 'boxer discomfort of the spine pooch and mutt dog health supplements'

distance = 319
spam score = 86
title = 'boxer discomfort of the spine pooch and mutt dog health supplements'

distance = 320
spam score = 84
title = 'collie with stiff joints joint supplement for dogs pooch and mutt dog health supplements'

distance = 320
spam score = 84
title = 'collie with stiff joints joint supplement for dogs pooch and mutt dog health supplements'

distance = 347
spam score = 72
title = 'other comments pooch and mutt dog health supplements'

distance = 348
spam score = 89
title = 'golden retriever stiff joints pooch and mutt dog health supplements'

distance = 348
spam score = 89
title = 'golden retriever stiff joints pooch and mutt dog health supplements'

distance = 348
spam score = 82
title = 'setter weight gain usa dog supplements pooch and mutt dog health supplements'

distance = 349
spam score = 85
title = 'rescue dog itching and scratching dog skin supplement pooch and mutt dog health supplements'

distance = 349
spam score = 83
title = 'german shepherd dog shepherd belly pooch and mutt dog health supplements'

distance = 349
spam score = 75
title = 'rottweiler with hip dysplasia mobile bones pooch and mutt dog health supplements'

distance = 349
spam score = 74
title = 'rottweiler with hip dysplasia mobile bones pooch and mutt dog health supplements'

distance = 349
spam score = 83
title = 'german shepherd dog shepherd belly pooch and mutt dog health supplements'

distance = 351
spam score = 86
title = 'chow dog with stiff joints supplement with glucosamine for dogs pooch and mutt dog health supplements'

distance = 373
spam score = 77
title = 'labrador runny stools natural remedies pooch and mutt dog health supplements'

distance = 373
spam score = 83
title = 'probiotic for dogs bionic biotic dog health supplement pooch and mutt'

distance = 373
spam score = 77
title = 'labrador runny stools natural remedies pooch and mutt dog health supplements'

distance = 375
spam score = 86
title = 'labrador hip discomfort pooch and mutt dog health supplements'

distance = 375
spam score = 86
title = 'labrador hip discomfort pooch and mutt dog health supplements'

distance = 375
spam score = 90
title = 'collie stiff hips pooch and mutt dog health supplements'

distance = 377
spam score = 84
title = 'doberman skin problems itching and scratching pooch and mutt dog health supplements'

distance = 377
spam score = 84
title = 'doberman skin problems itching and scratching pooch and mutt dog health supplements'

distance = 380
spam score = 81
title = 'setter with colitis runny stools pooch and mutt dog health supplements'

distance = 380
spam score = 81
title = 'setter with colitis runny stools pooch and mutt dog health supplements'

distance = 415
spam score = 81
title = 'weimaraner runny stools weight gain pooch and mutt dog health supplements'

distance = 415
spam score = 83
title = 'springer spaniel skin coat pooch and mutt dog health supplements'

distance = 416
spam score = 80
title = 'hello world pooch and mutt dog health supplements'

distance = 416
spam score = 80
title = 'hello world pooch and mutt dog health supplements'

distance = 417
spam score = 84
title = 'cockerpoo dog with hip dislocation pooch and mutt dog health supplements'

distance = 417
spam score = 84
title = 'cockerpoo dog with hip dislocation pooch and mutt dog health supplements'

distance = 418
spam score = 84
title = 'whippet foul wind runny stools pooch and mutt dog health supplements'

distance = 421
spam score = 84
title = '19 year old yorkshire terrier with collitis pooch and mutt dog health supplements'

distance = 421
spam score = 84
title = '19 year old yorkshire terrier with collitis pooch and mutt dog health supplements'

distance = 423
spam score = 87
title = 'tibetan terrier runny stools itching pooch and mutt dog health supplements'

distance = 454
spam score = 83
title = 'corgie pooch and mutt'

distance = 454
spam score = 82
title = 'colle x springer stiff joints joint supplement pooch and mutt dog health supplements'

distance = 456
spam score = 83
title = 'underweight rescue cockerpoo cocker spaniel x poodle pooch and mutt dog health supplements'

distance = 456
spam score = 81
title = 'pooch amp mutt 8216we8217re all going on a summer howliday8217 pooch and mutt dog health supplements'

distance = 456
spam score = 83
title = 'underweight rescue cockerpoo cocker spaniel x poodle pooch and mutt dog health supplements'

distance = 457
spam score = 86
title = 'labrador stiff joints pooch and mutt dog health supplements'

distance = 457
spam score = 85
title = 'joint supplement for dogs labrador hip replacement pooch and mutt dog health supplements'

distance = 457
spam score = 76
title = 'labrador joint stiffness glucosamine for dogs pooch and mutt dog health supplements'

distance = 457
spam score = 80
title = 'pooch amp mutt tantalising tennis balls pooch and mutt dog health supplements'

distance = 457
spam score = 76
title = 'labrador joint stiffness glucosamine for dogs pooch and mutt dog health supplements'

distance = 489
spam score = 76
title = 'pooch and mutt'

distance = 491
spam score = 85
title = 'german shepherd diarrhea german shepherd itching pooch and mutt dog health supplements'

distance = 491
spam score = 87
title = 'lurcher with hip dysplasia joint supplement for dogs pooch and mutt dog health supplements'

distance = 491
spam score = 85
title = 'german shepherd diarrhea german shepherd itching pooch and mutt dog health supplements'

distance = 491
spam score = 87
title = 'lurcher with hip dysplasia joint supplement for dogs pooch and mutt dog health supplements'

distance = 493
spam score = 83
title = 'rescue border collie skin coat stools pooch and mutt dog health supplements'

distance = 493
spam score = 85
title = 'pointer pooch and mutt'

distance = 494
spam score = 87
title = 'itchy american bulldog with colitis pooch and mutt dog health supplements'

distance = 494
spam score = 87
title = 'itchy american bulldog with colitis pooch and mutt dog health supplements'

distance = 495
spam score = 79
title = 'pooch mutt affiliate login pooch and mutt'

distance = 543
spam score = 89
title = 'labrador dog mobility pooch and mutt dog health supplements'

distance = 544
spam score = 81
title = 'spaniel with runny stools natural remedy for dogs pooch and mutt dog health supplements'

distance = 544
spam score = 81
title = 'spaniel with runny stools natural remedy for dogs pooch and mutt dog health supplements'

distance = 544
spam score = 83
title = 'german shepherd weight condition loose motions pooch and mutt dog health supplements'

distance = 545
spam score = 88
title = 'pooch and mutt'

distance = 546
spam score = 85
title = 'st bernard skin problems itching pooch and mutt dog health supplements'

distance = 546
spam score = 85
title = 'st bernard skin problems itching pooch and mutt dog health supplements'

distance = 552
spam score = 83
title = 'rescue shih tzu with itchy skin dog itchy skin remedy pooch and mutt dog health supplements'

distance = 552
spam score = 82
title = 'gsd german shepherd i digestion soft stools pooch and mutt dog health supplements'

distance = 552
spam score = 82
title = 'gsd german shepherd i digestion soft stools pooch and mutt dog health supplements'

distance = 668
spam score = 80
title = 'spaniel with stiff joints metacam side effects glucosamine for dogs pooch and mutt dog health supplements'

distance = 677
spam score = 74
title = 'putting the walkies into work pooch and mutt dog health supplements'

distance = 680
spam score = 84
title = 'bionic biotic probiotic for dogs health pooch and mutt'

distance = 686
spam score = 87
title = 'label information mobile bones pooch and mutt'

distance = 686
spam score = 82
title = 'luxating patella pooch and mutt'

distance = 687
spam score = 83
title = 'pooch and mutt dog health supplements'

distance = 693
spam score = 69
title = 'order dog supplements pooch and mutt'

distance = 695
spam score = 69
title = 'guarantee pooch and mutt'

distance = 700
spam score = 71
title = 'buy bionic biotic dog health supplement usa pooch and mutt'

distance = 704
spam score = 86
title = 'vet trials joint supplement for dogs luxating patella pooch and mutt dog health supplements'

distance = 982
spam score = 72
title = 'tyson runny stools tyson dog with diarrhea pooch and mutt dog health supplements'

distance = 1132
spam score = 85
title = 'stockists natural dog supplements pooch and mutt'

distance = 14
spam score = 90
title = ''

distance = 14
spam score = 90
title = ''

distance = 14
spam score = 90
title = ''

distance = 14
spam score = 90
title = ''

distance = 14
spam score = 90
title = ''

distance = 14
spam score = 90
title = ''

distance = 14
spam score = 90
title = ''

distance = 14
spam score = 90
title = ''

distance = 15
spam score = 90
title = ''

distance = 15
spam score = 90
title = ''

distance = 15
spam score = 90
title = ''

distance = 16
spam score = 91
title = ''

distance = 18
spam score = 90
title = ''

distance = 18
spam score = 90
title = ''

distance = 19
spam score = 90
title = ''

distance = 19
spam score = 90
title = ''

distance = 31
spam score = 90
title = ''

distance = 31
spam score = 90
title = ''

distance = 31
spam score = 89
title = ''

distance = 31
spam score = 89
title = ''

distance = 32
spam score = 89
title = ''

distance = 32
spam score = 89
title = ''

distance = 32
spam score = 90
title = ''

distance = 32
spam score = 89
title = ''

distance = 32
spam score = 89
title = ''

distance = 34
spam score = 90
title = ''

distance = 35
spam score = 89
title = ''

distance = 41
spam score = 89
title = ''

distance = 41
spam score = 89
title = ''

distance = 41
spam score = 89
title = ''

distance = 41
spam score = 89
title = ''

distance = 42
spam score = 89
title = ''

distance = 44
spam score = 89
title = ''

distance = 54
spam score = 91
title = ''

distance = 54
spam score = 87
title = ''

distance = 55
spam score = 87
title = ''

distance = 57
spam score = 87
title = ''

distance = 67
spam score = 90
title = ''

distance = 74
spam score = 91
title = ''

distance = 76
spam score = 92
title = ''

distance = 79
spam score = 91
title = ''

distance = 80
spam score = 90
title = ''

distance = 81
spam score = 90
title = ''

distance = 83
spam score = 90
title = ''

distance = 88
spam score = 90
title = ''

distance = 88
spam score = 90
title = ''

distance = 89
spam score = 91
title = ''

distance = 89
spam score = 91
title = ''

distance = 93
spam score = 91
title = ''

distance = 98
spam score = 91
title = ''

distance = 99
spam score = 91
title = ''

distance = 99
spam score = 91
title = ''

distance = 101
spam score = 91
title = ''

distance = 108
spam score = 90
title = ''

distance = 109
spam score = 91
title = ''

distance = 112
spam score = 90
title = ''

distance = 118
spam score = 90
title = ''

distance = 1550
spam score = 81
title = ''

distance = 1551
spam score = 79
title = ''

distance = 1609
spam score = 10
title = ''

distance = 1769
spam score = 69
title = ''

distance = 1779
spam score = 86
title = ''

distance = 156
spam score = 68
title = 'people039s blog for the constitution raquo news digest 82510'

distance = 158
spam score = 78
title = 'people039s blog for the constitution raquo news digest 2910'

distance = 166
spam score = 76
title = 'people039s blog for the constitution raquo news digest 82010'

distance = 177
spam score = 74
title = 'people039s blog for the constitution raquo news digest 31011'

distance = 178
spam score = 77
title = 'people039s blog for the constitution raquo news digest 21010'

distance = 180
spam score = 72
title = 'people039s blog for the constitution raquo news digest 21111'

distance = 182
spam score = 76
title = 'people039s blog for the constitution raquo news digest 63011'

distance = 182
spam score = 78
title = 'people039s blog for the constitution raquo news digest 61011'

distance = 188
spam score = 72
title = 'people039s blog for the constitution raquo news digest 41211'

distance = 196
spam score = 76
title = 'people039s blog for the constitution raquo news digest 102810'

distance = 197
spam score = 76
title = 'people039s blog for the constitution raquo news digest 32111'

distance = 197
spam score = 73
title = 'people039s blog for the constitution raquo news digest 12011'

distance = 198
spam score = 68
title = 'people039s blog for the constitution raquo news digest 3211'

distance = 198
spam score = 80
title = 'people039s blog for the constitution raquo news digest 3911'

distance = 200
spam score = 80
title = 'people039s blog for the constitution raquo news digest 6711'

distance = 201
spam score = 70
title = 'people039s blog for the constitution raquo news digest 11911'

distance = 203
spam score = 76
title = 'people039s blog for the constitution raquo news digest 111511'

distance = 205
spam score = 79
title = 'people039s blog for the constitution raquo news digest 91709'

distance = 208
spam score = 69
title = 'people039s blog for the constitution raquo news digest 9911'

distance = 208
spam score = 74
title = 'people039s blog for the constitution raquo news digest 6211'

distance = 265
spam score = 83
title = 'people039s blog for the constitution raquo colbert on the patriot act'

distance = 265
spam score = 84
title = 'people039s blog for the constitution raquo speaking out through music and art'

distance = 270
spam score = 75
title = 'people039s blog for the constitution raquo news digest 41312'

distance = 270
spam score = 81
title = 'people039s blog for the constitution raquo news digest 41511'

distance = 272
spam score = 76
title = 'people039s blog for the constitution raquo news digest 031412'

distance = 274
spam score = 78
title = 'people039s blog for the constitution raquo daniel ellsberg 8220manning is no different than i8221'

distance = 274
spam score = 80
title = 'people039s blog for the constitution raquo news digest 11109'

distance = 275
spam score = 72
title = 'people039s blog for the constitution raquo news digest 22312'

distance = 275
spam score = 83
title = 'people039s blog for the constitution raquo news digest 41111'

distance = 276
spam score = 83
title = 'people039s blog for the constitution raquo watch torturing democracy online'

distance = 301
spam score = 71
title = 'people039s blog for the constitution raquo if you are not outraged8230'

distance = 302
spam score = 79
title = 'people039s blog for the constitution raquo news digest 111109'

distance = 304
spam score = 87
title = 'people039s blog for the constitution raquo archiving atrocities'

distance = 307
spam score = 65
title = 'people039s blog for the constitution raquo islam for cops'

distance = 307
spam score = 73
title = 'people039s blog for the constitution raquo news digest 3612'

distance = 307
spam score = 84
title = 'people039s blog for the constitution raquo how the media treats waterboarding'

distance = 308
spam score = 78
title = 'people039s blog for the constitution raquo a strip search prevention proposal'

distance = 309
spam score = 81
title = 'people039s blog for the constitution raquo organizing opportunity protest this sunday at john yoo8217s house'

distance = 311
spam score = 73
title = 'people039s blog for the constitution raquo america8217s stance on torture'

distance = 311
spam score = 65
title = 'people039s blog for the constitution raquo news digest 33012'

distance = 361
spam score = 85
title = 'people039s blog for the constitution raquo keep shining the light'

distance = 361
spam score = 69
title = 'people039s blog for the constitution raquo private contractors and the rule of law'

distance = 363
spam score = 82
title = 'people039s blog for the constitution raquo it8217s sunshine week so why are we still in the dark'

distance = 367
spam score = 83
title = 'people039s blog for the constitution raquo amherst ma votes to bring guantnamo detainees to town'

distance = 368
spam score = 80
title = 'people039s blog for the constitution raquo respecting rights is not a choice in a democracy'

distance = 369
spam score = 92
title = 'people039s blog for the constitution raquo 8220preserving our civil rights8221 northampton community forum'

distance = 369
spam score = 79
title = 'people039s blog for the constitution raquo electronic free speech suppressed in arizona'

distance = 371
spam score = 75
title = 'people039s blog for the constitution raquo manning faces pretrial hearing'

distance = 373
spam score = 79
title = 'people039s blog for the constitution raquo witchhunting muslims for fun and profit at public expense'

distance = 373
spam score = 72
title = 'people039s blog for the constitution raquo news digest 122211'

distance = 413
spam score = 67
title = 'people039s blog for the constitution raquo fear tactics on illegal immigration'

distance = 414
spam score = 69
title = 'people039s blog for the constitution raquo cell phone service interruptus'

distance = 416
spam score = 91
title = 'people039s blog for the constitution raquo hold dhs accountable'

distance = 417
spam score = 76
title = 'people039s blog for the constitution raquo we know who and where you are'

distance = 418
spam score = 70
title = 'people039s blog for the constitution raquo local authorities play fast and loose with cell phone tracking'

distance = 418
spam score = 79
title = 'people039s blog for the constitution raquo senate hearing reopens debate on profiling muslims'

distance = 418
spam score = 70
title = 'people039s blog for the constitution raquo local authorities play fast and loose with cell phone tracking'

distance = 419
spam score = 72
title = 'people039s blog for the constitution raquo new nctc guidelines threaten privacy'

distance = 419
spam score = 70
title = 'people039s blog for the constitution raquo federal court allows surveillance case to proceed against government but not against telecom companies'

distance = 420
spam score = 90
title = 'people039s blog for the constitution raquo terror inc business is booming'

distance = 463
spam score = 79
title = 'people039s blog for the constitution raquo santa clara county rejects scomm'

distance = 463
spam score = 68
title = 'people039s blog for the constitution raquo threatening the right to lawful protest'

distance = 466
spam score = 67
title = 'people039s blog for the constitution raquo be careful what you tweetsylvester8217s watching8230'

distance = 466
spam score = 75
title = 'people039s blog for the constitution raquo maryland residents and activists speak out against the ndaa'

distance = 467
spam score = 73
title = 'people039s blog for the constitution raquo rep peter king believes examining other nonmuslim extremists is 8220obscuring a real and dangerous threat8221'

distance = 468
spam score = 81
title = 'people039s blog for the constitution raquo patriot act update after a successful callin day the focus shifts to congress'

distance = 468
spam score = 71
title = 'people039s blog for the constitution raquo guantnamo commander issues order whittling down attorneyclient privilege'

distance = 468
spam score = 76
title = 'people039s blog for the constitution raquo tsa8217s nude body scanners are ineffective'

distance = 469
spam score = 66
title = 'people039s blog for the constitution raquo be calm be cool be collected8230or else'

distance = 470
spam score = 57
title = 'people039s blog for the constitution raquo ruffalo on terrorist watch list for fracking opposition'

distance = 508
spam score = 71
title = 'people039s blog for the constitution raquo former us officials under investigation for material support of terrorism'

distance = 510
spam score = 72
title = 'people039s blog for the constitution raquo don8217t mess with texas8230 unless you8217re the tsa'

distance = 510
spam score = 83
title = 'people039s blog for the constitution raquo patriot award ted stein'

distance = 512
spam score = 80
title = 'people039s blog for the constitution raquo coalition urges governors to reject sale of prisons to corporation'

distance = 513
spam score = 77
title = 'people039s blog for the constitution raquo torturederived evidence barred at trial'

distance = 518
spam score = 71
title = 'people039s blog for the constitution raquo harvard students file lawsuit over tsa patdowns'

distance = 521
spam score = 59
title = 'people039s blog for the constitution raquo new cyber bill getting big push from the spy and tech worlds'

distance = 523
spam score = 81
title = 'people039s blog for the constitution raquo tortured afghan and iraqi detainees continue to seek justice'

distance = 523
spam score = 75
title = 'people039s blog for the constitution raquo new habeas corpus bill falsely claims to 8220right8221 wrongs of the ndaa'

distance = 524
spam score = 75
title = 'people039s blog for the constitution raquo norm stamper blows the whistle on paramilitary policing'

distance = 578
spam score = 80
title = 'people039s blog for the constitution raquo patriot award naji mujahid'

distance = 579
spam score = 57
title = 'people039s blog for the constitution raquo deplorable racial profiling found in arizona sheriff8217s office'

distance = 581
spam score = 69
title = 'people039s blog for the constitution raquo the fate of immigrant rights for 2012'

distance = 584
spam score = 92
title = 'people039s blog for the constitution raquo don8217t miss this opportunity congress indistrict work period april 619'

distance = 586
spam score = 71
title = 'people039s blog for the constitution raquo shahid buttar on how surveillance impedes national security'

distance = 587
spam score = 78
title = 'people039s blog for the constitution raquo wikileak 8220war logs8221 a difficult balance'

distance = 588
spam score = 72
title = 'people039s blog for the constitution raquo state secrets provisions and procedures are not changing'

distance = 588
spam score = 76
title = 'people039s blog for the constitution raquo shahid buttar summarizes the ndaa and how to resist it'

distance = 588
spam score = 77
title = 'people039s blog for the constitution raquo torture more systematic and widespread than initially thought senate committee finds'

distance = 592
spam score = 60
title = 'people039s blog for the constitution raquo guantnamo autopsy raises concerns over mistreatment of prisoners'

distance = 665
spam score = 66
title = 'people039s blog for the constitution raquo federal appeals court rules police used excessive force in two stun gun cases'

distance = 670
spam score = 69
title = 'people039s blog for the constitution raquo patriot award gail noble'

distance = 678
spam score = 61
title = 'people039s blog for the constitution raquo amazon8217s decison to discontinue hosting wikileaks prompts boycott'

distance = 682
spam score = 80
title = 'people039s blog for the constitution raquo unsigned signing statements and selfserve law or how barack obama is like dean wormer'

distance = 682
spam score = 59
title = 'people039s blog for the constitution raquo filtering out critical thinking'

distance = 683
spam score = 81
title = 'people039s blog for the constitution raquo book review cheating justice how bush and cheney attacked the rule of law plotted to avoid prosecutionand what we can do about it'

distance = 683
spam score = 81
title = 'people039s blog for the constitution raquo book review cheating justice how bush and cheney attacked the rule of law plotted to avoid prosecutionand what we can do about it'

distance = 687
spam score = 81
title = 'people039s blog for the constitution raquo bordc strongly supports the justice act'

distance = 687
spam score = 80
title = 'people039s blog for the constitution raquo bush and blair guilty of war crimes'

distance = 691
spam score = 74
title = 'people039s blog for the constitution raquo supreme court to rule on corporations8217 liability for human rights violations'

distance = 1075
spam score = 70
title = 'people039s blog for the constitution raquo trying us officials for crimes against humanity jurisdiction may be the biggest hurdle'

distance = 1097
spam score = 77
title = 'people039s blog for the constitution raquo patriot act podcast'

distance = 1296
spam score = 78
title = 'people039s blog for the constitution raquo us researchers and pharmaceutical companies conducting human experimentation in africa'

distance = 1385
spam score = 64
title = 'arduino blog raquo blog archive raquo arduino flamethrower guitarhero rockstar'

distance = 1512
spam score = 30
title = 'flamenco shop tipp'

distance = 90
spam score = 89
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 90
spam score = 89
title = 'crossfit workout 200410 crossfit ignite sydney'

distance = 92
spam score = 89
title = 'crossfit workout again girl push up crossfit ignite sydney'

distance = 96
spam score = 86
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 100
spam score = 87
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 102
spam score = 86
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 103
spam score = 90
title = 'crossfit workout 122 girl overhead crossfit ignite sydney'

distance = 105
spam score = 87
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 107
spam score = 86
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 108
spam score = 87
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 109
spam score = 87
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 110
spam score = 86
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 110
spam score = 84
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 111
spam score = 87
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 111
spam score = 88
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 111
spam score = 89
title = 'crossfit workout power and grace girl lsit crossfit ignite sydney'

distance = 112
spam score = 88
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 112
spam score = 90
title = 'crossfit workout clean and squat girl lunge crossfit ignite sydney'

distance = 112
spam score = 90
title = 'crossfit workout hanging around crossfit ignite sydney'

distance = 112
spam score = 87
title = 'crossfit workout rest day crossfit ignite sydney'

distance = 184
spam score = 84
title = 'crossfit workout strength and t2b crossfit ignite sydney'

distance = 184
spam score = 89
title = 'crossfit workout deadlift and ring dips guy ring dip crossfit ignite sydney'

distance = 185
spam score = 81
title = 'crossfit workout spam crossfit ignite sydney'

distance = 185
spam score = 91
title = 'slider crossfit ignite sydney'

distance = 185
spam score = 78
title = 'crossfit workout karen crossfit ignite sydney'

distance = 186
spam score = 88
title = '10 fitness challenges part 3 girl rope climb crossfit ignite sydney'

distance = 189
spam score = 89
title = 'crossfit workout games team wod 6 crossfit ignite sydney'

distance = 189
spam score = 89
title = 'crossfit workout front squat spealler front squat crossfit ignite sydney'

distance = 190
spam score = 84
title = 'crossfit workout crossfit open 123 crossfit ignite sydney'

distance = 190
spam score = 86
title = 'crossfit ignite8230 a gym like no other are we for you crossfit ignite sydney'

distance = 243
spam score = 84
title = 'crossfit workout rope climbs crossfit ignite sydney'

distance = 243
spam score = 86
title = 'crossfit workout press and balance crossfit ignite sydney'

distance = 243
spam score = 85
title = 'crossfit workout snatch and db row crossfit ignite sydney'

distance = 244
spam score = 84
title = 'crossfit workout bike ride crossfit ignite sydney'

distance = 245
spam score = 90
title = 'crossfit workout 290410 crossfit ignite sydney'

distance = 247
spam score = 88
title = 'a few tips to get you through the games games2011womense1anniethorisdottirsmilecj crossfit ignite sydney'

distance = 248
spam score = 83
title = 'crossfit workout 5km row crossfit ignite sydney'

distance = 248
spam score = 86
title = 'crossfit workout burpull crossfit ignite sydney'

distance = 249
spam score = 88
title = 'crossfit workout climbing the wall crossfit ignite sydney'

distance = 251
spam score = 86
title = 'crossfit workout bike and burpees crossfit ignite sydney'

distance = 305
spam score = 93
title = 'contact crossfit ignite sydney'

distance = 308
spam score = 80
title = 'treadmill crossfit ignite sydney'

distance = 312
spam score = 83
title = 'lunges crossfit ignite sydney'

distance = 315
spam score = 86
title = 'crossfit workout bar muscle ups crossfit ignite sydney'

distance = 317
spam score = 91
title = 'a simple summer heirarchy crossfit ignite sydney'

distance = 317
spam score = 82
title = 'hill sprints crossfit ignite sydney'

distance = 318
spam score = 82
title = 'crossfit workout filly crossfit ignite sydney'

distance = 319
spam score = 84
title = 'crossfit workout clean and renegade row crossfit ignite sydney'

distance = 321
spam score = 82
title = 'not for time podcast 2 8211 4 week intensive crossfit ignite sydney'

distance = 326
spam score = 80
title = 'burpee over bar crossfit ignite sydney'

distance = 370
spam score = 82
title = 'behind neck push press crossfit ignite sydney'

distance = 371
spam score = 84
title = 'rope tidal waves crossfit ignite sydney'

distance = 373
spam score = 87
title = 'heavy singles lifting crossfit ignite sydney'

distance = 373
spam score = 91
title = 'ratatouille crossfit ignite sydney'

distance = 373
spam score = 85
title = 'helen crossfit ignite sydney'

distance = 374
spam score = 83
title = 'crossfit workout 521510 crossfit ignite sydney'

distance = 377
spam score = 79
title = 'crossfit workout power deads crossfit ignite sydney'

distance = 377
spam score = 88
title = 'crossfit workout gymnastic skills circuit crossfit ignite sydney'

distance = 378
spam score = 93
title = 'your crossfit ignite trial session crossfit ignite sydney'

distance = 379
spam score = 84
title = 'power clean push jerk crossfit ignite sydney'

distance = 421
spam score = 88
title = 'macadamia nut mayonnaise crossfit ignite sydney'

distance = 421
spam score = 78
title = 'crossfit workout squat and deadlift crossfit ignite sydney'

distance = 422
spam score = 84
title = 'crossfit workout 3 part crossfit ignite sydney'

distance = 424
spam score = 80
title = 'crossfit workout power row crossfit ignite sydney'

distance = 424
spam score = 89
title = 'a short analysis of the dish hold crossfit ignite sydney'

distance = 426
spam score = 81
title = 'burpee lateral jump crossfit ignite sydney'

distance = 429
spam score = 78
title = 'exercise goals crossfit ignite sydney'

distance = 431
spam score = 82
title = 'why you should learn new skills crossfit ignite sydney'

distance = 432
spam score = 77
title = 'why is it important to keep food journal crossfit ignite sydney'

distance = 433
spam score = 79
title = 'crossfit workout clean to thruster crossfit ignite sydney'

distance = 492
spam score = 80
title = 'the how and why of scaling wod8217s crossfit ignite sydney'

distance = 496
spam score = 89
title = 'gluten free gingerbread men crossfit ignite sydney'

distance = 497
spam score = 76
title = 'crossfit workout libra crossfit ignite sydney'

distance = 498
spam score = 93
title = 'almond flour pancakes crossfit ignite sydney'

distance = 499
spam score = 83
title = 'goulash soup crossfit ignite sydney'

distance = 507
spam score = 79
title = 'valley stampede 2011 crossfit ignite sydney'

distance = 508
spam score = 79
title = 'the reason we use free weights crossfit ignite sydney'

distance = 508
spam score = 78
title = 'crossfit workout weighted pullups or dips crossfit ignite sydney'

distance = 509
spam score = 78
title = 'how to progress my pull ups and dips crossfit ignite sydney'

distance = 510
spam score = 85
title = 'it8217ll be a stretch crossfit ignite sydney'

distance = 572
spam score = 80
title = 'crossfit workout run little angie crossfit ignite sydney'

distance = 573
spam score = 84
title = 'ginger crossfit ignite sydney'

distance = 574
spam score = 85
title = 'strength bias crossfit ignite sydney'

distance = 575
spam score = 85
title = 'crossfit workout crawl before walk crossfit ignite sydney'

distance = 576
spam score = 87
title = 'crossfit workout weighted dips crossfit ignite sydney'

distance = 576
spam score = 89
title = 'greek lamb with watermelon salad crossfit ignite sydney'

distance = 577
spam score = 84
title = 'power clean to push jerk crossfit ignite sydney'

distance = 577
spam score = 78
title = 'db row crossfit ignite sydney'

distance = 578
spam score = 82
title = 'progress crossfit ignite sydney'

distance = 579
spam score = 76
title = 'this is what i want how often do i train crossfit ignite sydney'

distance = 675
spam score = 81
title = 'clean to thruster crossfit ignite sydney'

distance = 677
spam score = 83
title = 'ignite ups the mobility but please do some homework crossfit ignite sydney'

distance = 684
spam score = 79
title = 'weaknesses crossfit ignite sydney'

distance = 687
spam score = 94
title = '8220beetroot amp eggplant chips8221 crossfit ignite sydney'

distance = 691
spam score = 84
title = 'crossfit workout kalsu crossfit ignite sydney'

distance = 692
spam score = 84
title = 'crossfit workout kalsu crossfit ignite sydney'

distance = 706
spam score = 82
title = 'crossfit workout pullups and pistols crossfit ignite sydney'

distance = 711
spam score = 82
title = 'planche crossfit ignite sydney'

distance = 715
spam score = 71
title = 'cycle crossfit ignite sydney'

distance = 721
spam score = 86
title = 'crossfit workout 8220blonde fran8221 crossfit ignite sydney'

distance = 1367
spam score = 86
title = 'journal david graham fitness'

distance = 1367
spam score = 96
title = 'invictus triathlon squad david graham fitness'

distance = 1377
spam score = 87
title = 'athletes david graham fitness'

distance = 1385
spam score = 94
title = 'regulars david graham fitness'

distance = 1386
spam score = 91
title = 'cormac mcgarry triathlete david graham fitness'

distance = 161
spam score = 48
title = 'scores raquo the daily stache'

distance = 162
spam score = 52
title = 'contact us raquo the daily stache'

distance = 164
spam score = 44
title = 'standings raquo the daily stache'

distance = 168
spam score = 48
title = 'aaron yorke stache writer raquo the daily stache'

distance = 187
spam score = 47
title = 'devon jeffreys stache writer raquo the daily stache'

distance = 188
spam score = 46
title = 'matt esposito stache writer raquo the daily stache'

distance = 199
spam score = 45
title = 'scott ilowite stache writer raquo the daily stache'

distance = 205
spam score = 25
title = 'video gary carter homers in first game as a met raquo the daily stache'

distance = 206
spam score = 24
title = 'video someone needs to tell john franco where the mets play raquo the daily stache'

distance = 230
spam score = 28
title = 'video of wednesday8217s pregame festivities at citi field raquo the daily stache'

distance = 230
spam score = 28
title = 'video mike piazza wants mets hat for hall of fame raquo the daily stache'

distance = 233
spam score = 47
title = 'matthew falkenbury creatoreditor raquo the daily stache'

distance = 233
spam score = 33
title = 'gallery opening day 2012 another year another easy win raquo the daily stache'

distance = 236
spam score = 65
title = '2011 december 15 raquo the daily stache'

distance = 242
spam score = 58
title = '2011 december 17 raquo the daily stache'

distance = 243
spam score = 56
title = 'kevin kearns stache writer raquo the daily stache'

distance = 244
spam score = 65
title = 'about us raquo the daily stache'

distance = 247
spam score = 65
title = '2012 january 22 raquo the daily stache'

distance = 249
spam score = 56
title = '2011 december 27 raquo the daily stache'

distance = 249
spam score = 59
title = '2011 december 21 raquo the daily stache'

distance = 298
spam score = 59
title = '2012 february 21 raquo the daily stache'

distance = 300
spam score = 30
title = 'cute or cruel the mets dog hangs out by seven train raquo the daily stache'

distance = 300
spam score = 62
title = '2012 march 19 raquo the daily stache'

distance = 301
spam score = 31
title = 'vote for ike raquo the daily stache'

distance = 303
spam score = 63
title = '2011 december 08 raquo the daily stache'

distance = 305
spam score = 75
title = '2012 january 10 raquo the daily stache'

distance = 306
spam score = 64
title = 'andy pettite raquo the daily stache'

distance = 308
spam score = 43
title = 'finally the moves we have been waiting for raquo the daily stache'

distance = 310
spam score = 64
title = 'fernando cabrera raquo the daily stache'

distance = 312
spam score = 55
title = 'nats raquo the daily stache'

distance = 330
spam score = 56
title = 'chris snyder raquo the daily stache'

distance = 330
spam score = 48
title = 'bullpen raquo the daily stache'

distance = 334
spam score = 55
title = 'sandy alderson raquo the daily stache'

distance = 336
spam score = 56
title = 'josh johnson raquo the daily stache'

distance = 339
spam score = 27
title = 'the difference between players8217 thoughts regarding yankees and mets raquo the daily stache'

distance = 339
spam score = 54
title = 'len berman raquo the daily stache'

distance = 339
spam score = 62
title = '2012 march 29 raquo the daily stache'

distance = 340
spam score = 18
title = 'don8217t let the door hit ya raquo the daily stache'

distance = 341
spam score = 55
title = 'jed lowrie raquo the daily stache'

distance = 342
spam score = 64
title = 'new york knicks raquo the daily stache'

distance = 357
spam score = 49
title = 'ronny cedeno raquo the daily stache'

distance = 358
spam score = 48
title = 'ross detwiler raquo the daily stache'

distance = 358
spam score = 37
title = 'mets8217 history explored at hofstra raquo the daily stache'

distance = 360
spam score = 30
title = '2012 april 03 raquo the daily stache'

distance = 364
spam score = 20
title = 'coors field don8217t get too homer happy raquo the daily stache'

distance = 364
spam score = 26
title = 'post game mets 5 giants 4 raquo the daily stache'

distance = 365
spam score = 58
title = 'brad emaus raquo the daily stache'

distance = 365
spam score = 18
title = '2012 april 08 raquo the daily stache'

distance = 372
spam score = 49
title = 'jayson werth raquo the daily stache'

distance = 377
spam score = 47
title = 'chipper jones raquo the daily stache'

distance = 429
spam score = 27
title = 'murphy8217s law mets 4 nationals 3 raquo the daily stache'

distance = 439
spam score = 34
title = 'down on the farm april 29 2012 raquo the daily stache'

distance = 439
spam score = 44
title = 'it was the spring of our discontent8230 raquo the daily stache'

distance = 440
spam score = 24
title = 'scott hairston raquo the daily stache'

distance = 440
spam score = 20
title = 'maybe the mets won8217t be so terrible raquo the daily stache'

distance = 445
spam score = 28
title = 'who we hate more the yankees or the phillies raquo the daily stache'

distance = 445
spam score = 39
title = 'jose reyes raquo the daily stache'

distance = 447
spam score = 28
title = 'ramon ramirez raquo the daily stache'

distance = 448
spam score = 23
title = 'mets not pudging on ivan raquo the daily stache'

distance = 449
spam score = 27
title = 'the best team in new york8230at least for one day raquo the daily stache'

distance = 483
spam score = 38
title = 'all8217s 8220wright8221 with johan and bullpen on opening day raquo the daily stache'

distance = 485
spam score = 22
title = '2012 april 12 raquo the daily stache'

distance = 489
spam score = 16
title = 'a video tribute to jose reyes seriously raquo the daily stache'

distance = 489
spam score = 18
title = 'pregame new york mets 63 atlanta braves 54 raquo the daily stache'

distance = 493
spam score = 19
title = 'pregame new york mets 52 philadelphia phillies 34 raquo the daily stache'

distance = 494
spam score = 20
title = 'post game mets 5 phillies 0 raquo the daily stache'

distance = 497
spam score = 15
title = 'pregame new york mets 42 philadelphia phillies 33 raquo the daily stache'

distance = 500
spam score = 25
title = 'pre game san francisco giants 77 vs new york mets 86 raquo the daily stache'

distance = 505
spam score = 30
title = 'frank francisco says his knee is ready to go despite swelling raquo the daily stache'

distance = 508
spam score = 40
title = 'the wright stuff8230or is it raquo the daily stache'

distance = 528
spam score = 44
title = 'jon rauch raquo the daily stache'

distance = 532
spam score = 26
title = 'closing time means revenge for new york mets 3 marlins 2 raquo the daily stache'

distance = 534
spam score = 29
title = 'when it comes to chipper think of the good times raquo the daily stache'

distance = 534
spam score = 36
title = 'newcitifieldwallwar raquo the daily stache'

distance = 535
spam score = 21
title = 'kirk nieuwenhuis looking like a natural raquo the daily stache'

distance = 536
spam score = 26
title = 'the pros and cons of metstwitter raquo the daily stache'

distance = 538
spam score = 36
title = 'opening day new york mets vs atlanta braves raquo the daily stache'

distance = 541
spam score = 27
title = 'mets opening day roster just about set raquo the daily stache'

distance = 542
spam score = 24
title = 'mets swept away deep in the heart of texas raquo the daily stache'

distance = 542
spam score = 20
title = 'top 10 mets prospects of 2012 6 wilmer flores raquo the daily stache'

distance = 580
spam score = 47
title = 'andres torres raquo the daily stache'

distance = 584
spam score = 36
title = 'oy postgame giants 4 mets 3 raquo the daily stache'

distance = 585
spam score = 57
title = 'did the mets shun tradition again raquo the daily stache'

distance = 586
spam score = 28
title = 'top 10 mets prospects of 2012 5 reese havens raquo the daily stache'

distance = 598
spam score = 40
title = 'pregame miami marlins 79 at mets 98 raquo the daily stache'

distance = 604
spam score = 17
title = 'pregame mets 74 at atlanta braves 65 raquo the daily stache'

distance = 605
spam score = 42
title = 'pelfrey and gee fast starts are a must raquo the daily stache'

distance = 607
spam score = 11
title = 'can 20118242s weakness be 20128242s strength raquo the daily stache'

distance = 611
spam score = 50
title = 'lucas duda raquo the daily stache'

distance = 612
spam score = 18
title = 'rumor mets plan to acknowledge chipper jones raquo the daily stache'

distance = 659
spam score = 25
title = 'pregame new york mets 10 vs atlanta braves 01 raquo the daily stache'

distance = 663
spam score = 17
title = 'really hits home jose reyes returns to new york raquo the daily stache'

distance = 678
spam score = 40
title = 'pregame mets 1311 at houston astros 1014 raquo the daily stache'

distance = 679
spam score = 19
title = 'mets fans it8217s time to deploy operation 8220everybody cool out8221 raquo the daily stache'

distance = 682
spam score = 26
title = 'down on the farm april 7 2012 raquo the daily stache'

distance = 696
spam score = 19
title = 'rip kid raquo the daily stache'

distance = 703
spam score = 16
title = 'mets fall to detwiler nats 62 raquo the daily stache'

distance = 707
spam score = 25
title = 'top 10 mets prospects of 2012 3 jeurys familia raquo the daily stache'

distance = 711
spam score = 18
title = 'pregame washington nationals 32 new york mets 41 raquo the daily stache'

distance = 712
spam score = 23
title = 'spring training numbers issued for 2012 raquo the daily stache'

distance = 823
spam score = 28
title = 'did mets front office do the right thing by letting reyes go raquo the daily stache'

distance = 838
spam score = 36
title = 'mets lose controland the series to washington raquo the daily stache'

distance = 853
spam score = 24
title = 'my carter connection8230rip 8 raquo the daily stache'

distance = 874
spam score = 17
title = 'how jose reyes took his talents to south beach raquo the daily stache'

distance = 922
spam score = 19
title = 'post game lead tie lead tie win raquo the daily stache'

distance = 35
spam score = 64
title = 'print your own8230 rtfm'

distance = 46
spam score = 64
title = 'jesus8217 general rtfm'

distance = 51
spam score = 67
title = 'smoking kills rtfm'

distance = 60
spam score = 62
title = 'scary ideas8230 rtfm'

distance = 60
spam score = 61
title = 'humans suck rtfm'

distance = 63
spam score = 59
title = 'novel concept for employers rtfm'

distance = 65
spam score = 65
title = 'why are 18 gray cards 18 gray rtfm'

distance = 65
spam score = 64
title = 'hidden agenda rtfm'

distance = 76
spam score = 64
title = 'depth of field calculator rtfm'

distance = 91
spam score = 64
title = 'making shrek feel inadequate rtfm'

distance = 95
spam score = 55
title = 'marvelous balls rtfm'

distance = 97
spam score = 65
title = 'the calm before the storm rtfm'

distance = 99
spam score = 59
title = 'little known tool for image texturing rtfm'

distance = 106
spam score = 56
title = 'color management under linux rtfm'

distance = 108
spam score = 60
title = 'ccdcmos sensor cleaning debunked rtfm'

distance = 109
spam score = 60
title = 'like both assault rifles and vodka rtfm'

distance = 112
spam score = 63
title = 'where should you sign your photographs rtfm'

distance = 112
spam score = 65
title = 'my vla naming suggestion rtfm'

distance = 121
spam score = 65
title = 'diffraction amp dslrs rtfm'

distance = 123
spam score = 71
title = 'chart of netflix plan costs vs number of dvds rtfm'

distance = 134
spam score = 63
title = 'digital slr compact flash speed benchmarks rtfm'

distance = 136
spam score = 65
title = 'chart of netflix plan costs vs number of dvds starting 20111001 rtfm'

distance = 136
spam score = 59
title = 'long live the xcom clones rtfm'

distance = 137
spam score = 63
title = 'if only every camera had gps built in8230 rtfm'

distance = 141
spam score = 61
title = 'how to sign your photographs rtfm'

distance = 149
spam score = 65
title = 'jhoblittcardfront350x200 rtfm'

distance = 150
spam score = 68
title = 'uh fitness center rtfm'

distance = 150
spam score = 69
title = 'generating hdr images on linux rtfm'

distance = 150
spam score = 63
title = 'msnbot is a pig rtfm'

distance = 155
spam score = 62
title = 'jhoblittvcf rtfm'

distance = 163
spam score = 65
title = 'choose your own adventure rtfm'

distance = 164
spam score = 64
title = 'information is information rtfm'

distance = 165
spam score = 69
title = 'oss project management divide and conquer rtfm'

distance = 165
spam score = 58
title = 'can msnbot behave rtfm'

distance = 171
spam score = 48
title = 'wtf is it with americans and 8216shinny things8217 rtfm'

distance = 174
spam score = 62
title = 'firefox 15 the final straw rtfm'

distance = 175
spam score = 63
title = '8220the shorties8221 rtfm'

distance = 181
spam score = 70
title = 'what not to fry rtfm'

distance = 186
spam score = 65
title = 'press 82168217 to disconnect rtfm'

distance = 188
spam score = 64
title = 'joe amp dagny8217s birthday party v1 pics rtfm'

distance = 197
spam score = 65
title = 'jhoblittlinkdin rtfm'

distance = 202
spam score = 65
title = 'state of hawaiihawaiiantel 1004hz 1k test phone numbers rtfm'

distance = 203
spam score = 63
title = 'default password for apc pdus rtfm'

distance = 207
spam score = 66
title = 'panoramic photography links rtfm'

distance = 208
spam score = 61
title = 'en fuego martini rtfm'

distance = 221
spam score = 60
title = 'simple margarita recipe rtfm'

distance = 225
spam score = 61
title = 'default password for infortrend ds s12sr22404 rtfm'

distance = 229
spam score = 66
title = 'remote vnc updates rtfm'

distance = 240
spam score = 63
title = 'determining the type of tftlcd in your monitor rtfm'

distance = 241
spam score = 63
title = 'grip flac amp ogg rtfm'

distance = 253
spam score = 69
title = 'default password for apc ups network management card 2 rtfm'

distance = 262
spam score = 58
title = 'how to find a mechanic that doesn8217t suck rtfm'

distance = 267
spam score = 59
title = 'bad design or just bad materials rtfm'

distance = 269
spam score = 63
title = 'jeff call log rtfm'

distance = 281
spam score = 66
title = 'default password for areca raid cards rtfm'

distance = 286
spam score = 66
title = 'polycom soundpoint 501 default admin password rtfm'

distance = 288
spam score = 75
title = 'the flaw in representational democracy rtfm'

distance = 289
spam score = 62
title = 'uv filter tests rtfm'

distance = 291
spam score = 62
title = 'datetimeformatiso8601 008 released to cpan rtfm'

distance = 296
spam score = 59
title = 'default password for 3ware 3dm2 daemon rtfm'

distance = 307
spam score = 59
title = 'democratic chaos 821708 rtfm'

distance = 328
spam score = 55
title = 'default password for qlogic sanbox 1400 fibre channel switch rtfm'

distance = 332
spam score = 61
title = 'removing all user generated pages from a trac wiki rtfm'

distance = 345
spam score = 81
title = 'wordpress yoko theme 105 released rtfm'

distance = 367
spam score = 79
title = 'rtfm read this fine material from joshua hoblitt'

distance = 372
spam score = 66
title = 'a major milestone reduced car insurance rates rtfm'

distance = 381
spam score = 67
title = 'raritan ferrite cores rtfm'

distance = 390
spam score = 62
title = 'blog resurrection8230 rtfm'

distance = 433
spam score = 53
title = 'encrypted google search rtfm'

distance = 454
spam score = 70
title = 'default password for supermicro ipmibmcs rtfm'

distance = 504
spam score = 70
title = 'scorpions fluoresce under uv light rtfm'

distance = 526
spam score = 80
title = 'darwin bobbleheads 8211 too bad this isn8217t a joke rtfm'

distance = 538
spam score = 60
title = 'google checkout8217s possible killer feature rtfm'

distance = 540
spam score = 68
title = 'blogger sftp errors rtfm'

distance = 554
spam score = 50
title = 'coolmax alta shirts rtfm'

distance = 555
spam score = 66
title = 'mysql rtfm'

distance = 557
spam score = 65
title = 'osx account creation think different think wtf rtfm'

distance = 559
spam score = 72
title = 'retaining archive links when moving from blogger to moveabletype rtfm'

distance = 566
spam score = 65
title = 'september 2007 rtfm'

distance = 575
spam score = 72
title = 'december 2008 rtfm'

distance = 588
spam score = 76
title = 'january 2012 rtfm'

distance = 611
spam score = 69
title = 'fitness rtfm'

distance = 618
spam score = 71
title = 'networking rtfm'

distance = 645
spam score = 70
title = 'june 2009 rtfm'

distance = 660
spam score = 69
title = 'sql rtfm'

distance = 664
spam score = 60
title = 'setting the default locale on gentoo to utf8 encoding rtfm'

distance = 664
spam score = 69
title = 'sql rtfm'

distance = 679
spam score = 68
title = 'privacy rtfm'

distance = 697
spam score = 81
title = 'september 2011 rtfm'

distance = 720
spam score = 71
title = 'november 2011 rtfm'

distance = 759
spam score = 72
title = 'github rtfm'

distance = 762
spam score = 72
title = 'yum rtfm'

distance = 770
spam score = 72
title = 'puppet rtfm'

distance = 780
spam score = 69
title = 'insepecting gentoo livecd builds with linux loopback devices rtfm'

distance = 784
spam score = 72
title = 'createrepo rtfm'

distance = 786
spam score = 73
title = 'october 2007 rtfm'

distance = 799
spam score = 74
title = 'winxp high cpu utilization under libvirtkvm rtfm'

distance = 877
spam score = 76
title = 'qr codes for business cards rtfm'

distance = 923
spam score = 60
title = 'how to change the mount point of a gpfs filesystem rtfm'

distance = 927
spam score = 75
title = 'skeleton template of a tree of multireleasearch yum repos rtfm'

distance = 1065
spam score = 51
title = 'rebel xt aa battery life test rtfm'

distance = 1117
spam score = 22
title = 'notes on canon digital slr cameras and lenses rtfm'

distance = 1140
spam score = 69
title = 'readding a gpfs node to an existing cluster rtfm'

distance = 1343
spam score = 32
title = 'netgear fvx538 ntp if you like it or not rtfm'

distance = 1379
spam score = 61
title = 'replacing a failed mdadm mirror disk rtfm'

distance = 117
spam score = 25
title = ''

distance = 120
spam score = 11
title = ''

distance = 126
spam score = 11
title = ''

distance = 133
spam score = 9
title = ''

distance = 134
spam score = 13
title = ''

distance = 138
spam score = 13
title = ''

distance = 151
spam score = 12
title = ''

distance = 152
spam score = 12
title = ''

distance = 154
spam score = 12
title = ''

distance = 161
spam score = 9
title = ''

distance = 163
spam score = 9
title = ''

distance = 172
spam score = 10
title = ''

distance = 174
spam score = 9
title = ''

distance = 178
spam score = 12
title = ''

distance = 185
spam score = 12
title = ''

distance = 187
spam score = 12
title = ''

distance = 189
spam score = 9
title = ''

distance = 195
spam score = 9
title = ''

distance = 195
spam score = 12
title = ''

distance = 197
spam score = 13
title = ''

distance = 198
spam score = 26
title = ''

distance = 206
spam score = 10
title = ''

distance = 208
spam score = 12
title = ''

distance = 215
spam score = 13
title = ''

distance = 227
spam score = 25
title = ''

distance = 228
spam score = 12
title = ''

distance = 229
spam score = 25
title = ''

distance = 243
spam score = 25
title = ''

distance = 252
spam score = 25
title = ''

distance = 276
spam score = 13
title = ''

distance = 279
spam score = 23
title = ''

distance = 285
spam score = 25
title = ''

distance = 310
spam score = 11
title = ''

distance = 315
spam score = 25
title = ''

distance = 316
spam score = 13
title = ''

distance = 322
spam score = 20
title = ''

distance = 351
spam score = 13
title = ''

distance = 357
spam score = 12
title = ''

distance = 373
spam score = 13
title = ''

distance = 405
spam score = 12
title = ''

distance = 409
spam score = 12
title = ''

distance = 423
spam score = 22
title = ''

distance = 442
spam score = 23
title = ''

distance = 484
spam score = 20
title = ''

distance = 487
spam score = 23
title = ''

distance = 507
spam score = 21
title = ''

distance = 507
spam score = 25
title = ''

distance = 515
spam score = 17
title = ''

distance = 535
spam score = 28
title = ''

distance = 544
spam score = 25
title = ''

distance = 570
spam score = 26
title = ''

distance = 578
spam score = 31
title = ''

distance = 582
spam score = 35
title = ''

distance = 585
spam score = 11
title = ''

distance = 597
spam score = 11
title = ''

distance = 598
spam score = 7
title = ''

distance = 608
spam score = 12
title = ''

distance = 612
spam score = 14
title = ''

distance = 628
spam score = 16
title = ''

distance = 644
spam score = 15
title = ''

distance = 647
spam score = 11
title = ''

distance = 676
spam score = 9
title = ''

distance = 691
spam score = 12
title = ''

distance = 700
spam score = 12
title = ''

distance = 745
spam score = 12
title = ''

distance = 771
spam score = 29
title = ''

distance = 975
spam score = 14
title = ''

distance = 1022
spam score = 43
title = ''

distance = 1067
spam score = 26
title = ''

distance = 1113
spam score = 22
title = ''

distance = 1141
spam score = 14
title = ''

distance = 244
spam score = 68
title = 'college lifestyles presents the 14day valentine8217s challenge college lifestyles'

distance = 259
spam score = 68
title = 'four ways to say 8220thank you8221 to your bod college lifestyles'

distance = 264
spam score = 72
title = 'must reads college lifestyles'

distance = 266
spam score = 71
title = 'looks for spring break 8211 beach college lifestyles'

distance = 270
spam score = 74
title = 'were you single on valentine8217s day learn to love yourself amp music college lifestyles'

distance = 270
spam score = 74
title = 'were you single on valentine8217s day learn to love yourself amp music college lifestyles'

distance = 279
spam score = 34
title = 'day 14 how did you meet your significant other college lifestyles'

distance = 279
spam score = 35
title = 'day 14 how did you meet your significant other college lifestyles'

distance = 281
spam score = 74
title = 'looks for spring break 8211 plane travel college lifestyles'

distance = 282
spam score = 70
title = 'job challenge day 11 what isare questions you were asked in a job interview college lifestyles'

distance = 286
spam score = 27
title = 'day 10 your best date ever college lifestyles'

distance = 291
spam score = 69
title = 'job challenge day 9 what was your favorite internship and why college lifestyles'

distance = 291
spam score = 68
title = 'job challenge day 9 what was your favorite internship and why college lifestyles'

distance = 299
spam score = 71
title = 'job challenge day 10 what is your dream job college lifestyles'

distance = 299
spam score = 71
title = 'job challenge day 10 what is your dream job college lifestyles'

distance = 305
spam score = 71
title = 'looks for spring break 8211 beach college lifestyles'

distance = 307
spam score = 70
title = 'represent your sorority during summer the cl way college lifestyles'

distance = 307
spam score = 70
title = '3 simple ways to beat acne college lifestyles'

distance = 308
spam score = 69
title = '4 ways to impress your boss college lifestyles'

distance = 308
spam score = 69
title = '4 ways to impress your boss college lifestyles'

distance = 365
spam score = 68
title = '4 tips for moving back in with your parents college lifestyles'

distance = 365
spam score = 66
title = 'the editors closet come on in college lifestyles'

distance = 365
spam score = 66
title = 'the editors closet come on in college lifestyles'

distance = 368
spam score = 70
title = 'cl8217s returning senior philanthropy writer stephanie college lifestyles'

distance = 368
spam score = 71
title = 'six tips for a balanced lifestyle college lifestyles'

distance = 369
spam score = 70
title = 'what8217s fresh for spring college lifestyles'

distance = 369
spam score = 70
title = 'what8217s fresh for spring college lifestyles'

distance = 371
spam score = 70
title = 'apartment living pros and cons college lifestyles'

distance = 371
spam score = 70
title = 'apartment living pros and cons college lifestyles'

distance = 372
spam score = 64
title = '5 reasons you shouldn8217t date a coworker college lifestyles'

distance = 387
spam score = 66
title = 'cl8217s spring clothing online shopping suggestions college lifestyles'

distance = 387
spam score = 66
title = 'cl8217s spring clothing online shopping suggestions college lifestyles'

distance = 390
spam score = 21
title = 'vday dcor 101 college lifestyles'

distance = 390
spam score = 21
title = 'vday dcor 101 college lifestyles'

distance = 393
spam score = 76
title = 'job challenge day 1 why do you want to be a insert career choice college lifestyles'

distance = 393
spam score = 70
title = 'top 5 spring tips from glamorales college lifestyles'

distance = 393
spam score = 69
title = 'top 5 spring tips from glamorales college lifestyles'

distance = 395
spam score = 63
title = 'classy coed on campus sonja college lifestyles'

distance = 395
spam score = 36
title = 'day 9 your embarrassing or awkward date moments college lifestyles'

distance = 400
spam score = 42
title = 'cl8217s entertainment round up college lifestyles'

distance = 423
spam score = 57
title = 'how to say no college lifestyles'

distance = 423
spam score = 57
title = 'how to say no college lifestyles'

distance = 424
spam score = 63
title = 'cake balls your next bake sale item college lifestyles'

distance = 425
spam score = 66
title = 'job challenge day 7 what should you wear to a job interview college lifestyles'

distance = 426
spam score = 60
title = 'best dressed on campus meet cmu student michele kissick college lifestyles'

distance = 426
spam score = 72
title = 'salsa the new exercise college lifestyles'

distance = 426
spam score = 61
title = 'best dressed on campus meet cmu student michele kissick college lifestyles'

distance = 427
spam score = 66
title = 'cl8217s favorite jewelry trends of 2012 college lifestyles'

distance = 427
spam score = 65
title = 'cl8217s favorite jewelry trends of 2012 college lifestyles'

distance = 427
spam score = 72
title = 'cls guide to making the most of your summer concert experience college lifestyles'

distance = 454
spam score = 69
title = 'looks for less lourdes leon college lifestyles'

distance = 454
spam score = 76
title = '5 reasons to take summer classes college lifestyles'

distance = 454
spam score = 76
title = '5 reasons to take summer classes college lifestyles'

distance = 460
spam score = 71
title = 'snack right while traveling college lifestyles'

distance = 460
spam score = 70
title = 'snack right while traveling college lifestyles'

distance = 461
spam score = 34
title = 'balancing greek life and college life college lifestyles'

distance = 461
spam score = 34
title = 'balancing greek life and college life college lifestyles'

distance = 463
spam score = 27
title = 'go green in style 5 products for your dormapartment college lifestyles'

distance = 464
spam score = 67
title = '5 ways with popcorn college lifestyles'

distance = 464
spam score = 67
title = '5 ways with popcorn college lifestyles'

distance = 492
spam score = 67
title = 'spring break musthaves sand staycation snow college lifestyles'

distance = 494
spam score = 32
title = 'how to own a job fair college lifestyles'

distance = 494
spam score = 34
title = 'mother knows best 10 tips of advice college lifestyles'

distance = 494
spam score = 35
title = 'mother knows best 10 tips of advice college lifestyles'

distance = 494
spam score = 31
title = 'how to own a job fair college lifestyles'

distance = 495
spam score = 64
title = 'cls top 10 biglittle initiation gifts college lifestyles'

distance = 497
spam score = 76
title = 'technology fashion we 8216model8217 with verizon wireless college lifestyles'

distance = 500
spam score = 32
title = '5 ways to dress up a drab winter wardrobe college lifestyles'

distance = 500
spam score = 73
title = 'style by the city valparaso chile college lifestyles'

distance = 501
spam score = 29
title = 'california christiania republic be free contest and giveaway college lifestyles'

distance = 526
spam score = 77
title = 'trail mix not just for the trails college lifestyles'

distance = 526
spam score = 78
title = 'trail mix not just for the trails college lifestyles'

distance = 530
spam score = 63
title = 'oscars the best and the worst college lifestyles'

distance = 533
spam score = 59
title = 'spring fashion trends 50 and under college lifestyles'

distance = 535
spam score = 74
title = 'fuel up and head outside college lifestyles'

distance = 535
spam score = 74
title = 'fuel up and head outside college lifestyles'

distance = 535
spam score = 58
title = '5 stylish ways to rock your shorts college lifestyles'

distance = 541
spam score = 70
title = 'verizon wireless online workshops what we loved learned and wanted more of college lifestyles'

distance = 542
spam score = 63
title = 'oscars the best and the worst college lifestyles'

distance = 545
spam score = 69
title = 'top 4 xy board accessories for students college lifestyles'

distance = 568
spam score = 71
title = 'intern kitchen 8211 mexican chocolate popcorn balls college lifestyles'

distance = 568
spam score = 71
title = 'intern kitchen 8211 mexican chocolate popcorn balls college lifestyles'

distance = 577
spam score = 68
title = 'one food many ways oatmeal college lifestyles'

distance = 577
spam score = 67
title = 'one food many ways oatmeal college lifestyles'

distance = 583
spam score = 61
title = 'pretty little liars recap a8217s little helper college lifestyles'

distance = 584
spam score = 67
title = 'want a japanese inspired look try tokidoki college lifestyles'

distance = 585
spam score = 69
title = 'sunnys sanctuary 3 ways to wear animal printed tights college lifestyles'

distance = 586
spam score = 63
title = '4 ways to look amazing for prom college lifestyles'

distance = 586
spam score = 64
title = '4 ways to look amazing for prom college lifestyles'

distance = 590
spam score = 21
title = 'guy v girl pretty college lifestyles'

distance = 618
spam score = 64
title = 'cl interview with jos alejandro flores college lifestyles'

distance = 624
spam score = 74
title = 'q amp a with robin plotkin college lifestyles'

distance = 624
spam score = 74
title = 'q amp a with robin plotkin college lifestyles'

distance = 640
spam score = 65
title = 'pamper your pet on love your pet day college lifestyles'

distance = 640
spam score = 33
title = 'vagina vagina the other side of vday college lifestyles'

distance = 640
spam score = 33
title = 'vagina vagina the other side of vday college lifestyles'

distance = 640
spam score = 57
title = 'jersey shore the shark fight college lifestyles'

distance = 640
spam score = 65
title = 'pamper your pet on love your pet day college lifestyles'

distance = 644
spam score = 68
title = 'intern kitchen 8211 baked ziti with meat sauce college lifestyles'

distance = 645
spam score = 63
title = 'intern kitchen 8211 irish soda bread college lifestyles'

distance = 764
spam score = 35
title = 'gg recap crazy cupid love8217s arrow missed fans8217 hearts college lifestyles'

distance = 773
spam score = 74
title = 'guide to eating healthier chips college lifestyles'

distance = 779
spam score = 68
title = 'slow down amp indulge into your senses 8211 aromatherapy college lifestyles'

distance = 899
spam score = 75
title = 'how to create the perfect manicure college lifestyles'

distance = 899
spam score = 75
title = 'how to create the perfect manicure college lifestyles'

distance = 116
spam score = 60
title = ''

distance = 130
spam score = 60
title = ''

distance = 139
spam score = 61
title = ''

distance = 141
spam score = 62
title = ''

distance = 144
spam score = 64
title = ''

distance = 146
spam score = 61
title = ''

distance = 149
spam score = 58
title = ''

distance = 152
spam score = 58
title = ''

distance = 158
spam score = 61
title = ''

distance = 159
spam score = 64
title = ''

distance = 165
spam score = 56
title = ''

distance = 165
spam score = 60
title = ''

distance = 170
spam score = 65
title = ''

distance = 172
spam score = 63
title = ''

distance = 173
spam score = 61
title = ''

distance = 174
spam score = 58
title = ''

distance = 175
spam score = 62
title = ''

distance = 180
spam score = 61
title = ''

distance = 181
spam score = 68
title = ''

distance = 181
spam score = 63
title = ''

distance = 189
spam score = 60
title = ''

distance = 189
spam score = 58
title = ''

distance = 191
spam score = 57
title = ''

distance = 192
spam score = 63
title = ''

distance = 198
spam score = 58
title = ''

distance = 204
spam score = 60
title = ''

distance = 217
spam score = 61
title = ''

distance = 219
spam score = 68
title = ''

distance = 219
spam score = 57
title = ''

distance = 220
spam score = 68
title = ''

distance = 220
spam score = 59
title = ''

distance = 223
spam score = 61
title = ''

distance = 245
spam score = 60
title = ''

distance = 247
spam score = 60
title = ''

distance = 252
spam score = 56
title = ''

distance = 254
spam score = 54
title = ''

distance = 272
spam score = 55
title = ''

distance = 303
spam score = 57
title = ''

distance = 356
spam score = 59
title = ''

distance = 398
spam score = 55
title = ''

distance = 423
spam score = 41
title = ''

distance = 430
spam score = 46
title = ''

distance = 456
spam score = 45
title = ''

distance = 469
spam score = 62
title = ''

distance = 472
spam score = 45
title = ''

distance = 476
spam score = 49
title = ''

distance = 495
spam score = 66
title = ''

distance = 541
spam score = 64
title = ''

distance = 558
spam score = 64
title = ''

distance = 567
spam score = 60
title = ''

distance = 568
spam score = 63
title = ''

distance = 569
spam score = 62
title = ''

distance = 592
spam score = 60
title = ''

distance = 630
spam score = 69
title = ''

distance = 644
spam score = 59
title = ''

distance = 707
spam score = 73
title = ''

distance = 783
spam score = 39
title = ''

distance = 940
spam score = 50
title = ''

distance = 1705
spam score = 79
title = ''

distance = 1865
spam score = 91
title = ''

distance = 0
spam score = 5
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 8
title = ''

distance = 796
spam score = 5
title = ''

distance = 1723
spam score = 40
title = ''

distance = 259
spam score = 14
title = 'jases books online store what where midi powered by cubecart'

distance = 259
spam score = 10
title = 'jases books online store botan micro powered by cubecart'

distance = 267
spam score = 9
title = 'jases books online store chishti maxi powered by cubecart'

distance = 268
spam score = 10
title = 'jases books online store mocha maxi powered by cubecart'

distance = 275
spam score = 13
title = 'jases books online store melancholy of summer micro powered by cubecart'

distance = 276
spam score = 13
title = 'jases books online store casablanca mini powered by cubecart'

distance = 278
spam score = 13
title = 'jases books online store poetical remains micro powered by cubecart'

distance = 282
spam score = 12
title = 'jases books online store honour amp reputation micro powered by cubecart'

distance = 290
spam score = 12
title = 'jases books online store yazd mini powered by cubecart'

distance = 290
spam score = 12
title = 'jases books online store digginamp39 it micro powered by cubecart'

distance = 292
spam score = 13
title = 'jases books online store what where micro powered by cubecart'

distance = 294
spam score = 12
title = 'jases books online store nanohana micro powered by cubecart'

distance = 295
spam score = 14
title = 'jases books online store asagao slim powered by cubecart'

distance = 299
spam score = 12
title = 'jases books online store the lovers mini powered by cubecart'

distance = 299
spam score = 12
title = 'jases books online store cocoa mini powered by cubecart'

distance = 304
spam score = 11
title = 'jases books online store travelling ganesh micro powered by cubecart'

distance = 307
spam score = 12
title = 'jases books online store karakusa slim powered by cubecart'

distance = 312
spam score = 12
title = 'jases books online store tiffany wisteria powered by cubecart'

distance = 313
spam score = 16
title = 'jases books online store safavid ultra powered by cubecart'

distance = 314
spam score = 12
title = 'jases books online store shida micro powered by cubecart'

distance = 362
spam score = 12
title = 'jases books online store summer amp sensibility midi powered by cubecart'

distance = 362
spam score = 15
title = 'jases books online store simplicity midi rare powered by cubecart'

distance = 363
spam score = 10
title = 'jases books online store william morris birds mini powered by cubecart'

distance = 363
spam score = 12
title = 'jases books online store damas marble mini powered by cubecart'

distance = 365
spam score = 14
title = 'jases books online store high button boot midi powered by cubecart'

distance = 365
spam score = 17
title = 'jases books online store peace midi oos powered by cubecart'

distance = 367
spam score = 14
title = 'jases books online store ispahan mini rare powered by cubecart'

distance = 367
spam score = 12
title = 'jases books online store squaring the circle squared circles rare powered by cubecart'

distance = 368
spam score = 10
title = 'jases books online store mohammed begarha maxi powered by cubecart'

distance = 368
spam score = 11
title = 'jases books online store chocolate maxi powered by cubecart'

distance = 392
spam score = 11
title = 'jases books online store sequined ruby slim powered by cubecart'

distance = 393
spam score = 12
title = 'jases books online store sequined topaz guest book powered by cubecart'

distance = 393
spam score = 14
title = 'jases books online store orphen powered by cubecart'

distance = 394
spam score = 10
title = 'jases books online store tiffany magnolia powered by cubecart'

distance = 394
spam score = 12
title = 'jases books online store painted walls dragon mini powered by cubecart'

distance = 394
spam score = 13
title = 'jases books online store squaring the circle pink moon rare powered by cubecart'

distance = 395
spam score = 13
title = 'jases books online store midnight gold midi powered by cubecart'

distance = 396
spam score = 12
title = 'jases books online store mystic calligraphy ha powered by cubecart'

distance = 396
spam score = 12
title = 'jases books online store french ornate bleu mini powered by cubecart'

distance = 397
spam score = 11
title = 'jases books online store mirror jewel slim powered by cubecart'

distance = 416
spam score = 11
title = 'jases books online store hotaru ultra powered by cubecart'

distance = 416
spam score = 11
title = 'jases books online store digginamp39 it midi powered by cubecart'

distance = 418
spam score = 13
title = 'jases books online store painted walls dragon midi powered by cubecart'

distance = 418
spam score = 13
title = 'jases books online store swirling peacock ebony slim powered by cubecart'

distance = 418
spam score = 12
title = 'jases books online store squaring the circle poked eggs rare powered by cubecart'

distance = 420
spam score = 16
title = 'jases books online store parisian mosaicmosac micro powered by cubecart'

distance = 421
spam score = 16
title = 'jases books online store parisian mosaicmosac mini powered by cubecart'

distance = 422
spam score = 14
title = 'jases books online store stravagante ultra powered by cubecart'

distance = 423
spam score = 13
title = 'jases books online store pastoral impulses micro powered by cubecart'

distance = 424
spam score = 14
title = 'jases books online store antique maps western hemisphere midi powered by cubecart'

distance = 453
spam score = 12
title = 'jases books online store silver filigree blush pink slim new powered by cubecart'

distance = 454
spam score = 13
title = 'jases books online store pastoral impulses midi powered by cubecart'

distance = 456
spam score = 14
title = 'jases books online store bleu slim open spine powered by cubecart'

distance = 456
spam score = 16
title = 'jases books online store gates of cairo baibars ultra powered by cubecart'

distance = 457
spam score = 18
title = 'jases books online store mucha snap dragon micro new powered by cubecart'

distance = 458
spam score = 11
title = 'jases books online store silver filigree blush pink ultra new powered by cubecart'

distance = 458
spam score = 17
title = 'jases books online store mucha amethyst slim new powered by cubecart'

distance = 459
spam score = 11
title = 'jases books online store william morris iris midi powered by cubecart'

distance = 459
spam score = 9
title = 'jases books online store swirling peacock ebony midi powered by cubecart'

distance = 459
spam score = 12
title = 'jases books online store ring cross powered by cubecart'

distance = 489
spam score = 8
title = 'jases books online store grolier midi powered by cubecart'

distance = 490
spam score = 13
title = 'jases books online store flor de pasion ebony midi powered by cubecart'

distance = 490
spam score = 10
title = 'jases books online store crox sinestre powered by cubecart'

distance = 490
spam score = 11
title = 'jases books online store squaring the circle shell shock rare powered by cubecart'

distance = 491
spam score = 15
title = 'jases books online store gothic web green powered by cubecart'

distance = 491
spam score = 12
title = 'jases books online store baroque ventaglio rosso grande new powered by cubecart'

distance = 491
spam score = 10
title = 'jases books online store french ornate bleu midi powered by cubecart'

distance = 491
spam score = 11
title = 'jases books online store fab footwear lola micro powered by cubecart'

distance = 492
spam score = 12
title = 'jases books online store lindau gospels mini powered by cubecart'

distance = 492
spam score = 14
title = 'jases books online store ougi handstitched ultra new powered by cubecart'

distance = 522
spam score = 14
title = 'jases books online store suede amethyst midi powered by cubecart'

distance = 523
spam score = 10
title = 'jases books online store celtic cross powered by cubecart'

distance = 523
spam score = 12
title = 'jases books online store eye vii sauron powered by cubecart'

distance = 524
spam score = 12
title = 'jases books online store ribbed lime ultra rare powered by cubecart'

distance = 526
spam score = 10
title = 'jases books online store filigree floral ivory guest book powered by cubecart'

distance = 526
spam score = 11
title = 'jases books online store filigree floral ebony grande powered by cubecart'

distance = 528
spam score = 14
title = 'jases books online store wordsworth letter quoting quotdaffodilsquot mini new powered by cubecart'

distance = 528
spam score = 12
title = 'jases books online store filigree floral ebony handstitched ultra new powered by cubecart'

distance = 530
spam score = 15
title = 'jases books online store claw xii silver powered by cubecart'

distance = 530
spam score = 12
title = 'jases books online store pagan xxx iolena iii powered by cubecart'

distance = 555
spam score = 13
title = 'jases books online store metal pagan vi sun powered by cubecart'

distance = 557
spam score = 10
title = 'jases books online store address book tsubaki micro powered by cubecart'

distance = 557
spam score = 11
title = 'jases books online store album butterfly powered by cubecart'

distance = 558
spam score = 12
title = 'jases books online store oscar wilde the importance of being earnest mini powered by cubecart'

distance = 559
spam score = 13
title = 'jases books online store ribbed olive ultra powered by cubecart'

distance = 560
spam score = 10
title = 'jases books online store fiendish posh sudoku powered by cubecart'

distance = 560
spam score = 15
title = 'jases books online store red words ladies purse powered by cubecart'

distance = 561
spam score = 13
title = 'jases books online store fab footwear sorceress midi powered by cubecart'

distance = 562
spam score = 12
title = 'jases books online store address book mediterranean cats midi powered by cubecart'

distance = 563
spam score = 13
title = 'jases books online store address book high button boot midi powered by cubecart'

distance = 622
spam score = 10
title = 'jases books online store address book thai gems mini powered by cubecart'

distance = 626
spam score = 14
title = 'jases books online store all purpose massage oil 500ml powered by cubecart'

distance = 633
spam score = 13
title = 'jases books online store gothic web purple powered by cubecart'

distance = 639
spam score = 12
title = 'jases books online store australian gumleaf 13cm teapot stand powered by cubecart'

distance = 645
spam score = 12
title = 'jases books online store australian gumleaf rectangle pot stand powered by cubecart'

distance = 646
spam score = 12
title = 'jases books online store address book filigree floral ebony midi powered by cubecart'

distance = 647
spam score = 11
title = 'jases books online store address book filigree floral ivory midi powered by cubecart'

distance = 649
spam score = 13
title = 'jases books online store bones of amzer powered by cubecart'

distance = 650
spam score = 12
title = 'jases books online store metal pagan vii pagan sun a5 powered by cubecart'

distance = 659
spam score = 11
title = 'jases books online store william morris bird ultra oos powered by cubecart'

distance = 838
spam score = 11
title = 'jases books online store moleskine pocket address book powered by cubecart'

distance = 877
spam score = 15
title = 'jases books online store french ornate vert midi powered by cubecart'

distance = 877
spam score = 14
title = 'jases books online store cats circle large journal powered by cubecart'

distance = 931
spam score = 11
title = 'jases books online store enchanted dreams cd by kokila powered by cubecart'

distance = 1000
spam score = 11
title = 'jases books online store spider cross halfbound powered by cubecart'

distance = 258
spam score = 9
title = ''

distance = 261
spam score = 8
title = ''

distance = 271
spam score = 27
title = ''

distance = 289
spam score = 8
title = ''

distance = 293
spam score = 12
title = ''

distance = 296
spam score = 10
title = ''

distance = 296
spam score = 6
title = ''

distance = 299
spam score = 12
title = ''

distance = 304
spam score = 17
title = ''

distance = 304
spam score = 17
title = ''

distance = 311
spam score = 11
title = ''

distance = 316
spam score = 16
title = ''

distance = 321
spam score = 13
title = ''

distance = 323
spam score = 8
title = ''

distance = 329
spam score = 12
title = ''

distance = 331
spam score = 10
title = ''

distance = 331
spam score = 24
title = ''

distance = 337
spam score = 11
title = ''

distance = 338
spam score = 16
title = ''

distance = 338
spam score = 9
title = ''

distance = 340
spam score = 14
title = ''

distance = 340
spam score = 11
title = ''

distance = 340
spam score = 19
title = ''

distance = 346
spam score = 11
title = ''

distance = 346
spam score = 24
title = ''

distance = 355
spam score = 10
title = ''

distance = 359
spam score = 23
title = ''

distance = 359
spam score = 9
title = ''

distance = 360
spam score = 26
title = ''

distance = 364
spam score = 10
title = ''

distance = 364
spam score = 20
title = ''

distance = 365
spam score = 12
title = ''

distance = 365
spam score = 23
title = ''

distance = 367
spam score = 21
title = ''

distance = 371
spam score = 21
title = ''

distance = 372
spam score = 13
title = ''

distance = 379
spam score = 17
title = ''

distance = 384
spam score = 11
title = ''

distance = 388
spam score = 33
title = ''

distance = 393
spam score = 19
title = ''

distance = 402
spam score = 14
title = ''

distance = 405
spam score = 9
title = ''

distance = 412
spam score = 14
title = ''

distance = 415
spam score = 9
title = ''

distance = 420
spam score = 8
title = ''

distance = 420
spam score = 8
title = ''

distance = 427
spam score = 10
title = ''

distance = 431
spam score = 12
title = ''

distance = 436
spam score = 10
title = ''

distance = 442
spam score = 18
title = ''

distance = 443
spam score = 12
title = ''

distance = 443
spam score = 6
title = ''

distance = 443
spam score = 9
title = ''

distance = 449
spam score = 7
title = ''

distance = 449
spam score = 9
title = ''

distance = 452
spam score = 9
title = ''

distance = 455
spam score = 8
title = ''

distance = 459
spam score = 8
title = ''

distance = 459
spam score = 7
title = ''

distance = 461
spam score = 9
title = ''

distance = 492
spam score = 10
title = ''

distance = 495
spam score = 8
title = ''

distance = 497
spam score = 8
title = ''

distance = 502
spam score = 10
title = ''

distance = 505
spam score = 9
title = ''

distance = 509
spam score = 11
title = ''

distance = 511
spam score = 12
title = ''

distance = 512
spam score = 4
title = ''

distance = 539
spam score = 12
title = ''

distance = 545
spam score = 5
title = ''

distance = 547
spam score = 10
title = ''

distance = 548
spam score = 9
title = ''

distance = 549
spam score = 8
title = ''

distance = 556
spam score = 6
title = ''

distance = 558
spam score = 11
title = ''

distance = 563
spam score = 9
title = ''

distance = 564
spam score = 8
title = ''

distance = 568
spam score = 12
title = ''

distance = 569
spam score = 15
title = ''

distance = 570
spam score = 6
title = ''

distance = 570
spam score = 6
title = ''

distance = 571
spam score = 14
title = ''

distance = 587
spam score = 10
title = ''

distance = 591
spam score = 13
title = ''

distance = 598
spam score = 9
title = ''

distance = 599
spam score = 17
title = ''

distance = 616
spam score = 5
title = ''

distance = 616
spam score = 3
title = ''

distance = 617
spam score = 10
title = ''

distance = 618
spam score = 12
title = ''

distance = 626
spam score = 35
title = ''

distance = 658
spam score = 15
title = ''

distance = 658
spam score = 12
title = ''

distance = 674
spam score = 10
title = ''

distance = 679
spam score = 14
title = ''

distance = 1896
spam score = 22
title = ''

distance = 262
spam score = 60
title = ''

distance = 265
spam score = 61
title = ''

distance = 274
spam score = 63
title = ''

distance = 279
spam score = 61
title = ''

distance = 301
spam score = 65
title = ''

distance = 310
spam score = 63
title = ''

distance = 313
spam score = 63
title = ''

distance = 317
spam score = 63
title = ''

distance = 319
spam score = 64
title = ''

distance = 323
spam score = 61
title = ''

distance = 328
spam score = 64
title = ''

distance = 330
spam score = 60
title = ''

distance = 331
spam score = 70
title = ''

distance = 332
spam score = 68
title = ''

distance = 333
spam score = 63
title = ''

distance = 333
spam score = 61
title = ''

distance = 335
spam score = 68
title = ''

distance = 336
spam score = 66
title = ''

distance = 345
spam score = 70
title = ''

distance = 348
spam score = 61
title = ''

distance = 353
spam score = 66
title = ''

distance = 392
spam score = 61
title = ''

distance = 392
spam score = 67
title = ''

distance = 397
spam score = 59
title = ''

distance = 398
spam score = 61
title = ''

distance = 409
spam score = 61
title = ''

distance = 411
spam score = 60
title = ''

distance = 414
spam score = 59
title = ''

distance = 416
spam score = 66
title = ''

distance = 428
spam score = 61
title = ''

distance = 456
spam score = 63
title = ''

distance = 460
spam score = 63
title = ''

distance = 464
spam score = 59
title = ''

distance = 472
spam score = 57
title = ''

distance = 484
spam score = 68
title = ''

distance = 488
spam score = 66
title = ''

distance = 511
spam score = 73
title = ''

distance = 512
spam score = 61
title = ''

distance = 544
spam score = 61
title = ''

distance = 546
spam score = 65
title = ''

distance = 551
spam score = 49
title = ''

distance = 562
spam score = 72
title = ''

distance = 571
spam score = 58
title = ''

distance = 605
spam score = 63
title = ''

distance = 648
spam score = 62
title = ''

distance = 666
spam score = 51
title = ''

distance = 720
spam score = 62
title = ''

distance = 723
spam score = 57
title = ''

distance = 739
spam score = 56
title = ''

distance = 748
spam score = 59
title = ''

distance = 757
spam score = 59
title = ''

distance = 766
spam score = 61
title = ''

distance = 774
spam score = 68
title = ''

distance = 808
spam score = 58
title = ''

distance = 808
spam score = 61
title = ''

distance = 216
spam score = 5
title = 'university of texas ranked no 1 hook up school by college magazine'

distance = 231
spam score = 11
title = 'dallas news anchor paige mccoy smith freaks out on camera'

distance = 239
spam score = 2
title = 'machete red carpet deets'

distance = 240
spam score = 12
title = 'machete premieres at the paramount theater'

distance = 247
spam score = 27
title = 'boondocks saints cast to make announcement at sxsw 2012'

distance = 247
spam score = 9
title = 'schedule is out for austin f1 race weekend'

distance = 250
spam score = 7
title = 'south texas fire department goes up in flames'

distance = 252
spam score = 6
title = 'brad womack deserved the slap'

distance = 257
spam score = 4
title = 'matthew mcconaughey soaking in the sun city'

distance = 257
spam score = 6
title = 'bachelor brad makes the soup'

distance = 258
spam score = 7
title = 'explosion at central austin home several injured'

distance = 261
spam score = 8
title = 'warm springlike weather return to central texas'

distance = 261
spam score = 2
title = 'bernie opens la film festival'

distance = 261
spam score = 5
title = 'austin car thieves stealing pickups at a record pace'

distance = 262
spam score = 23
title = 'about the digital texan'

distance = 263
spam score = 7
title = 'car explodes in downtown austin parking garage'

distance = 265
spam score = 16
title = 'matthew mcconaughey finally pops the question'

distance = 266
spam score = 4
title = 'true grit shooting locations'

distance = 268
spam score = 5
title = 'google map of the top 20 speed traps in austin'

distance = 269
spam score = 5
title = 'brad womack and emily maynard so happy together'

distance = 313
spam score = 23
title = 'sxsw 2012 panels and films feature famous celebrities'

distance = 317
spam score = 12
title = 'austin039s trail of lights to make a comeback in 2012'

distance = 318
spam score = 3
title = 'bastrop wildfire each house has a story'

distance = 319
spam score = 11
title = 'ut grads head to the academy awards with diamonds'

distance = 323
spam score = 7
title = 'austin house explosion and fire caused by gas leak'

distance = 327
spam score = 6
title = 'texas drought expands no relief in sight'

distance = 328
spam score = 9
title = 'jay z presents first ever solo show at sxsw 2012'

distance = 328
spam score = 20
title = 'fred cantu scores new contract with keye quits home depot job'

distance = 332
spam score = 6
title = 'homeowner christopher thomas arrested for shooting neighbor039s dog'

distance = 335
spam score = 8
title = 'jack black and matthew mcconaughey support bastrop wildfire victims'

distance = 358
spam score = 7
title = 'gunman shot by police at occupy houston protest'

distance = 358
spam score = 46
title = 'thousands turn out for zilker park kite festival'

distance = 358
spam score = 8
title = 'getwell vigil planned for austin039s favorite vagrant leslie cochran'

distance = 362
spam score = 3
title = 'texas river otters making a come back'

distance = 363
spam score = 17
title = 'sxsw 2010 perez hilton party'

distance = 364
spam score = 16
title = 'kxan anchor catenya mchenry fired'

distance = 366
spam score = 4
title = 'feds going after bass pro shop for discrimination'

distance = 369
spam score = 6
title = 'heavy storm damage at bastrop state park'

distance = 370
spam score = 17
title = 'fox 7039s foti kallergis leaving tv news for cooking school'

distance = 376
spam score = 6
title = 'occupy austin lives group now protesting pressure washing'

distance = 400
spam score = 8
title = 'stratfor back online after devastating hack attack'

distance = 403
spam score = 14
title = 'picture yourself in a scene from dr suess039 the lorax'

distance = 405
spam score = 12
title = 'lcra no more water for texas rice farmers'

distance = 406
spam score = 15
title = '55yearold texas grandmother wants to be a dallas cowboys cheerleader'

distance = 406
spam score = 17
title = 'houston anchor legend dave ward returns to ktrk tv in cowboy hat'

distance = 413
spam score = 23
title = 'the 2012 offcentered film fest is coming up in april'

distance = 416
spam score = 48
title = 'texas bluebonnets arrive early in austin'

distance = 421
spam score = 34
title = 'did dallas meat packing company dump pig blood into trinity river'

distance = 426
spam score = 10
title = 'bastrop offering free trees in effort to recover from wildfires'

distance = 426
spam score = 24
title = 'famous faces to attend the texas film hall of fame awards'

distance = 448
spam score = 16
title = 'khloe and lamar dallas edition premieres on e'

distance = 448
spam score = 10
title = 'hacktivists rickroll stratfor clients'

distance = 450
spam score = 5
title = 'buda family finds huge texas giant centipede near their garage'

distance = 454
spam score = 5
title = 'houston school administrators indicted for doctoring dropout rates'

distance = 455
spam score = 3
title = 'city allows occupy austin to trash city hall plaza'

distance = 457
spam score = 7
title = 'bernie ecclestone talks down f1 popularity in us'

distance = 457
spam score = 11
title = 'kxan039s chris willis off the anchor desk after 12 years'

distance = 459
spam score = 2
title = 'video 18wheeler flips over on north dallas tollway'

distance = 462
spam score = 52
title = 'austin039s el greco segment to air on fox039s kitchen nightmares jan 20'

distance = 463
spam score = 8
title = 'anonymous threatening new year039s eve hack attack'

distance = 493
spam score = 16
title = 'khloe kardashian and lamar odom do dallas'

distance = 497
spam score = 34
title = 'austin police and fbi bust central texas cocaine ring'

distance = 498
spam score = 5
title = 'leander woman calls 911 after boyfriend snorts bath salt to get high'

distance = 504
spam score = 11
title = 'supreme court to hear case on admissions discrimination at ut'

distance = 506
spam score = 1
title = 'city occupy austin protest to cost taxpayers city occupy austin protest to cost taxpayers 12 million2 million'

distance = 507
spam score = 3
title = 'galveston hurricane kills 12000 and destroys city'

distance = 507
spam score = 2
title = 'austin police officers fired in slapping incident'

distance = 509
spam score = 6
title = 'wikileaks and anonymous partner and release 5 million stratfor emails'

distance = 509
spam score = 14
title = 'texas doctors indicted in massive medicare and medicaid fraud'

distance = 511
spam score = 5
title = 'university of texas students want to ban antibacterial soap on campus'

distance = 554
spam score = 19
title = 'would you pay 000 for a case of dublin dr pepper'

distance = 554
spam score = 13
title = 'the reckless kelly 4th annual celebrity softball jam preview'

distance = 557
spam score = 6
title = 'alamo drafthouse to open cocktail lounge in old austin brothel'

distance = 557
spam score = 10
title = 'thieves and vandals steal the daily texan newspapers from ut campus'

distance = 559
spam score = 18
title = 'the chuggin monkey celebrates 10years rocking austin039s 6th street'

distance = 561
spam score = 3
title = 'nba superstar lamar odom to play against the austin toros'

distance = 562
spam score = 13
title = 'heavy rain storms to move through southcentral texas'

distance = 564
spam score = 50
title = 'thousands pay tribute to austin police officer jaime padron'

distance = 573
spam score = 5
title = 'swanky dallas steakhouse is all about khloe and lamar'

distance = 581
spam score = 16
title = 'perry paul struggle for relevance in new hampshire debate'

distance = 620
spam score = 3
title = 'talker michael berry writes check to victim in gay bar hitandrun'

distance = 621
spam score = 6
title = 'lcra may cut off water to texas farmers'

distance = 626
spam score = 1
title = 'ashton kutcher039s texas mistress sara leal not pregnant'

distance = 635
spam score = 15
title = 'did the daily texan pull a trayvon martin cartoon off their website'

distance = 639
spam score = 16
title = 'khloe kardashian lands dallas radio gig on mix 1029 kdmx'

distance = 641
spam score = 37
title = 'el greco segment airs tonight on gordon ramsay039s kitchen nighmares'

distance = 641
spam score = 18
title = 'austin police arrest 38 occupy austin protesters'

distance = 645
spam score = 13
title = 'texas rice farmers unlikely to get any water to grow this year039s crop'

distance = 647
spam score = 10
title = 'austin city council passes disposable plastic bag ban'

distance = 657
spam score = 15
title = 'talker michael berry gay bar hitandrun investigation relaunched'

distance = 694
spam score = 39
title = 'fox 7s chief meteorologist scott fisher lives for baseball'

distance = 696
spam score = 10
title = 'is it time for rick perry to call it quits and come back to austin'

distance = 701
spam score = 19
title = 'jack ingram and hayes carll rock austin grounded in music event'

distance = 702
spam score = 18
title = 'texas drought a real threat to the alligator gar'

distance = 704
spam score = 21
title = '21 jump street premiere at the paramount'

distance = 710
spam score = 26
title = 'houston pd pressured in radio host michael berry gay bar hitandrun'

distance = 714
spam score = 52
title = 'alamo drafthouse039s 400 rabbits cocktail lounge invades slaughter lane'

distance = 717
spam score = 53
title = 'growing up in tornado alley led kxans jim spencer weather forecasting'

distance = 721
spam score = 35
title = 'kitchen nightmares exploits problems at austin039s el greco'

distance = 722
spam score = 23
title = 'the texas drought is getting to the bugs'

distance = 887
spam score = 32
title = 'war veteran antonio buehler continues fight with austin police'

distance = 923
spam score = 8
title = 'the occupy wall street criminal rap sheet'

distance = 983
spam score = 54
title = 'rick perry has big donors in financial sector'

distance = 104
spam score = 96
title = ''

distance = 135
spam score = 96
title = ''

distance = 188
spam score = 97
title = ''

distance = 190
spam score = 93
title = ''

distance = 240
spam score = 96
title = ''

distance = 265
spam score = 93
title = ''

distance = 270
spam score = 94
title = ''

distance = 297
spam score = 93
title = ''

distance = 328
spam score = 95
title = ''

distance = 329
spam score = 95
title = ''

distance = 336
spam score = 97
title = ''

distance = 337
spam score = 94
title = ''

distance = 349
spam score = 96
title = ''

distance = 355
spam score = 97
title = ''

distance = 360
spam score = 94
title = ''

distance = 361
spam score = 94
title = ''

distance = 365
spam score = 94
title = ''

distance = 386
spam score = 98
title = ''

distance = 387
spam score = 96
title = ''

distance = 387
spam score = 96
title = ''

distance = 388
spam score = 94
title = ''

distance = 394
spam score = 96
title = ''

distance = 395
spam score = 96
title = ''

distance = 399
spam score = 97
title = ''

distance = 401
spam score = 95
title = ''

distance = 405
spam score = 95
title = ''

distance = 424
spam score = 95
title = ''

distance = 428
spam score = 98
title = ''

distance = 434
spam score = 94
title = ''

distance = 437
spam score = 94
title = ''

distance = 454
spam score = 94
title = ''

distance = 479
spam score = 96
title = ''

distance = 489
spam score = 87
title = ''

distance = 504
spam score = 98
title = ''

distance = 530
spam score = 94
title = ''

distance = 535
spam score = 91
title = ''

distance = 571
spam score = 96
title = ''

distance = 580
spam score = 97
title = ''

distance = 582
spam score = 95
title = ''

distance = 616
spam score = 94
title = ''

distance = 657
spam score = 92
title = ''

distance = 780
spam score = 96
title = ''

distance = 1025
spam score = 93
title = ''

distance = 1567
spam score = 78
title = ''

distance = 150
spam score = 78
title = 'colorectal cancer advocacy fight colorectal cancer'

distance = 163
spam score = 89
title = 'colorectal cancer trends fight colorectal cancer'

distance = 167
spam score = 69
title = 'colorectal cancer incidence fight colorectal cancer'

distance = 171
spam score = 83
title = 'pain fight colorectal cancer'

distance = 172
spam score = 79
title = 'kraserbitux fight colorectal cancer'

distance = 183
spam score = 72
title = 'disparities fight colorectal cancer part 6'

distance = 197
spam score = 90
title = 'fentanyl fight colorectal cancer'

distance = 198
spam score = 91
title = 'military dogs fight colorectal cancer'

distance = 200
spam score = 54
title = 'disparities fight colorectal cancer part 3'

distance = 205
spam score = 86
title = 'survivorship fight colorectal cancer'

distance = 205
spam score = 73
title = 'asco 2009 fight colorectal cancer part 2'

distance = 211
spam score = 83
title = 'cancer survivor fight colorectal cancer'

distance = 212
spam score = 68
title = 'vitamin d fight colorectal cancer'

distance = 216
spam score = 93
title = 'radiationinduced cancers fight colorectal cancer'

distance = 217
spam score = 85
title = 'research studies fight colorectal cancer'

distance = 219
spam score = 91
title = 'egfr fight colorectal cancer'

distance = 220
spam score = 89
title = 'financial assistance fight colorectal cancer'

distance = 220
spam score = 93
title = 'chalk river fight colorectal cancer'

distance = 221
spam score = 94
title = 'blood glucose fight colorectal cancer'

distance = 221
spam score = 81
title = 'wellness tips fight colorectal cancer'

distance = 320
spam score = 95
title = 'estrogen replacement therapy fight colorectal cancer'

distance = 320
spam score = 95
title = 'proximal adenomas fight colorectal cancer'

distance = 320
spam score = 91
title = 'radiotherapy fight colorectal cancer'

distance = 321
spam score = 84
title = 'acupuncture fight colorectal cancer'

distance = 321
spam score = 91
title = 'recurrence fight colorectal cancer'

distance = 322
spam score = 80
title = 'pcori fight colorectal cancer'

distance = 322
spam score = 92
title = 'ostomy fight colorectal cancer'

distance = 322
spam score = 94
title = 'tennessee fight colorectal cancer'

distance = 323
spam score = 78
title = 'liver metastases fight colorectal cancer part 3'

distance = 324
spam score = 94
title = '5fu shortage fight colorectal cancer'

distance = 354
spam score = 95
title = 'fmla fight colorectal cancer'

distance = 354
spam score = 96
title = 'statins fight colorectal cancer'

distance = 356
spam score = 94
title = 'cabig fight colorectal cancer'

distance = 356
spam score = 94
title = 'tips amp tricks fight colorectal cancer'

distance = 357
spam score = 93
title = 'christine niemi fight colorectal cancer'

distance = 359
spam score = 93
title = 'lapatinib fight colorectal cancer'

distance = 360
spam score = 95
title = 'entertainment industry foundation fight colorectal cancer'

distance = 361
spam score = 93
title = 'rebates fight colorectal cancer'

distance = 362
spam score = 94
title = 'cancer care fight colorectal cancer'

distance = 362
spam score = 78
title = 'treating colorectal cancer fight colorectal cancer part 8'

distance = 396
spam score = 97
title = 'board of directors fight colorectal cancer'

distance = 396
spam score = 90
title = 'colectomy fight colorectal cancer'

distance = 397
spam score = 87
title = 'stage iii fight colorectal cancer'

distance = 397
spam score = 59
title = 'from the desk of dr lenz fight colorectal cancer part 16'

distance = 398
spam score = 74
title = 'disparities fight colorectal cancer part 4'

distance = 399
spam score = 91
title = 'subtotal colectomy fight colorectal cancer'

distance = 399
spam score = 95
title = 'compassion fatigue fight colorectal cancer'

distance = 399
spam score = 91
title = 'speaker pelosi fight colorectal cancer'

distance = 399
spam score = 78
title = 'cancer support fight colorectal cancer'

distance = 400
spam score = 87
title = 'colorectal cancer awareness fight colorectal cancer part 6'

distance = 438
spam score = 81
title = 'managing symptoms and side effects fight colorectal cancer'

distance = 438
spam score = 94
title = 'stool dna test fight colorectal cancer'

distance = 438
spam score = 80
title = 'uninsured fight colorectal cancer'

distance = 438
spam score = 75
title = 'braf mutations fight colorectal cancer'

distance = 439
spam score = 91
title = 'colorectal cancer awareness fight colorectal cancer part 4'

distance = 439
spam score = 77
title = 'colorectal cancer awareness fight colorectal cancer part 5'

distance = 440
spam score = 70
title = 'understanding genetics fight colorectal cancer'

distance = 442
spam score = 88
title = 'department of defense fight colorectal cancer'

distance = 443
spam score = 66
title = 'lynch syndrome fight colorectal cancer part 5'

distance = 443
spam score = 81
title = 'microsatellite instability fight colorectal cancer'

distance = 477
spam score = 78
title = 'nausea fight colorectal cancer part 2'

distance = 479
spam score = 87
title = 'nausea fight colorectal cancer'

distance = 479
spam score = 81
title = 'cetuximab fight colorectal cancer'

distance = 480
spam score = 83
title = 'congress fight colorectal cancer part 2'

distance = 480
spam score = 78
title = 'endometrial cancer fight colorectal cancer'

distance = 481
spam score = 93
title = 'avant fight colorectal cancer'

distance = 481
spam score = 68
title = 'survival benefit fight colorectal cancer'

distance = 482
spam score = 81
title = 'medicare fight colorectal cancer part 4'

distance = 482
spam score = 77
title = 'health care costs fight colorectal cancer'

distance = 483
spam score = 79
title = 'colorectal cancer screening fight colorectal cancer part 5'

distance = 532
spam score = 86
title = 'house of representatives fight colorectal cancer'

distance = 532
spam score = 84
title = 'palliative care fight colorectal cancer'

distance = 534
spam score = 76
title = 'president barack obama fight colorectal cancer'

distance = 535
spam score = 85
title = 'obesity fight colorectal cancer'

distance = 535
spam score = 82
title = 'fatigue fight colorectal cancer'

distance = 535
spam score = 86
title = 'colon cancer alliance fight colorectal cancer'

distance = 536
spam score = 86
title = 'colorectal cancer awareness fight colorectal cancer part 3'

distance = 536
spam score = 96
title = 'placebo effect fight colorectal cancer'

distance = 537
spam score = 79
title = 'egfr inhibitors fight colorectal cancer'

distance = 537
spam score = 79
title = 'neuropathy fight colorectal cancer'

distance = 602
spam score = 81
title = 'digestive disease week fight colorectal cancer'

distance = 605
spam score = 84
title = 'mucositis fight colorectal cancer'

distance = 605
spam score = 84
title = 'stage ii fight colorectal cancer'

distance = 607
spam score = 57
title = 'medicare fight colorectal cancer part 3'

distance = 608
spam score = 67
title = 'msi fight colorectal cancer part 2'

distance = 608
spam score = 91
title = 'cancer research fight colorectal cancer'

distance = 609
spam score = 84
title = 'leucovorin shortage fight colorectal cancer part 2'

distance = 609
spam score = 73
title = 'from the desk of dr lenz fight colorectal cancer part 7'

distance = 613
spam score = 89
title = 'research amp treatment news fight colorectal cancer part 2'

distance = 613
spam score = 88
title = 'research amp treatment news fight colorectal cancer part 2'

distance = 691
spam score = 86
title = 'colon cancer patient education fight colorectal cancer part 30'

distance = 694
spam score = 95
title = 'leucovorin shortage fight colorectal cancer part 3'

distance = 695
spam score = 87
title = 'nih fight colorectal cancer'

distance = 695
spam score = 75
title = 'colon cancer patient education fight colorectal cancer part 48'

distance = 697
spam score = 90
title = 'kay granger fight colorectal cancer'

distance = 698
spam score = 80
title = 'hedgehog fight colorectal cancer'

distance = 699
spam score = 81
title = 'colon cancer patient education fight colorectal cancer part 17'

distance = 700
spam score = 87
title = 'colon cancer patient education fight colorectal cancer part 26'

distance = 700
spam score = 84
title = 'colon cancer patient education fight colorectal cancer part 20'

distance = 701
spam score = 78
title = 'bevacizumab fight colorectal cancer part 2'

distance = 1001
spam score = 87
title = 'staging fight colorectal cancer'

distance = 1006
spam score = 98
title = 'drug shortage fight colorectal cancer'

distance = 1039
spam score = 73
title = 'fight colorectal cancer in the media fight colorectal cancer'

distance = 1063
spam score = 96
title = 'leucovorin fight colorectal cancer'

distance = 1374
spam score = 75
title = 'more niagara residents need to be screened for colorectal cancer niagara health system'

distance = 1616
spam score = 69
title = 'international cooperation raquo sage bionetworks podcasts'

distance = 178
spam score = 47
title = 'china hosting blog raquo blog archive raquo billing system maintenance'

distance = 215
spam score = 57
title = 'china hosting blog raquo blog archive raquo chinese new year holidays'

distance = 229
spam score = 63
title = 'china hosting blog raquo blog archive raquo us shared hosting ip changes'

distance = 239
spam score = 54
title = 'china hosting blog raquo blog archive raquo holiday greetings'

distance = 239
spam score = 40
title = 'china hosting blog raquo blog archive raquo hong kong server outage'

distance = 244
spam score = 61
title = 'china hosting blog raquo blog archive raquo sinohosting moving to new offices at the end of august'

distance = 245
spam score = 50
title = 'china hosting blog raquo blog archive raquo china shuts down 10000 unregistered websites'

distance = 245
spam score = 57
title = 'china hosting blog raquo blog archive raquo hong kong server coming soon'

distance = 246
spam score = 50
title = 'china hosting blog raquo blog archive raquo october 1st holiday notice'

distance = 247
spam score = 50
title = 'china hosting blog raquo blog archive raquo china national day holidays'

distance = 255
spam score = 53
title = 'china hosting blog raquo blog archive raquo usa dedicated servers for chinese companies'

distance = 257
spam score = 53
title = 'china hosting blog raquo blog archive raquo sinohostingnet now accepting moneybookers'

distance = 259
spam score = 60
title = 'china hosting blog raquo blog archive raquo icp license application procedure'

distance = 259
spam score = 46
title = 'china hosting blog raquo blog archive raquo ip address change notification for some chinahosted accounts'

distance = 260
spam score = 58
title = 'china hosting blog raquo blog archive raquo sinohosting is now on facebook'

distance = 262
spam score = 68
title = 'china hosting blog raquo blog archive raquo new job openings at sinohosting'

distance = 263
spam score = 48
title = 'china hosting blog raquo blog archive raquo new server for shared hosting in shanghai china netcom'

distance = 263
spam score = 55
title = 'china hosting blog raquo blog archive raquo eu domain names now available'

distance = 269
spam score = 54
title = 'china hosting blog raquo blog archive raquo china dedicated servers and vps available soon'

distance = 271
spam score = 52
title = 'china hosting blog raquo blog archive raquo alipay now accepted at sinohosting'

distance = 291
spam score = 55
title = 'china hosting blog raquo blog archive raquo change of ip address for the china linux server'

distance = 296
spam score = 46
title = 'china hosting blog raquo blog archive raquo hong kong dedicated servers coming soon'

distance = 297
spam score = 56
title = 'china hosting blog raquo blog archive raquo two new hong kong servers available for shared hosting clients'

distance = 299
spam score = 56
title = 'china hosting blog raquo blog archive raquo shanghai server downtime notice'

distance = 301
spam score = 57
title = 'china hosting blog raquo blog archive raquo issues with one of the chinese servers'

distance = 305
spam score = 39
title = 'china hosting blog raquo blog archive raquo hong kong windows shared hosting server issues'

distance = 316
spam score = 58
title = 'china hosting blog raquo blog archive raquo ddos attack on tigersinohostingnet'

distance = 319
spam score = 52
title = 'china hosting blog raquo blog archive raquo suspension of dot cn registrations'

distance = 319
spam score = 64
title = 'china hosting blog raquo blog archive raquo upgrade to our billing system'

distance = 322
spam score = 52
title = 'china hosting blog raquo blog archive raquo billing system issue'

distance = 331
spam score = 56
title = 'china hosting blog raquo blog archive raquo linux for china hosting'

distance = 332
spam score = 48
title = 'china hosting blog raquo blog archive raquo jiangsu telecom datacenter upgrades'

distance = 336
spam score = 68
title = 'china hosting blog raquo blog archive raquo china hosting blog launched'

distance = 339
spam score = 69
title = 'china hosting blog raquo blog archive raquo it support in shanghai'

distance = 342
spam score = 66
title = 'china hosting blog raquo blog archive raquo easter promotion 8211 10 off on new orders and renewals'

distance = 342
spam score = 54
title = 'china hosting blog raquo blog archive raquo server taipo issues'

distance = 345
spam score = 59
title = 'china hosting blog raquo blog archive raquo new ip address for tigersinohostingnet'

distance = 347
spam score = 54
title = 'china hosting blog raquo blog archive raquo sinohostingnet now on twitter'

distance = 363
spam score = 47
title = 'china hosting blog raquo blog archive raquo billing system server migration'

distance = 364
spam score = 50
title = 'china hosting blog raquo blog archive raquo sinohosting affiliate program launch'

distance = 373
spam score = 46
title = 'china hosting blog raquo blog archive raquo change of ip address 8211 china linux server'

distance = 376
spam score = 58
title = 'china hosting blog raquo blog archive raquo disk failure at hkwin server'

distance = 376
spam score = 45
title = 'china hosting blog raquo blog archive raquo hardware failure on 2105222392'

distance = 381
spam score = 56
title = 'china hosting blog raquo blog archive raquo sinohosting at the 3rd expat expo in beijing'

distance = 382
spam score = 39
title = 'china hosting blog raquo blog archive raquo sinohostingnet now listed at web hosting search'

distance = 384
spam score = 40
title = 'china hosting blog raquo blog archive raquo updates on chinese domain names registration'

distance = 392
spam score = 53
title = 'china hosting blog raquo blog archive raquo domain name servers outages'

distance = 393
spam score = 51
title = 'china hosting blog raquo blog archive raquo issue with 61147124150'

distance = 393
spam score = 57
title = 'china hosting blog raquo blog archive raquo change of ip address 8211 hong kong vps node'

distance = 394
spam score = 53
title = 'china hosting blog raquo blog archive raquo shared hosting accounts on china servers without icp licenses to be shut down soon'

distance = 395
spam score = 61
title = 'china hosting blog raquo blog archive raquo dot cn price increase'

distance = 403
spam score = 59
title = 'china hosting blog raquo blog archive raquo vps servers to be moved to guangdong datacenter'

distance = 406
spam score = 52
title = 'china hosting blog raquo blog archive raquo dot cn domain registration now possible without an icp license'

distance = 411
spam score = 56
title = 'china hosting blog raquo blog archive raquo china ftp hosting service launch'

distance = 411
spam score = 44
title = 'china hosting blog raquo blog archive raquo emergency network upgrade on server tiger'

distance = 416
spam score = 47
title = 'china hosting blog raquo blog archive raquo godaddy blocked in china'

distance = 418
spam score = 53
title = 'china hosting blog raquo blog archive raquo china vps plans debut'

distance = 420
spam score = 48
title = 'china hosting blog raquo blog archive raquo changes in international web hosting and email hosting packages'

distance = 421
spam score = 58
title = 'china hosting blog raquo blog archive raquo email hosting small business plan now offers 20 accounts'

distance = 429
spam score = 52
title = 'china hosting blog raquo blog archive raquo why hosting in singapore makes sense for chinabased companies'

distance = 441
spam score = 51
title = 'china hosting blog raquo blog archive raquo new limits on domain refund by the icann'

distance = 443
spam score = 64
title = 'china hosting blog raquo blog archive raquo domain name pricing update'

distance = 445
spam score = 51
title = 'china hosting blog raquo blog archive raquo chinese cn domain names now over 10 millions'

distance = 445
spam score = 73
title = 'china hosting blog raquo blog archive raquo china email marketing services'

distance = 454
spam score = 39
title = 'china hosting blog raquo blog archive raquo sinovpn a vpn provider for businesses and expatriates in china'

distance = 455
spam score = 48
title = 'china hosting blog raquo blog archive raquo updates to our hong kong dedicated servers plans'

distance = 457
spam score = 58
title = 'china hosting blog raquo blog archive raquo new service fee for icp registration'

distance = 461
spam score = 48
title = 'china hosting blog raquo blog archive raquo launch of our hong kong web hosting services'

distance = 462
spam score = 42
title = 'china hosting blog raquo blog archive raquo singapore server downtime notice'

distance = 463
spam score = 58
title = 'china hosting blog raquo blog archive raquo china dedicated servers plans upgrade'

distance = 474
spam score = 55
title = 'china hosting blog raquo blog archive raquo direct credit card payment now available'

distance = 474
spam score = 39
title = 'china hosting blog raquo blog archive raquo asia and hk promotion in october'

distance = 477
spam score = 54
title = 'china hosting blog raquo blog archive raquo emergency ip address change at server mongkok'

distance = 481
spam score = 53
title = 'china hosting blog raquo blog archive raquo plesk windows hosting plans available in hong kong'

distance = 484
spam score = 61
title = 'china hosting blog raquo blog archive raquo hong kong cpanel hosting now with fantastico'

distance = 493
spam score = 54
title = 'china hosting blog raquo blog archive raquo how to check whether your site is blocked in china or not'

distance = 493
spam score = 46
title = 'china hosting blog raquo blog archive raquo router failure at server tiger'

distance = 493
spam score = 56
title = 'china hosting blog raquo blog archive raquo maintenance at tele asia datacenter'

distance = 496
spam score = 52
title = 'china hosting blog raquo blog archive raquo new prices for china and hong kong domain names'

distance = 500
spam score = 53
title = 'china hosting blog raquo blog archive raquo chinese dot cn extension now second cctld globally'

distance = 501
spam score = 63
title = 'china hosting blog raquo blog archive raquo important migration notification 8211 hknwt to stanley'

distance = 512
spam score = 53
title = 'china hosting blog raquo blog archive raquo bank transfer and other payment options now available in shenzhen'

distance = 522
spam score = 45
title = 'china hosting blog raquo blog archive raquo network card replacement at vps node'

distance = 522
spam score = 55
title = 'china hosting blog raquo blog archive raquo verification and delisting of icp licenses'

distance = 525
spam score = 67
title = 'china hosting blog raquo blog archive raquo china hosting plans update'

distance = 535
spam score = 66
title = 'china hosting blog raquo blog archive raquo web hosting plans upgrade announcement'

distance = 537
spam score = 42
title = 'china hosting blog raquo blog archive raquo no domain snatching icann guys please wake up'

distance = 549
spam score = 54
title = 'china hosting blog raquo blog archive raquo sinohosting launches guangdong and beijing cpanel shared hosting services'

distance = 555
spam score = 61
title = 'china hosting blog raquo blog archive raquo new pricing on selected china vps plans'

distance = 567
spam score = 44
title = 'china hosting blog raquo blog archive raquo hong kong dedicated ip address price revision'

distance = 609
spam score = 57
title = 'china hosting blog raquo blog archive raquo crackdown on nonverified cn domain names'

distance = 641
spam score = 56
title = 'china hosting blog raquo blog archive raquo new regulations on dot cn domain names registration now available only for companies'

distance = 722
spam score = 54
title = 'china hosting blog raquo blog archive raquo doing a full backup in cpanel'

distance = 741
spam score = 61
title = 'china hosting blog raquo blog archive raquo icp license crackdown'

distance = 743
spam score = 70
title = 'china hosting blog raquo blog archive raquo moving your site to a new hosting provider in china sixsteps guide'

distance = 754
spam score = 51
title = 'china hosting blog raquo blog archive raquo chinese registrars required not to block customers who want to transfer away'

distance = 772
spam score = 48
title = 'china hosting blog raquo blog archive raquo security alert 8211 iframe infection'

distance = 789
spam score = 31
title = 'china hosting blog raquo blog archive raquo security breach at server central'

distance = 814
spam score = 61
title = 'china hosting blog raquo blog archive raquo major upgrade to the icp license system in china 8211 photo id now required'

distance = 815
spam score = 56
title = 'china hosting blog raquo blog archive raquo china servers downtime notice'

distance = 907
spam score = 58
title = 'china hosting blog raquo blog archive raquo icp license in china what you need to know'

distance = 1731
spam score = 93
title = 'undercover investigation documents laboratory misery for dogs cats and rabbits take action petaorguk 1'

distance = 1760
spam score = 10
title = 'pinkmonkeycom sat study guide section section 5 reading comprehension'

distance = 253
spam score = 18
title = 'sunday review 8211 saga of the swamp thing book 4 hc swampthing4 collected comics library'

distance = 255
spam score = 17
title = 'how to find new comics that you will like spinnerrack collected comics library'

distance = 257
spam score = 18
title = 'best collected editions of 2011 21 collected comics library'

distance = 257
spam score = 23
title = 'ccl on the book cave podcast 8211 essentials showcases and more marvelsaga1mattmoring collected comics library'

distance = 257
spam score = 18
title = 'best collected editions of 2011 new52 collected comics library'

distance = 258
spam score = 18
title = 'best collected editions of 2011 malecall collected comics library'

distance = 259
spam score = 18
title = 'best collected editions of 2011 somedayfunnies collected comics library'

distance = 261
spam score = 18
title = 'best collected editions of 2011 comicswalker collected comics library'

distance = 261
spam score = 23
title = 'ccl podcast 321 8211 too many green lantern origins glfirstflight collected comics library'

distance = 262
spam score = 19
title = 'best collected editions of 2011 comicsrobinson collected comics library'

distance = 262
spam score = 19
title = 'best collected editions of 2011 metabarons collected comics library'

distance = 262
spam score = 22
title = 'dc comics new 52 collected editions list justiceleague152 collected comics library'

distance = 264
spam score = 20
title = 'october 2011 collected edition sale estimates 201110trades collected comics library'

distance = 264
spam score = 19
title = 'november 2011 collected edition sale estimates 201111trades collected comics library'

distance = 264
spam score = 19
title = 'best collected editions of 2011 archie1 collected comics library'

distance = 264
spam score = 21
title = 'december 2011 collected edition sale estimates 201112trades collected comics library'

distance = 264
spam score = 17
title = 'best collected editions of 2011 bone collected comics library'

distance = 265
spam score = 20
title = 'september 2011 collected edition sale estimates 201109trades collected comics library'

distance = 268
spam score = 20
title = 'sdcc 2011 day 1 collected editions news romitaae collected comics library'

distance = 270
spam score = 18
title = 'best collected editions of 2011 sugarandspikearchivesvolume1 collected comics library'

distance = 343
spam score = 25
title = 'the complete comic books of john carter of mars funnies30 collected comics library'

distance = 343
spam score = 30
title = 'sunday review 8211 the thing liberty legion thinglibertylegion collected comics library'

distance = 343
spam score = 26
title = 'sunday review will eisner8217s the contract with god trilogy wecontracttrilogy collected comics library'

distance = 343
spam score = 28
title = 'the complete comic books of john carter of mars dhweird collected comics library'

distance = 345
spam score = 28
title = '2011 eisner awards what did win eisnerawardsimage collected comics library'

distance = 347
spam score = 31
title = 'adopt a character for 2011 supes11stprinting collected comics library'

distance = 347
spam score = 35
title = 'sunday review star wars the comics companion starwarscomicscompanion collected comics library'

distance = 347
spam score = 28
title = 'sunday review special edition series volume 2 the ray 038 black condor ses2rbc collected comics library'

distance = 348
spam score = 29
title = 'the complete comic books of john carter of mars the gods of mars collected comics library'

distance = 349
spam score = 32
title = 'the complete comic books of john carter of mars a princess of mars collected comics library'

distance = 369
spam score = 29
title = 'the complete comic books of john carter of mars wardejah2 collected comics library'

distance = 377
spam score = 44
title = 'ccl on comic book page mayo report september 2011 collected edition sale estimates'

distance = 377
spam score = 21
title = 'two online mlk comic books'

distance = 377
spam score = 28
title = 'sdcc 2011 day 0 collected editions news wallywoodcoverimage600x880 collected comics library'

distance = 378
spam score = 33
title = 'the complete comic books of john carter of mars johncarteromnibus1davis collected comics library'

distance = 384
spam score = 43
title = 'reraising the flagg'

distance = 384
spam score = 39
title = 'january 2011 collected edition sale estimates'

distance = 386
spam score = 25
title = 'collected comics library podcast 324 the 2011 year in review'

distance = 386
spam score = 20
title = 'ccl podcast 299 8211 the 2010 year in review'

distance = 389
spam score = 28
title = 'ccl podcast 322 8211 dc8217s animated movies and their trades superman doomsday dvd collected comics library'

distance = 434
spam score = 21
title = 'collected comics library podcast 325 adopt a character 2012'

distance = 434
spam score = 21
title = 'collected edition blog browsing on tuesday morning'

distance = 436
spam score = 45
title = 'december 2010 collected edition sale estimates'

distance = 436
spam score = 41
title = 'ccl podcast 321 too many green lantern origins'

distance = 437
spam score = 39
title = 'collected edition blog browsing at comic con 2009 day 0'

distance = 437
spam score = 33
title = 'ccl podcast 288 8211 jim starlin8217s dreadstar'

distance = 440
spam score = 19
title = 'thoughts on the allstar batman and robin 10 recall'

distance = 441
spam score = 51
title = 'the new 52 equation'

distance = 442
spam score = 36
title = 'ccl podcast 309 8211 62159 for two'

distance = 444
spam score = 24
title = 'october 2010 collected edition sale estimates'

distance = 465
spam score = 50
title = 'ccl podcast 186 8211 2 marvel masterworks'

distance = 466
spam score = 21
title = 'collected edition blog browsing on friday afternoon'

distance = 466
spam score = 21
title = '6 minutes before and 6 minutes after watchmen'

distance = 466
spam score = 36
title = 'the better8230stronger8230faster collected edition'

distance = 466
spam score = 34
title = 'ccl podcast 77 8211 dc and marvel the crossovers'

distance = 468
spam score = 51
title = 'ccl podcast 207 8211 new york comic con 2009 wrap up'

distance = 470
spam score = 11
title = 'the women of marvel comics part 4 elektra'

distance = 470
spam score = 19
title = 'ccl podcast 280 8211 trading j michael straczynski'

distance = 471
spam score = 50
title = 'april 2011 collected edition sale estimates'

distance = 472
spam score = 22
title = 'ccl podcast 314 sdcc 2011 collected editions wrapup show'

distance = 487
spam score = 16
title = 'dc showcase presents'

distance = 488
spam score = 22
title = 'ccl podcast 322 dcs animated movies and their trades'

distance = 488
spam score = 31
title = 'dynamite to reprint the shadow by howard chaykin'

distance = 489
spam score = 23
title = 'sunday review 8211 marvel masterworks battlefield volume 1 hc'

distance = 489
spam score = 66
title = 'about collected comics library blog podcast chris marshall'

distance = 489
spam score = 26
title = 'collected edition blog browsing on tuesday morning'

distance = 492
spam score = 23
title = 'ccl podcast 315 shilling for back issue magazine'

distance = 495
spam score = 37
title = 'sunday review 8211 the adventures of tintin volume 1'

distance = 496
spam score = 26
title = 'ccl podcast 308 8211 christopher irving hermes press and graphic nyc'

distance = 497
spam score = 40
title = 'ccl podcast 176 8211 a look at dc comics 2009 collected editions'

distance = 518
spam score = 44
title = 'ccl podcast 313 trading captain america ii'

distance = 518
spam score = 34
title = 'sdcc 2011 day 1 collected editions news'

distance = 520
spam score = 23
title = 'ccl podcast 320 interview with richard graham government issue'

distance = 522
spam score = 22
title = 'real power part 10 zatanna'

distance = 524
spam score = 16
title = 'the decision to buy is just as important as when to buy'

distance = 525
spam score = 37
title = 'sunday review star wars the comics companion'

distance = 525
spam score = 33
title = 'sunday review 8211 saga of the swamp thing book 4 hc'

distance = 525
spam score = 21
title = 'real power part 8 batwoman'

distance = 526
spam score = 32
title = '8th annual ncaa football bowl contest'

distance = 527
spam score = 23
title = 'ccl on comic book page mayo report march 2010 collected edition sale estimates'

distance = 556
spam score = 41
title = 'ccl podcast 120 8211 free comics 2007 now what'

distance = 557
spam score = 42
title = 'ccl podcast 54 marvel fireside'

distance = 559
spam score = 29
title = 'ccl on comic book page mayo report 2009 year in review'

distance = 561
spam score = 22
title = 'fantagraphics to publish the complete carl barks'

distance = 561
spam score = 36
title = 'free comics 2011 now what'

distance = 562
spam score = 34
title = 'ccl on comic book page mayo report april 2010 collected edition sale estimates'

distance = 563
spam score = 39
title = 'sunday review the great comic book artists volumes 1 and 2'

distance = 565
spam score = 54
title = 'ccl podcast 185 8211 sinestro corp war vols 13'

distance = 568
spam score = 35
title = 'sunday review special edition series volume 2 the ray black condor'

distance = 570
spam score = 26
title = 'ccl podcast 187 8211 jack kirby8217s silver star and omac'

distance = 623
spam score = 21
title = 'sunday review 8211 the simon and kirby superheroes'

distance = 625
spam score = 21
title = 'sunday review the smithsonian collection of newspaper comics hc'

distance = 627
spam score = 28
title = 'out of print books comic book'

distance = 629
spam score = 34
title = 'sunday review 8211 shazam by chip kidd'

distance = 631
spam score = 31
title = 'how dc will collect before watchmen'

distance = 632
spam score = 27
title = 'comic book journalism'

distance = 639
spam score = 41
title = 'bone 20th anniversary color one volume editions'

distance = 639
spam score = 25
title = 'comic book blog browsing on a thursday morning'

distance = 640
spam score = 46
title = 'collected edition blog browsing at comic con 2009 day 2'

distance = 647
spam score = 17
title = 'battlefield'

distance = 899
spam score = 55
title = 'image comics collected editions november 2011 solicitations'

distance = 957
spam score = 66
title = 'library collected comics library'

distance = 1218
spam score = 64
title = 'marvel comics collected editions january 2012 solicitations'

distance = 1690
spam score = 86
title = 'about marvel overview jobs and careers marvel'

distance = 1690
spam score = 85
title = 'about marvel overview jobs and careers marvel'

distance = 171
spam score = 60
title = 'corel paintshop photo pro x3 design store'

distance = 187
spam score = 58
title = 'corel paintshop photo pro design store'

distance = 188
spam score = 60
title = 'corel paintshop photo pro x3 design store'

distance = 191
spam score = 56
title = 'corel paintshop photo x3 design store'

distance = 195
spam score = 54
title = 'sketchbook 8211 201011 design store'

distance = 196
spam score = 62
title = 'corel paintshop photo pro design store'

distance = 198
spam score = 49
title = 'corel paintshop photo pro design store'

distance = 201
spam score = 56
title = 'corel paintshop photo x3 8211 design store'

distance = 205
spam score = 57
title = 'corel paintshop photo pro design store'

distance = 208
spam score = 60
title = '2012 sketchbook page 17 design store'

distance = 210
spam score = 56
title = 'corel paintshop photo pro design store'

distance = 210
spam score = 59
title = 'corel paintshop photo pro design store'

distance = 220
spam score = 60
title = 'corel paintshop photo pro design store'

distance = 222
spam score = 58
title = 'corel paintshop photo pro design store'

distance = 223
spam score = 59
title = 'the sketchbook design store'

distance = 225
spam score = 60
title = 'corel paintshop photo x3 8211 design store'

distance = 233
spam score = 55
title = 'corel paintshop photo pro design store'

distance = 236
spam score = 60
title = 'me drawing in my sketchbook design store'

distance = 236
spam score = 58
title = 'corel paintshop photo pro design store'

distance = 241
spam score = 55
title = 'corel paintshop photo pro design store'

distance = 356
spam score = 62
title = '20110408 kwill on sketchbookjapanese sub design store'

distance = 356
spam score = 55
title = 'corel paintshop photo pro design store'

distance = 357
spam score = 61
title = 'mass effect 3 by harrison design store'

distance = 360
spam score = 59
title = 'photoshop elements 10 walkthrough design store'

distance = 360
spam score = 48
title = 'seth brady8217s sketchbook design store'

distance = 361
spam score = 57
title = 'adobe illustrator tutorial design store'

distance = 362
spam score = 59
title = 'how to do tone shading with manga studio design store'

distance = 363
spam score = 62
title = '2011 sketchbook project tour seattle design store'

distance = 363
spam score = 51
title = '7 adobe photoshop cs5 mac design store'

distance = 363
spam score = 56
title = 'using the step and repeat command in coreldrawmp4 design store'

distance = 399
spam score = 53
title = 'drive angry bluray 3d design store'

distance = 402
spam score = 58
title = 'how to do smooth slow motion in adobe after effects cs4 design store'

distance = 402
spam score = 63
title = 'photoshop style effects in coreldraw pt2 design store'

distance = 404
spam score = 58
title = 'after effects tutorial shatter effect design store'

distance = 404
spam score = 59
title = '3 adobe photoshop elements 10 for windows download design store'

distance = 405
spam score = 53
title = '3d in adobe illustrator cs4 design store'

distance = 405
spam score = 53
title = 'stick figures of purgatory 2 design store'

distance = 406
spam score = 59
title = 'locksmiths company logo designer londonwimbledon design store'

distance = 407
spam score = 59
title = 'tricks using renders design store'

distance = 408
spam score = 64
title = 'today is the 20th anniv of adobe photoshop design store'

distance = 429
spam score = 58
title = 'iceflowstudios design training 8211 introducing photoshop liquify design store'

distance = 430
spam score = 57
title = 'open season bluray 3d design store'

distance = 430
spam score = 61
title = 'convert bitmap in black amp white in coreldraw design store'

distance = 432
spam score = 57
title = 'open season bluray 3d design store'

distance = 433
spam score = 62
title = 'adobe after effects cs4 blue flame effect tutorial design store'

distance = 434
spam score = 61
title = 'the polar express presented in 3d design store'

distance = 437
spam score = 53
title = 'logo design for small business design store'

distance = 438
spam score = 54
title = 'tutorial photoshop cs5 8211 how to change background with pen tool design store'

distance = 439
spam score = 58
title = 'iceflowstudios design training 8211 introducing photoshop liquify design store'

distance = 440
spam score = 60
title = 'wwii in 3d bluray design store'

distance = 459
spam score = 57
title = '9 honestech vhs to dvd 50 deluxe design store'

distance = 460
spam score = 64
title = 'en 8211 03 what8217s new 8211 get going quickly coreldraw graphics suite x5 design store'

distance = 460
spam score = 63
title = 'adobe photoshop cs51 serial keyno download design store'

distance = 461
spam score = 53
title = 'pashtotutorial 8211 part 34 8211 how to put a person8217s face on another person8217s face design store'

distance = 462
spam score = 54
title = 'tutorial photoshop cs5 8211 how to change background with pen tool design store'

distance = 463
spam score = 54
title = 'paintshop photo pro x3 amp crazytalk6 8211 let your photos do the talking design store'

distance = 463
spam score = 64
title = 'tell me more about atopic eczema a patient8217s guide patient guide s design store'

distance = 464
spam score = 57
title = 'how to draw arc text 8211 adobe illustrator basics design store'

distance = 464
spam score = 57
title = 'how to draw arc text 8211 adobe illustrator basics design store'

distance = 464
spam score = 57
title = '5 adobe photoshop lightroom 3 student and teacher edition design store'

distance = 495
spam score = 60
title = 'paintshop pro x4 8211 new high dynamic range tools design store'

distance = 496
spam score = 55
title = 'how to work with the canvas size in coreldraw design store'

distance = 496
spam score = 62
title = '4 essential photo editing tips from a paintshop insider 8211 part 3 design store'

distance = 497
spam score = 57
title = '4 adobe photoshop extended cs5 student and teacher edition design store'

distance = 497
spam score = 63
title = 'setting color of preset shapes in paintshop pro x4 tutorial design store'

distance = 498
spam score = 56
title = 'photoshop beginners tutorial 1 design store'

distance = 501
spam score = 62
title = 'graphic and logo designer in london design store'

distance = 502
spam score = 64
title = 'en 8211 13 advanced techniques 8211 part 2 of 3 coreldraw graphics suite x5 design store'

distance = 504
spam score = 60
title = 'creating labels using the interactive contour tool coreldrawpart2flv design store'

distance = 504
spam score = 57
title = 'tracing with the pen tool in adobe illustrator design store'

distance = 530
spam score = 66
title = 'paint shop pro custom gradients tutorial design store'

distance = 530
spam score = 56
title = 'meet evelyn and craig from the paintshop pro team design store'

distance = 532
spam score = 57
title = 'part 2 draw an eye in adobe illustrator with karl gude design store'

distance = 534
spam score = 51
title = 'paintshop pro x4 8211 enhanced performance design store'

distance = 534
spam score = 53
title = 'resident evil afterlife bluray 3d design store'

distance = 534
spam score = 76
title = 'adobe photoshop cs5 template tutorial part 1 8211 basic template structure and navigation bar design store'

distance = 535
spam score = 53
title = 'meet evelyn and craig from the paintshop pro team design store'

distance = 536
spam score = 66
title = 'exploring problems of 8220joining8221 fashion flat sketching in adobe illustrator for fashion design design store'

distance = 537
spam score = 65
title = 'manga studio ex 4 win mac design store'

distance = 538
spam score = 64
title = 'manga studio debut 4 for mac download design store'

distance = 564
spam score = 59
title = 'golubice bijela sto si odletjela design store'

distance = 564
spam score = 60
title = 'logo design in adobe illustrator hd version design store'

distance = 568
spam score = 59
title = 'curso de corel draw x5 8211 aula 07 8211 aparar soldar e interseco design store'

distance = 572
spam score = 56
title = 'tangled fourdisc combo bluray 3d bluray dvd digital copy design store'

distance = 575
spam score = 59
title = 'intro to basic digital photo editing tools amp concepts 8211 part 5 design store'

distance = 577
spam score = 65
title = 'intro to basic digital photo editing tools amp concepts 8211 part 6 design store'

distance = 582
spam score = 58
title = 'radioshack rc car battery pack charger 72 96 rc 23333 design store'

distance = 583
spam score = 52
title = 'let8217s draw 3 8220the spider jockey part 1 cubes and proportion basics8221 design store'

distance = 584
spam score = 65
title = '10 sony vegas movie studio hd platinum 11 production suite design store'

distance = 585
spam score = 56
title = 'drawplus x4 8211 embossed text effect design store'

distance = 648
spam score = 79
title = 'aurora plush 8 inches panda design store'

distance = 652
spam score = 60
title = 'how to reflect the tool size in the cursor in manga studio design store'

distance = 656
spam score = 63
title = 'adobe illustrator tutorial vector christmas ball design store'

distance = 664
spam score = 62
title = 'corel paintshop pro x4 pocztwka z wakacji cz 4 design store'

distance = 670
spam score = 58
title = 'manga studio no tablet req tutorial 4 8211 very basic dialogue balloons design store'

distance = 672
spam score = 57
title = 'corel paintshop pro x4 8211 jak sprawdzi z ilu kolorw skada si zdjcie design store'

distance = 677
spam score = 62
title = 'adobe illustrator tutorial for screen printers design store'

distance = 692
spam score = 61
title = 'manga studio debut 4 for mac 8211 free downlaod design store'

distance = 693
spam score = 62
title = 'symantec endpoint protection small business edition 5 user old version design store'

distance = 697
spam score = 57
title = 'secret 8211 life is coolmagicmadonnashy boy kbs yhy sketchbook fermin gallegos design store'

distance = 1229
spam score = 58
title = 'norton antivirus 2010 1user3pc old version design store'

distance = 1363
spam score = 54
title = 'amazonbasics highspeed hdmi cable 65 feet20 meters 8211 supports ethernet 3d and audio return newest standard design store'

distance = 85
spam score = 56
title = '2012 march 16 uss liberty cover up'

distance = 86
spam score = 52
title = '2012 march 07 uss liberty cover up'

distance = 86
spam score = 58
title = '2010 september 15 uss liberty cover up'

distance = 87
spam score = 58
title = '2011 november 01 uss liberty cover up'

distance = 89
spam score = 56
title = '2010 february 21 uss liberty cover up'

distance = 89
spam score = 56
title = '2010 february 04 uss liberty cover up'

distance = 90
spam score = 54
title = '2010 february 15 uss liberty cover up'

distance = 91
spam score = 51
title = '2010 august 19 uss liberty cover up'

distance = 92
spam score = 56
title = '2010 february 23 uss liberty cover up'

distance = 94
spam score = 51
title = '2012 march 05 uss liberty cover up'

distance = 94
spam score = 50
title = '2011 february 16 uss liberty cover up'

distance = 95
spam score = 50
title = '2012 march 10 uss liberty cover up'

distance = 95
spam score = 51
title = '2010 august 22 uss liberty cover up'

distance = 96
spam score = 59
title = '2012 march 14 uss liberty cover up'

distance = 96
spam score = 57
title = '2012 march 15 uss liberty cover up'

distance = 97
spam score = 62
title = '2011 december 23 uss liberty cover up'

distance = 98
spam score = 59
title = '2011 january 17 uss liberty cover up'

distance = 98
spam score = 50
title = '2011 february 03 uss liberty cover up'

distance = 99
spam score = 57
title = '2010 september 03 uss liberty cover up'

distance = 99
spam score = 57
title = '2010 september 28 uss liberty cover up'

distance = 115
spam score = 61
title = '2011 january 12 uss liberty cover up'

distance = 116
spam score = 54
title = '2010 august 14 uss liberty cover up'

distance = 116
spam score = 58
title = '2011 february 06 uss liberty cover up'

distance = 116
spam score = 55
title = '2010 february 26 uss liberty cover up'

distance = 117
spam score = 50
title = '2010 august 27 uss liberty cover up'

distance = 117
spam score = 61
title = '2011 january 02 uss liberty cover up'

distance = 117
spam score = 61
title = '2011 november 20 uss liberty cover up'

distance = 118
spam score = 59
title = '2010 september 21 uss liberty cover up'

distance = 119
spam score = 59
title = '2011 december 28 uss liberty cover up'

distance = 119
spam score = 58
title = '2011 january 30 uss liberty cover up'

distance = 130
spam score = 57
title = '2010 september 13 uss liberty cover up'

distance = 130
spam score = 52
title = '2010 august 16 uss liberty cover up'

distance = 131
spam score = 60
title = '2010 september 07 uss liberty cover up'

distance = 131
spam score = 57
title = '2009 september 03 uss liberty cover up'

distance = 131
spam score = 54
title = '2009 september 30 uss liberty cover up'

distance = 131
spam score = 70
title = '2009 august 27 uss liberty cover up'

distance = 131
spam score = 60
title = '2011 january 27 uss liberty cover up'

distance = 131
spam score = 58
title = '2009 september 14 uss liberty cover up'

distance = 132
spam score = 59
title = '2010 february 22 uss liberty cover up'

distance = 132
spam score = 57
title = '2009 september 10 uss liberty cover up'

distance = 145
spam score = 51
title = '2011 february 14 uss liberty cover up'

distance = 145
spam score = 59
title = '2011 november 09 uss liberty cover up'

distance = 146
spam score = 52
title = '2010 august 18 uss liberty cover up'

distance = 146
spam score = 62
title = '2011 january 18 uss liberty cover up'

distance = 147
spam score = 54
title = '2010 february 10 uss liberty cover up'

distance = 149
spam score = 56
title = '2009 september 06 uss liberty cover up'

distance = 150
spam score = 60
title = '2010 february 09 uss liberty cover up'

distance = 150
spam score = 58
title = '2011 january 05 uss liberty cover up'

distance = 151
spam score = 50
title = '2011 february 01 uss liberty cover up'

distance = 152
spam score = 53
title = '2011 december 01 uss liberty cover up'

distance = 187
spam score = 57
title = '2010 september 11 uss liberty cover up'

distance = 188
spam score = 53
title = '2010 august 20 uss liberty cover up'

distance = 197
spam score = 60
title = '2011 january 03 uss liberty cover up'

distance = 198
spam score = 40
title = '2010 january uss liberty cover up part 2'

distance = 203
spam score = 58
title = '2010 september 08 uss liberty cover up'

distance = 205
spam score = 52
title = '2009 august uss liberty cover up'

distance = 221
spam score = 56
title = '2010 september 23 uss liberty cover up'

distance = 235
spam score = 58
title = '2010 september 09 uss liberty cover up'

distance = 236
spam score = 63
title = 'negligence uss liberty cover up'

distance = 245
spam score = 57
title = '2010 september 29 uss liberty cover up'

distance = 462
spam score = 56
title = 'is this the america we want to leave to our children uss liberty cover up'

distance = 467
spam score = 76
title = 'go hear alison speak uss liberty cover up'

distance = 468
spam score = 52
title = 'uss liberty a pictorial story uss liberty cover up'

distance = 485
spam score = 64
title = 'some gems from john gidusko8217s uss liberty newsletter uss liberty cover up'

distance = 488
spam score = 60
title = 'special edition uss liberty 2009 anniversary of american tragedy uss liberty cover up'

distance = 494
spam score = 53
title = 'us suffers from fawning over israel uss liberty cover up'

distance = 496
spam score = 57
title = '2011 october uss liberty cover up'

distance = 506
spam score = 45
title = 'about uss liberty cover up'

distance = 514
spam score = 61
title = 'oped comment from joe meadors uss liberty survivor uss liberty cover up'

distance = 525
spam score = 54
title = '8220what i8217d like to know is the legal status of the investigation request8221 so would we all uss liberty cover up'

distance = 600
spam score = 45
title = 'us coverup of israeli attack on the uss liberty uss liberty cover up'

distance = 606
spam score = 50
title = 'israel8217s deadly 1967 attack in us ship censorship never ends uss liberty cover up'

distance = 606
spam score = 73
title = 'uss liberty photo album uss liberty cover up'

distance = 607
spam score = 46
title = 'american cold war veterans will the truth ever be told uss liberty uss liberty cover up'

distance = 609
spam score = 56
title = 'ahron jay cristol8217s 8220the liberty incident8221 2002 uss liberty cover up'

distance = 618
spam score = 58
title = 'with friends like these8230 coverup of the attack on the liberty uss liberty cover up'

distance = 620
spam score = 68
title = 'still under wraps8230 uss liberty cover up'

distance = 625
spam score = 42
title = 'the loss of liberty uss liberty coverup uss liberty cover up'

distance = 631
spam score = 68
title = 'ahron jay cristol israel first always uss liberty cover up'

distance = 636
spam score = 53
title = '43rd anniversary of israeli attack on uss liberty uss liberty cover up'

distance = 705
spam score = 54
title = 'will israel go to war uss liberty cover up'

distance = 706
spam score = 67
title = 'liberty survivor hour with hosts phil tourney and ron kukal thursday8217s show 923 has veterans today senior editor gordon duff scheduled uss liberty cover up'

distance = 706
spam score = 51
title = 'did lbj cover for israel uss liberty cover up'

distance = 710
spam score = 35
title = 'uss liberty 8211 could it happen again in the strait of hormuz perhaps uss liberty cover up'

distance = 712
spam score = 35
title = 'coverup alleged in probe of uss liberty uss liberty cover up'

distance = 721
spam score = 44
title = 'attack on uss liberty 8211 a mystery that won8217t go away uss liberty cover up'

distance = 723
spam score = 55
title = 'michael b oren israel8217s official paid liar uss liberty cover up'

distance = 734
spam score = 50
title = 'a minnesota town remembered the uss liberty uss liberty cover up'

distance = 736
spam score = 66
title = 'part two of cracker jack ahron8217s 8220expert research with a crappy prize inside all nuts8221 uss liberty cover up'

distance = 737
spam score = 40
title = 'haaretz8217s columnist 8220the mavi marmara affair provided an excuse to bring up the liberty incident once again8221 uss liberty cover up'

distance = 799
spam score = 69
title = 'taki on the uss liberty uss liberty cover up'

distance = 803
spam score = 45
title = 'bbc 8220why did israel attack uss liberty8221 uss liberty cover up'

distance = 804
spam score = 58
title = 'oped 8220a military family members opinion8221 uss liberty cover up'

distance = 805
spam score = 47
title = '8220the israeli story in a nutshell8221 uss liberty cover up'

distance = 814
spam score = 60
title = 'amazing what tel aviv gets away with uss liberty cover up'

distance = 819
spam score = 48
title = 'mantiq altayr the attack on the uss liberty uss liberty cover up'

distance = 820
spam score = 89
title = 'survivor joe meadors reports that planning for the next freedom flotilla to gaza is well underway uss liberty cover up'

distance = 828
spam score = 40
title = 'navy memorial service for admiral thomas moorer uss liberty cover up'

distance = 829
spam score = 38
title = 'gregory kane 20108242s chutzpah award winners uss liberty cover up'

distance = 830
spam score = 45
title = 'still ignored by our israel first government8230liberty veterans file war crimes brief uss liberty cover up'

distance = 1050
spam score = 51
title = 'old nsa tapes discussed us and israel8217s gov8217t claims debunked uss liberty cover up'

distance = 1066
spam score = 46
title = 'at least turkey gave a damn about its citizens not so with the us govt and uss liberty uss liberty cover up'

distance = 1080
spam score = 41
title = 'capt william mcgonagle8217s remarkable vision superman8217s got nothing on him uss liberty cover up'

distance = 1096
spam score = 57
title = 'unveiling the attack on the uss liberty uss liberty cover up'

distance = 1109
spam score = 60
title = 'ken halliwell uss liberty attack the rules of engagement uss liberty cover up'

distance = 1128
spam score = 56
title = 'the rules of engagement8230 uss liberty cover up'

distance = 1166
spam score = 59
title = 'the navy court of inquiry evidence of negligence uss liberty cover up'

distance = 1183
spam score = 63
title = 'the salans report uss liberty cover up'

distance = 156
spam score = 41
title = ''

distance = 213
spam score = 39
title = ''

distance = 217
spam score = 45
title = ''

distance = 218
spam score = 45
title = ''

distance = 221
spam score = 41
title = ''

distance = 227
spam score = 31
title = ''

distance = 233
spam score = 49
title = ''

distance = 243
spam score = 47
title = ''

distance = 254
spam score = 46
title = ''

distance = 255
spam score = 38
title = ''

distance = 266
spam score = 43
title = ''

distance = 274
spam score = 42
title = ''

distance = 275
spam score = 35
title = ''

distance = 285
spam score = 45
title = ''

distance = 292
spam score = 30
title = ''

distance = 294
spam score = 29
title = ''

distance = 297
spam score = 42
title = ''

distance = 302
spam score = 39
title = ''

distance = 304
spam score = 44
title = ''

distance = 307
spam score = 24
title = ''

distance = 307
spam score = 48
title = ''

distance = 309
spam score = 30
title = ''

distance = 310
spam score = 40
title = ''

distance = 312
spam score = 48
title = ''

distance = 314
spam score = 41
title = ''

distance = 316
spam score = 49
title = ''

distance = 318
spam score = 46
title = ''

distance = 327
spam score = 50
title = ''

distance = 327
spam score = 37
title = ''

distance = 328
spam score = 30
title = ''

distance = 330
spam score = 29
title = ''

distance = 341
spam score = 46
title = ''

distance = 341
spam score = 26
title = ''

distance = 341
spam score = 59
title = ''

distance = 342
spam score = 42
title = ''

distance = 342
spam score = 35
title = ''

distance = 345
spam score = 29
title = ''

distance = 348
spam score = 31
title = ''

distance = 348
spam score = 49
title = ''

distance = 353
spam score = 48
title = ''

distance = 355
spam score = 29
title = ''

distance = 360
spam score = 48
title = ''

distance = 361
spam score = 50
title = ''

distance = 362
spam score = 39
title = ''

distance = 364
spam score = 33
title = ''

distance = 370
spam score = 39
title = ''

distance = 372
spam score = 34
title = ''

distance = 372
spam score = 33
title = ''

distance = 378
spam score = 42
title = ''

distance = 392
spam score = 43
title = ''

distance = 393
spam score = 50
title = ''

distance = 394
spam score = 52
title = ''

distance = 398
spam score = 44
title = ''

distance = 405
spam score = 42
title = ''

distance = 411
spam score = 41
title = ''

distance = 414
spam score = 52
title = ''

distance = 418
spam score = 23
title = ''

distance = 422
spam score = 43
title = ''

distance = 423
spam score = 45
title = ''

distance = 430
spam score = 40
title = ''

distance = 439
spam score = 32
title = ''

distance = 457
spam score = 41
title = ''

distance = 472
spam score = 38
title = ''

distance = 474
spam score = 39
title = ''

distance = 475
spam score = 31
title = ''

distance = 497
spam score = 46
title = ''

distance = 511
spam score = 48
title = ''

distance = 518
spam score = 43
title = ''

distance = 520
spam score = 42
title = ''

distance = 535
spam score = 39
title = ''

distance = 541
spam score = 33
title = ''

distance = 545
spam score = 30
title = ''

distance = 558
spam score = 53
title = ''

distance = 576
spam score = 51
title = ''

distance = 583
spam score = 28
title = ''

distance = 584
spam score = 44
title = ''

distance = 593
spam score = 30
title = ''

distance = 617
spam score = 34
title = ''

distance = 617
spam score = 28
title = ''

distance = 630
spam score = 37
title = ''

distance = 640
spam score = 29
title = ''

distance = 652
spam score = 29
title = ''

distance = 712
spam score = 42
title = ''

distance = 725
spam score = 25
title = ''

distance = 753
spam score = 48
title = ''

distance = 1336
spam score = 86
title = ''

distance = 1368
spam score = 88
title = ''

distance = 1400
spam score = 72
title = ''

distance = 1455
spam score = 88
title = ''

distance = 366
spam score = 49
title = ''

distance = 369
spam score = 63
title = ''

distance = 369
spam score = 63
title = ''

distance = 370
spam score = 50
title = ''

distance = 373
spam score = 47
title = ''

distance = 373
spam score = 47
title = ''

distance = 376
spam score = 56
title = ''

distance = 376
spam score = 52
title = ''

distance = 376
spam score = 53
title = ''

distance = 377
spam score = 56
title = ''

distance = 381
spam score = 57
title = ''

distance = 381
spam score = 58
title = ''

distance = 381
spam score = 58
title = ''

distance = 388
spam score = 50
title = ''

distance = 393
spam score = 64
title = ''

distance = 398
spam score = 58
title = ''

distance = 401
spam score = 52
title = ''

distance = 401
spam score = 51
title = ''

distance = 408
spam score = 48
title = ''

distance = 413
spam score = 44
title = ''

distance = 413
spam score = 44
title = ''

distance = 425
spam score = 49
title = ''

distance = 425
spam score = 50
title = ''

distance = 427
spam score = 67
title = ''

distance = 431
spam score = 44
title = ''

distance = 431
spam score = 43
title = ''

distance = 433
spam score = 55
title = ''

distance = 433
spam score = 54
title = ''

distance = 437
spam score = 40
title = ''

distance = 438
spam score = 53
title = ''

distance = 438
spam score = 38
title = ''

distance = 438
spam score = 66
title = ''

distance = 438
spam score = 67
title = ''

distance = 444
spam score = 66
title = ''

distance = 445
spam score = 55
title = ''

distance = 448
spam score = 58
title = ''

distance = 448
spam score = 58
title = ''

distance = 455
spam score = 54
title = ''

distance = 455
spam score = 54
title = ''

distance = 455
spam score = 60
title = ''

distance = 458
spam score = 56
title = ''

distance = 458
spam score = 56
title = ''

distance = 458
spam score = 56
title = ''

distance = 468
spam score = 84
title = ''

distance = 468
spam score = 52
title = ''

distance = 468
spam score = 52
title = ''

distance = 469
spam score = 84
title = ''

distance = 471
spam score = 61
title = ''

distance = 472
spam score = 41
title = ''

distance = 472
spam score = 41
title = ''

distance = 478
spam score = 48
title = ''

distance = 483
spam score = 56
title = ''

distance = 487
spam score = 55
title = ''

distance = 487
spam score = 54
title = ''

distance = 489
spam score = 63
title = ''

distance = 498
spam score = 57
title = ''

distance = 499
spam score = 76
title = ''

distance = 506
spam score = 48
title = ''

distance = 506
spam score = 48
title = ''

distance = 511
spam score = 62
title = ''

distance = 511
spam score = 61
title = ''

distance = 511
spam score = 61
title = ''

distance = 515
spam score = 66
title = ''

distance = 517
spam score = 46
title = ''

distance = 520
spam score = 63
title = ''

distance = 523
spam score = 81
title = ''

distance = 523
spam score = 53
title = ''

distance = 528
spam score = 77
title = ''

distance = 538
spam score = 60
title = ''

distance = 539
spam score = 59
title = ''

distance = 540
spam score = 66
title = ''

distance = 542
spam score = 87
title = ''

distance = 555
spam score = 69
title = ''

distance = 557
spam score = 60
title = ''

distance = 582
spam score = 89
title = ''

distance = 582
spam score = 89
title = ''

distance = 582
spam score = 89
title = ''

distance = 585
spam score = 60
title = ''

distance = 587
spam score = 66
title = ''

distance = 611
spam score = 62
title = ''

distance = 611
spam score = 63
title = ''

distance = 630
spam score = 85
title = ''

distance = 632
spam score = 60
title = ''

distance = 666
spam score = 81
title = ''

distance = 668
spam score = 63
title = ''

distance = 685
spam score = 75
title = ''

distance = 687
spam score = 69
title = ''

distance = 708
spam score = 62
title = ''

distance = 711
spam score = 68
title = ''

distance = 713
spam score = 77
title = ''

distance = 740
spam score = 68
title = ''

distance = 741
spam score = 69
title = ''

distance = 757
spam score = 84
title = ''

distance = 104
spam score = 98
title = 'the school of business then amp now school of business'

distance = 132
spam score = 97
title = 'alumni school of business'

distance = 134
spam score = 98
title = 'this week039s business school of business'

distance = 146
spam score = 97
title = 'academic programs school of business'

distance = 150
spam score = 97
title = 'our philosophy school of business'

distance = 151
spam score = 97
title = 'dean039s office school of business'

distance = 166
spam score = 98
title = 'herbert b mayo school of business'

distance = 171
spam score = 98
title = 'thomas breslin school of business'

distance = 172
spam score = 98
title = 'the school of business then amp now school of business'

distance = 173
spam score = 97
title = 'our people school of business'

distance = 181
spam score = 97
title = 'prospective students school of business'

distance = 196
spam score = 98
title = 'this week039s business school of business'

distance = 198
spam score = 97
title = 'alumni school of business'

distance = 212
spam score = 97
title = 'academic programs school of business'

distance = 216
spam score = 97
title = 'dean039s office school of business'

distance = 218
spam score = 98
title = 'current students school of business'

distance = 222
spam score = 98
title = 'course approval and modification school of business'

distance = 226
spam score = 96
title = 'professor quinton039s study abroad trips school of business'

distance = 229
spam score = 98
title = 'requirements for the minor in economics school of business'

distance = 229
spam score = 97
title = 'testimonials amp rankings school of business'

distance = 308
spam score = 98
title = 'employers school of business'

distance = 309
spam score = 97
title = 'speed networking school of business'

distance = 309
spam score = 97
title = 'speed networking school of business'

distance = 309
spam score = 98
title = 'the national association of black accountants naba sponsors kwame jackson at tcnj school of business'

distance = 311
spam score = 96
title = 'the school of business then amp now school of business'

distance = 311
spam score = 96
title = 'the school of business then amp now school of business'

distance = 314
spam score = 98
title = 'gerald j miller school of business'

distance = 314
spam score = 97
title = 'student organization photos school of business'

distance = 314
spam score = 98
title = 'economics students attend 2009 ode conference at ursinus college school of business'

distance = 315
spam score = 98
title = 'contacts for the department of management marketing and interdisciplinary business school of business'

distance = 343
spam score = 98
title = 'philosophy of undergraduate education school of business'

distance = 346
spam score = 96
title = 'tom szaky school of business'

distance = 346
spam score = 97
title = 'student investment fund school of business'

distance = 346
spam score = 97
title = 'student investment fund school of business'

distance = 346
spam score = 97
title = 'tom szaky school of business'

distance = 346
spam score = 98
title = 'applying for an mba program school of business'

distance = 351
spam score = 98
title = 'getting involved school of business'

distance = 351
spam score = 97
title = 'nyse trip school of business'

distance = 351
spam score = 99
title = 'code of conduct school of business'

distance = 351
spam score = 97
title = 'nyse trip school of business'

distance = 374
spam score = 98
title = 'sunita ahlawat school of business'

distance = 375
spam score = 98
title = 'appraisal economics job opportunity school of business'

distance = 375
spam score = 98
title = 'appraisal economics job opportunity school of business'

distance = 376
spam score = 97
title = '2011 celebration of student achievement school of business'

distance = 376
spam score = 97
title = '2011 celebration of student achievement school of business'

distance = 377
spam score = 96
title = 'inside terracycle school of business'

distance = 377
spam score = 96
title = 'inside terracycle school of business'

distance = 377
spam score = 98
title = 'requirements for the minor in human resources management school of business'

distance = 382
spam score = 98
title = 'koch associate program school of business'

distance = 382
spam score = 98
title = 'koch associate program school of business'

distance = 415
spam score = 98
title = 'waheeda lillevik school of business'

distance = 418
spam score = 96
title = 'alumni connections school of business'

distance = 422
spam score = 97
title = 'contacts school of business'

distance = 423
spam score = 98
title = 'the charles g koch summer fellow program school of business'

distance = 423
spam score = 98
title = 'dean039s advisory council school of business'

distance = 424
spam score = 97
title = 'tcnj heidelberg business study abroad school of business'

distance = 424
spam score = 97
title = 'tcnj heidelberg business study abroad school of business'

distance = 429
spam score = 98
title = 'sunita ahlawat school of business'

distance = 430
spam score = 97
title = 'rbi national sales challenge november 46 2010 school of business'

distance = 430
spam score = 97
title = 'rbi national sales challenge november 46 2010 school of business'

distance = 468
spam score = 99
title = 'welcome to the open option program in the school of business school of business'

distance = 470
spam score = 96
title = '20102011 studentalumni networking programs school of business'

distance = 470
spam score = 96
title = '20102011 studentalumni networking programs school of business'

distance = 472
spam score = 92
title = 'bus 099 freshmen seminar scavenger hunt school of business'

distance = 472
spam score = 92
title = 'bus 099 freshmen seminar scavenger hunt school of business'

distance = 475
spam score = 99
title = 'minor in marketing school of business'

distance = 477
spam score = 98
title = 'career resources school of business'

distance = 479
spam score = 98
title = 'economics program overview school of business'

distance = 479
spam score = 98
title = 'mercer regional chamber of commerce young business leaders council school of business'

distance = 480
spam score = 98
title = 'david prensky school of business'

distance = 519
spam score = 98
title = 'guest speakers in spring 2011 acc 498 capstone with dr nigrini school of business'

distance = 519
spam score = 98
title = 'guest speakers in spring 2011 acc 498 capstone with dr nigrini school of business'

distance = 523
spam score = 98
title = 'economics program overview school of business'

distance = 524
spam score = 98
title = 'daniel r hall award school of business'

distance = 529
spam score = 99
title = 'economics department news amp notes school of business'

distance = 534
spam score = 98
title = 'student leadership awards school of business'

distance = 538
spam score = 98
title = 'writing analyzing presenting school of business'

distance = 544
spam score = 98
title = 'advising and mentoring school of business'

distance = 551
spam score = 98
title = 'skill building in marketing courses school of business'

distance = 554
spam score = 99
title = 'marketing school of business'

distance = 615
spam score = 98
title = 'rbi national sales challenge school of business'

distance = 618
spam score = 97
title = 'selling facts school of business'

distance = 618
spam score = 96
title = 'phi beta lambda excels at state leadership conference school of business'

distance = 628
spam score = 99
title = 'dean039s alumni networking night school of business'

distance = 629
spam score = 99
title = 'online advising resources school of business'

distance = 631
spam score = 98
title = 'school of business staff school of business'

distance = 633
spam score = 99
title = 'advisement for open option business students school of business'

distance = 635
spam score = 93
title = 'commencement 2011 school of business'

distance = 636
spam score = 97
title = 'team invex dominates lion039s apprentice season two school of business'

distance = 637
spam score = 97
title = 'calendar school of business'

distance = 727
spam score = 99
title = 'c andrew lafond school of business'

distance = 734
spam score = 99
title = '2nd annual award for innovative leadership presented to tom szaky terracycle school of business'

distance = 734
spam score = 99
title = '2nd annual award for innovative leadership presented to tom szaky terracycle school of business'

distance = 738
spam score = 98
title = '2011 national conference on undergraduate research school of business'

distance = 738
spam score = 98
title = '2011 national conference on undergraduate research school of business'

distance = 748
spam score = 97
title = 'senior thesis in economics school of business'

distance = 748
spam score = 95
title = 'business dress attire reference school of business'

distance = 753
spam score = 99
title = 'general career information links school of business'

distance = 753
spam score = 98
title = 'change of major specialization guidelines school of business'

distance = 753
spam score = 99
title = 'general career information links school of business'

distance = 871
spam score = 98
title = 'pi sigma epsilon proamsellathon november 20 2010 school of business'

distance = 893
spam score = 98
title = 'mark j nigrini school of business'

distance = 907
spam score = 99
title = 'mayo business plan competition 2012 school of business'

distance = 925
spam score = 99
title = 'bozena leven school of business'

distance = 948
spam score = 92
title = 'senior theses in economics 2001 present school of business'

distance = 991
spam score = 98
title = 'brenda e ghitulescu school of business'

distance = 1017
spam score = 91
title = 'course checksheets amp suggested fouryear sequence of study school of business'

distance = 1037
spam score = 91
title = 'course checksheets amp suggested fouryear sequence of study school of business'

distance = 1092
spam score = 95
title = 'eco 494 senior thesis preparation school of business'

distance = 25
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 25
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 25
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 25
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 25
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 25
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 26
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 26
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 26
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 26
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 26
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 27
spam score = 81
title = 'check out what i bought from browns world class martial arts'

distance = 27
spam score = 81
title = 'check out what i bought from browns world class martial arts'

distance = 27
spam score = 81
title = 'check out what i bought from browns world class martial arts'

distance = 27
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 27
spam score = 81
title = 'check out what i bought from browns world class martial arts'

distance = 27
spam score = 81
title = 'check out what i bought from browns world class martial arts'

distance = 27
spam score = 81
title = 'check out what i bought from browns world class martial arts'

distance = 27
spam score = 81
title = 'check out what i bought from browns world class martial arts'

distance = 29
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 45
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 45
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 45
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 45
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 45
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 45
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 45
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 45
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 45
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 47
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 56
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 57
spam score = 84
title = 'check out what i bought from browns world class martial arts'

distance = 58
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 58
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 58
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 59
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 59
spam score = 81
title = 'check out what i bought from browns world class martial arts'

distance = 59
spam score = 82
title = 'check out what i bought from browns world class martial arts'

distance = 61
spam score = 85
title = 'check out what i bought from browns world class martial arts'

distance = 61
spam score = 81
title = 'check out what i bought from browns world class martial arts'

distance = 170
spam score = 83
title = 'round rock shaolin kung fu and tai chi'

distance = 170
spam score = 80
title = 'round rock shaolin kung fu and tai chi'

distance = 172
spam score = 84
title = 'check out what i bought from browns world class martial arts'

distance = 172
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 172
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 174
spam score = 83
title = 'check out what i bought from browns world class martial arts'

distance = 188
spam score = 85
title = 'crispin tournaments'

distance = 188
spam score = 85
title = 'crispin tournaments'

distance = 190
spam score = 80
title = 'check out what i bought from americas best martial arts'

distance = 192
spam score = 78
title = 'check out what i bought from americas best martial arts'

distance = 282
spam score = 86
title = 'browns martial arts waterdown ontario'

distance = 286
spam score = 89
title = 'charland institute of karate fitness'

distance = 286
spam score = 89
title = 'charland institute of karate fitness'

distance = 286
spam score = 89
title = 'charland institute of karate fitness'

distance = 286
spam score = 89
title = 'charland institute of karate fitness'

distance = 295
spam score = 88
title = 'charland institute of karate fitness'

distance = 295
spam score = 88
title = 'charland institute of karate fitness'

distance = 296
spam score = 77
title = 'check out what i bought from americas best martial arts'

distance = 307
spam score = 88
title = 'charland institute of karate fitness'

distance = 307
spam score = 88
title = 'charland institute of karate fitness'

distance = 413
spam score = 88
title = 'charland institute of karate fitness'

distance = 418
spam score = 88
title = 'charland institute of karate fitness'

distance = 418
spam score = 87
title = 'charland institute of karate fitness'

distance = 418
spam score = 87
title = 'charland institute of karate fitness'

distance = 418
spam score = 87
title = 'charland institute of karate fitness'

distance = 422
spam score = 78
title = 'check out what i bought from americas best martial arts'

distance = 432
spam score = 87
title = 'charland institute of karate fitness'

distance = 432
spam score = 87
title = 'charland institute of karate fitness'

distance = 432
spam score = 88
title = 'charland institute of karate fitness'

distance = 432
spam score = 88
title = 'charland institute of karate fitness'

distance = 484
spam score = 75
title = 'check out what i bought from americas best martial arts'

distance = 495
spam score = 77
title = 'check out what i bought from americas best martial arts'

distance = 499
spam score = 90
title = 'americas best martial arts'

distance = 514
spam score = 76
title = 'check out what i bought from americas best martial arts'

distance = 515
spam score = 77
title = 'check out what i bought from americas best martial arts'

distance = 529
spam score = 78
title = 'check out what i bought from americas best martial arts'

distance = 538
spam score = 78
title = 'check out what i bought from americas best martial arts'

distance = 544
spam score = 77
title = 'check out what i bought from americas best martial arts'

distance = 551
spam score = 76
title = 'check out what i bought from americas best martial arts'

distance = 553
spam score = 76
title = 'check out what i bought from americas best martial arts'

distance = 632
spam score = 88
title = 'charland institute of karate fitness'

distance = 632
spam score = 89
title = 'charland institute of karate fitness'

distance = 632
spam score = 89
title = 'charland institute of karate fitness'

distance = 632
spam score = 88
title = 'charland institute of karate fitness'

distance = 635
spam score = 74
title = 'check out what i bought from americas best martial arts'

distance = 648
spam score = 79
title = 'check out what i bought from americas best martial arts'

distance = 655
spam score = 76
title = 'check out what i bought from americas best martial arts'

distance = 659
spam score = 89
title = 'charland institute of karate fitness'

distance = 659
spam score = 89
title = 'charland institute of karate fitness'

distance = 660
spam score = 78
title = 'check out what i bought from americas best martial arts'

distance = 1113
spam score = 80
title = 'youth students don their new belts'

distance = 1113
spam score = 79
title = 'youth students don their new belts'

distance = 1114
spam score = 81
title = 'congratulating each student on their progress and achievement'

distance = 1114
spam score = 80
title = 'congratulating each student on their progress and achievement'

distance = 1114
spam score = 80
title = 'congratulating each student on their progress and achievement'

distance = 1115
spam score = 91
title = 'the charland institute of karate fitness'

distance = 1115
spam score = 79
title = 'bathrooms'

distance = 1115
spam score = 78
title = 'bathrooms'

distance = 1115
spam score = 76
title = 'bathrooms'

distance = 1120
spam score = 76
title = 'womens locker room'

distance = 1141
spam score = 74
title = 'the group picture from ryer academys youth belt graduation on thursday february 9th 2012'

distance = 1279
spam score = 77
title = 'check out what i bought from ryer martial arts academy'

distance = 195
spam score = 81
title = ''

distance = 223
spam score = 87
title = ''

distance = 228
spam score = 78
title = ''

distance = 228
spam score = 78
title = ''

distance = 231
spam score = 76
title = ''

distance = 232
spam score = 86
title = ''

distance = 234
spam score = 83
title = ''

distance = 245
spam score = 86
title = ''

distance = 246
spam score = 76
title = ''

distance = 258
spam score = 81
title = ''

distance = 262
spam score = 77
title = ''

distance = 267
spam score = 76
title = ''

distance = 268
spam score = 80
title = ''

distance = 272
spam score = 76
title = ''

distance = 274
spam score = 73
title = ''

distance = 277
spam score = 76
title = ''

distance = 277
spam score = 80
title = ''

distance = 280
spam score = 74
title = ''

distance = 280
spam score = 75
title = ''

distance = 280
spam score = 75
title = ''

distance = 291
spam score = 85
title = ''

distance = 292
spam score = 80
title = ''

distance = 295
spam score = 86
title = ''

distance = 296
spam score = 87
title = ''

distance = 299
spam score = 73
title = ''

distance = 304
spam score = 87
title = ''

distance = 310
spam score = 87
title = ''

distance = 313
spam score = 87
title = ''

distance = 313
spam score = 87
title = ''

distance = 316
spam score = 88
title = ''

distance = 325
spam score = 75
title = ''

distance = 329
spam score = 87
title = ''

distance = 337
spam score = 75
title = ''

distance = 339
spam score = 77
title = ''

distance = 344
spam score = 84
title = ''

distance = 344
spam score = 85
title = ''

distance = 356
spam score = 92
title = ''

distance = 361
spam score = 88
title = ''

distance = 362
spam score = 92
title = ''

distance = 363
spam score = 87
title = ''

distance = 363
spam score = 92
title = ''

distance = 367
spam score = 92
title = ''

distance = 370
spam score = 90
title = ''

distance = 377
spam score = 88
title = ''

distance = 381
spam score = 88
title = ''

distance = 395
spam score = 90
title = ''

distance = 398
spam score = 82
title = ''

distance = 398
spam score = 88
title = ''

distance = 407
spam score = 86
title = ''

distance = 421
spam score = 87
title = ''

distance = 422
spam score = 88
title = ''

distance = 428
spam score = 87
title = ''

distance = 431
spam score = 87
title = ''

distance = 437
spam score = 88
title = ''

distance = 468
spam score = 86
title = ''

distance = 525
spam score = 67
title = ''

distance = 536
spam score = 85
title = ''

distance = 537
spam score = 82
title = ''

distance = 544
spam score = 80
title = ''

distance = 552
spam score = 82
title = ''

distance = 556
spam score = 84
title = ''

distance = 565
spam score = 64
title = ''

distance = 571
spam score = 85
title = ''

distance = 586
spam score = 89
title = ''

distance = 605
spam score = 79
title = ''

distance = 608
spam score = 67
title = ''

distance = 609
spam score = 62
title = ''

distance = 617
spam score = 69
title = ''

distance = 619
spam score = 79
title = ''

distance = 620
spam score = 80
title = ''

distance = 620
spam score = 80
title = ''

distance = 623
spam score = 81
title = ''

distance = 623
spam score = 79
title = ''

distance = 624
spam score = 79
title = ''

distance = 632
spam score = 81
title = ''

distance = 634
spam score = 62
title = ''

distance = 636
spam score = 74
title = ''

distance = 637
spam score = 79
title = ''

distance = 650
spam score = 81
title = ''

distance = 652
spam score = 83
title = ''

distance = 653
spam score = 66
title = ''

distance = 664
spam score = 79
title = ''

distance = 676
spam score = 85
title = ''

distance = 691
spam score = 93
title = ''

distance = 723
spam score = 83
title = ''

distance = 729
spam score = 78
title = ''

distance = 735
spam score = 78
title = ''

distance = 746
spam score = 73
title = ''

distance = 748
spam score = 71
title = ''

distance = 750
spam score = 60
title = ''

distance = 751
spam score = 78
title = ''

distance = 779
spam score = 76
title = ''

distance = 785
spam score = 76
title = ''

distance = 799
spam score = 71
title = ''

distance = 808
spam score = 70
title = ''

distance = 833
spam score = 80
title = ''

distance = 935
spam score = 83
title = ''

distance = 971
spam score = 30
title = ''

distance = 148
spam score = 80
title = 'knit stuffed animals try handmade'

distance = 158
spam score = 88
title = 'art shrink try handmade'

distance = 159
spam score = 83
title = 'leatherwrapped paper journal try handmade'

distance = 164
spam score = 85
title = 'retro whale try handmade'

distance = 169
spam score = 86
title = 'how to recycle candles try handmade'

distance = 169
spam score = 79
title = 'handmade blogs try handmade'

distance = 171
spam score = 83
title = 'madbird try handmade'

distance = 172
spam score = 80
title = 'woven bead and button rings try handmade'

distance = 186
spam score = 65
title = 'i wish i could fly try handmade'

distance = 187
spam score = 88
title = 'blue sunflower studio try handmade'

distance = 191
spam score = 81
title = 'garden caterpillar try handmade'

distance = 191
spam score = 76
title = 'alternative to fox stole try handmade'

distance = 193
spam score = 74
title = 'abandonded and nearly underwater photographs try handmade'

distance = 196
spam score = 81
title = 'barking bird art try handmade'

distance = 197
spam score = 79
title = 'custom embellished ribbon shoes try handmade'

distance = 203
spam score = 87
title = 'custom leather handbags try handmade'

distance = 206
spam score = 78
title = 'icon no 1 try handmade'

distance = 220
spam score = 83
title = 'aunt bucky try handmade'

distance = 228
spam score = 82
title = 'pimp my swine flu mask try handmade'

distance = 232
spam score = 74
title = 'handmade porcelain objects terra cotta pottery and original slipcast items try handmade'

distance = 245
spam score = 83
title = 'browse try handmade try handmade'

distance = 250
spam score = 82
title = 'prom party or wedding dresses try handmade'

distance = 250
spam score = 85
title = 'fabric pendant necklaces try handmade'

distance = 253
spam score = 82
title = 'fabric storage bins try handmade'

distance = 253
spam score = 84
title = 'shopping bag in moss green corduroy and vintage geometric cotton try handmade'

distance = 253
spam score = 83
title = 'fabric storage bins try handmade'

distance = 255
spam score = 78
title = 'i like robots business card wallet try handmade'

distance = 260
spam score = 77
title = 'upcycled felt zipper brooches try handmade'

distance = 270
spam score = 83
title = 'kiersten essenpreis try handmade'

distance = 270
spam score = 82
title = 'multicolor neck cozy try handmade'

distance = 275
spam score = 81
title = 'frank oberle photo art try handmade'

distance = 282
spam score = 78
title = 'manimina dresses for girls try handmade'

distance = 284
spam score = 79
title = 'halter hotties try handmade'

distance = 290
spam score = 69
title = 'sterling silver and leather cuff try handmade'

distance = 291
spam score = 82
title = 'hand crafted earrings try handmade'

distance = 302
spam score = 76
title = 'tie shirts for boys try handmade'

distance = 306
spam score = 85
title = 'amy l try handmade'

distance = 309
spam score = 83
title = 'permission try handmade'

distance = 312
spam score = 71
title = 'unique wool and textile flower brooches and hair pins try handmade'

distance = 323
spam score = 68
title = 'zoo animal finger puppets try handmade'

distance = 328
spam score = 85
title = 'white earth studio try handmade'

distance = 341
spam score = 81
title = 'upcycled suit coat bags try handmade'

distance = 349
spam score = 84
title = 'anodized aluminum bracelets try handmade'

distance = 350
spam score = 83
title = 'glass mosaic and silver jewelry try handmade'

distance = 352
spam score = 72
title = 'my mustache brings all the girls to the yard try handmade'

distance = 352
spam score = 66
title = 'handmade felt bags and coin purses try handmade'

distance = 361
spam score = 80
title = 'vivid nature watercolors try handmade'

distance = 367
spam score = 76
title = 'soft leather evening bags try handmade'

distance = 372
spam score = 72
title = 'lost in jakarta try handmade'

distance = 374
spam score = 61
title = 'wheel thrown hand painted stoneware bowls try handmade'

distance = 382
spam score = 77
title = 'kim o8217brien try handmade'

distance = 386
spam score = 86
title = 'were you featured here try handmade'

distance = 388
spam score = 75
title = 'baby and child gift guide try handmade'

distance = 406
spam score = 79
title = 'poetry for the eyes8230 try handmade'

distance = 408
spam score = 67
title = 'jewel tone wrapped wire and gemstone jewelry try handmade'

distance = 412
spam score = 64
title = 'san jose california usa try handmade'

distance = 441
spam score = 63
title = 'oxidized sterling silver necklace try handmade'

distance = 449
spam score = 79
title = 'handmade baby rattles try handmade'

distance = 449
spam score = 79
title = 'handmade baby rattles try handmade'

distance = 461
spam score = 81
title = 'rochester new york usa try handmade'

distance = 470
spam score = 67
title = 'handmade paris inspired accessories try handmade'

distance = 479
spam score = 80
title = 'not enough cooks in the kitchen try handmade'

distance = 483
spam score = 77
title = 'product showcase coffee date try handmade'

distance = 489
spam score = 57
title = 'handmade seasonal stockup try handmade'

distance = 490
spam score = 72
title = 'meaningful minimalism try handmade'

distance = 490
spam score = 73
title = 'the upcyclers of etsy try handmade'

distance = 495
spam score = 68
title = 'the garbologist039s wife and her great clothes try handmade'

distance = 497
spam score = 67
title = 'handmade seasonal stockup try handmade'

distance = 499
spam score = 86
title = 'baltimore maryland usa try handmade'

distance = 501
spam score = 82
title = 'rebecca hadfield try handmade'

distance = 511
spam score = 68
title = 'interview with courtney filerdougal of my sunset road try handmade'

distance = 513
spam score = 81
title = 'well suited try handmade'

distance = 515
spam score = 78
title = 'a summer soiree try handmade'

distance = 521
spam score = 77
title = 'handwoven silk cashmere scarves try handmade'

distance = 524
spam score = 80
title = 'handmade black and white valentine8217s day dresses try handmade'

distance = 524
spam score = 54
title = 'barefoot weaver try handmade'

distance = 524
spam score = 71
title = 'ceramic place settings try handmade'

distance = 527
spam score = 51
title = 'screenprinted goodies try handmade'

distance = 531
spam score = 71
title = 'three holiday sweets you can buy not bake try handmade'

distance = 532
spam score = 81
title = 'choosing a new calendar try handmade'

distance = 561
spam score = 63
title = 'diyers in des moines try handmade'

distance = 570
spam score = 86
title = 'handmade with soy try handmade'

distance = 589
spam score = 69
title = 'tuffets from my little big chair try handmade'

distance = 599
spam score = 72
title = 'cafeteria style try handmade'

distance = 636
spam score = 83
title = 'repurposed water bottles become art try handmade'

distance = 640
spam score = 58
title = 'handmade with pet photos try handmade'

distance = 640
spam score = 69
title = 'head out on the highway try handmade'

distance = 645
spam score = 62
title = 'interview with joanne rich from sculpted light try handmade'

distance = 656
spam score = 65
title = 'diy propaganda try handmade'

distance = 662
spam score = 46
title = 'interview with anne cope of mayasmomma039s design studio try handmade'

distance = 692
spam score = 65
title = 'how to shop a farmer039s market try handmade'

distance = 712
spam score = 77
title = 'raise a glass 8211 american craft beer week try handmade'

distance = 715
spam score = 78
title = 'interview with erin bruce of kitty empire try handmade'

distance = 723
spam score = 37
title = 'darling dioramas try handmade'

distance = 747
spam score = 73
title = 'falling for pumpkins try handmade'

distance = 748
spam score = 63
title = 'promoting your handmade products try handmade'

distance = 759
spam score = 61
title = 'dandelions 8211 friend or foe try handmade'

distance = 761
spam score = 63
title = 'ice cube recipes try handmade'

distance = 763
spam score = 55
title = 'about try handmade try handmade'

distance = 781
spam score = 69
title = 'a greener birthday party try handmade'

distance = 877
spam score = 81
title = 'disclosure amp privacy policy try handmade'

distance = 925
spam score = 46
title = 'new in the gallery try handmade'

distance = 948
spam score = 53
title = 'interview with amy turn sharp little alouette try handmade'

distance = 955
spam score = 17
title = 'modern lutheran jello try handmade'

distance = 993
spam score = 27
title = 'happy campers tutorial try handmade'

distance = 1015
spam score = 34
title = 'interview with danielle velentzas of twist 21 try handmade'

distance = 1771
spam score = 42
title = 'hunza lake crisis pakistan politics current affairs chowrangi'

distance = 111
spam score = 65
title = 'good news about the books danny the dragon'

distance = 127
spam score = 70
title = 'illustrations are almost done danny the dragon'

distance = 139
spam score = 67
title = 'final edits danny the dragon'

distance = 140
spam score = 69
title = 'almost time to start editing the text danny the dragon'

distance = 141
spam score = 72
title = 'the danny the dragon website has launched danny the dragon'

distance = 143
spam score = 62
title = 'danny was a big hit danny the dragon'

distance = 151
spam score = 65
title = 'danny the dragon had another successful event in new york danny the dragon'

distance = 152
spam score = 65
title = 'scheduling book readings in the schools danny the dragon'

distance = 156
spam score = 64
title = 'lots of marketing and pr for danny danny the dragon'

distance = 158
spam score = 67
title = 'my concept for the book danny the dragon'

distance = 159
spam score = 68
title = 'it8217s great to be home danny the dragon'

distance = 159
spam score = 70
title = 'the books are beautiful danny the dragon'

distance = 160
spam score = 65
title = 'reviewing the concepts danny the dragon'

distance = 161
spam score = 67
title = 'busy with the development of other projects danny the dragon'

distance = 162
spam score = 73
title = 'the characters have been visualized danny the dragon'

distance = 163
spam score = 63
title = 'looking forward to my la vacation danny the dragon'

distance = 168
spam score = 68
title = 'treatment is written danny the dragon'

distance = 168
spam score = 68
title = 'ready to send the book to press danny the dragon'

distance = 169
spam score = 66
title = 'future plans to visit latvia danny the dragon'

distance = 169
spam score = 72
title = 'haven8217t received the illustrations yet danny the dragon'

distance = 202
spam score = 66
title = 'danny will be in the ny state reading association event danny the dragon'

distance = 205
spam score = 69
title = 'danny the dragon at the london book fair danny the dragon'

distance = 205
spam score = 70
title = 'very busy with the holidays coming around danny the dragon'

distance = 208
spam score = 65
title = 'still looking for an amazing illustrator danny the dragon'

distance = 210
spam score = 70
title = 'back and forth with the printer danny the dragon'

distance = 217
spam score = 73
title = 'glutenfreehelpinfo is up danny the dragon'

distance = 217
spam score = 69
title = 'hard copy illustrations have arrived danny the dragon'

distance = 218
spam score = 66
title = 'glossy or matte danny the dragon'

distance = 220
spam score = 65
title = 'can8217t wait for parents and kids to see this8230 danny the dragon'

distance = 220
spam score = 75
title = 'a plush toy named danny danny the dragon'

distance = 251
spam score = 68
title = 'tina and danny 8211 new members of siba danny the dragon'

distance = 251
spam score = 66
title = 'contest for parentsadults win a set of movie tickets danny the dragon'

distance = 252
spam score = 73
title = 'the websites are going to be incredible danny the dragon'

distance = 253
spam score = 69
title = 'illustrating your childrens book danny the dragon'

distance = 254
spam score = 66
title = 'excited to receive the hard copy illustrations danny the dragon'

distance = 254
spam score = 65
title = 'danny the dragon contest winner of march danny the dragon'

distance = 261
spam score = 70
title = 'it was great at the celiac walk danny the dragon'

distance = 262
spam score = 61
title = 'sesame street character to meet danny the dragon danny the dragon'

distance = 265
spam score = 71
title = 'recipes being well developed danny the dragon'

distance = 272
spam score = 80
title = 'this child loves danny the dragon danny the dragon danny the dragon'

distance = 325
spam score = 77
title = 'danny and i appear in a tampa bay publication dunedin beacon april 2010 danny review compressed danny the dragon'

distance = 325
spam score = 61
title = 'kindergarten teacher interviews tina turbin danny the dragon'

distance = 329
spam score = 54
title = 'danny the dragon contest winner january danny the dragon'

distance = 331
spam score = 68
title = 'sesame street halloween concert 8211 tonight is our big debut danny the dragon'

distance = 332
spam score = 64
title = 'january parent8217s and kid8217s contest danny the dragon'

distance = 332
spam score = 79
title = 'happy family raves about their danny the dragon set mypicturesmon5thsept294 danny the dragon'

distance = 332
spam score = 79
title = 'happy family raves about their danny the dragon set mypicturesmon5thsept291 danny the dragon'

distance = 334
spam score = 63
title = 'author tina turbin in the st petersburg times danny the dragon'

distance = 336
spam score = 77
title = 'study shows friendship may lengthen life danny the dragon'

distance = 339
spam score = 50
title = 'getting the kids to listen danny the dragon'

distance = 394
spam score = 70
title = 'literacy statistics need to be confronted by parents danny the dragon'

distance = 401
spam score = 67
title = 'homeschooler travels 50 states with skateboard and dad danny the dragon'

distance = 402
spam score = 77
title = 'danny the dragon hosts glutenfree cupcake party gf cupcake party danny the dragon'

distance = 407
spam score = 73
title = 'sesame street halloween concert 8211 3 days away danny the dragon'

distance = 417
spam score = 51
title = 'danny the dragon supports the cure danny the dragon'

distance = 418
spam score = 79
title = 'danny the dragon hosts glutenfree cupcake party gf cupcake party danny the dragon'

distance = 419
spam score = 79
title = 'danny the dragon hosts glutenfree cupcake party gf cupcake party flier no date danny the dragon'

distance = 432
spam score = 52
title = 'my book review featured on nikkis hurricane adventure website danny the dragon'

distance = 435
spam score = 57
title = 'my book review featured on nikkis hurricane adventure website danny the dragon'

distance = 437
spam score = 50
title = 'florida association of partners in education 8211 member danny the dragon'

distance = 481
spam score = 58
title = 'tina and danny brighten children8217s lives in palm harbor danny the dragon'

distance = 482
spam score = 56
title = 'get some help mom danny the dragon'

distance = 484
spam score = 60
title = 'turn off the tvtips for families danny the dragon'

distance = 489
spam score = 60
title = 'cupcake party in the taste section of the st pete times danny the dragon'

distance = 491
spam score = 41
title = 'danny the dragon makes the news in iran danny the dragon'

distance = 500
spam score = 48
title = 'shriners hospital of tampa my visit visits reading and creative time with the kids danny the dragon'

distance = 513
spam score = 68
title = 'danny the dragon and me cupcake parties are fun danny the dragon'

distance = 517
spam score = 73
title = 'proceeds from danny the dragon cd support good cause danny the dragon'

distance = 519
spam score = 44
title = 'congratulations letter from carol downing at blossom montessori school for the deaf danny the dragon'

distance = 527
spam score = 63
title = 'staying true to your vision danny the dragon'

distance = 624
spam score = 68
title = 'danny the dragon supports deaf literacy danny the dragon'

distance = 625
spam score = 68
title = 'a mothers role is a valuable asset to our society danny the dragon'

distance = 628
spam score = 59
title = 'fantastic article in newspaper about danny the dragon dvd danny the dragon'

distance = 638
spam score = 67
title = 'some helpful sleep tips danny the dragon'

distance = 649
spam score = 66
title = 'library visits with the kidssome helpful tips danny the dragon'

distance = 653
spam score = 58
title = 'exciting news tina turbin to announce her cause at pasadena city college orchestra concert danny the dragon'

distance = 655
spam score = 67
title = 'children8217s bookwatch remarkably detailed book review of danny the dragon meets jimmy danny the dragon'

distance = 670
spam score = 51
title = 'chatting with the hartford books examiner danny the dragon'

distance = 675
spam score = 88
title = 'buy danny the dragon books now danny the dragon'

distance = 676
spam score = 32
title = 'nikkis hurricane adventure part 1 an amazing story a delightful childrens book an important cause danny the dragon'

distance = 712
spam score = 89
title = 'about danny the dragon author tina turbin danny the dragon'

distance = 713
spam score = 64
title = 'school library journal is raving about danny the dragon danny the dragon'

distance = 714
spam score = 53
title = 'danny the dragon dvd receives accomplished review from midwest book review danny the dragon'

distance = 714
spam score = 82
title = 'danny the dragon awards danny the dragon'

distance = 716
spam score = 90
title = 'contact danny the dragon author tina turbin danny the dragon'

distance = 722
spam score = 55
title = 'i can do anything by the luster family danny the dragon'

distance = 731
spam score = 55
title = 'danny the dragon dvd gets prestigious review danny the dragon'

distance = 734
spam score = 80
title = 'proceeds from danny the dragon cd support good cause danny the dragon'

distance = 736
spam score = 92
title = 'danny the dragon media and events with tina turbin danny the dragon'

distance = 739
spam score = 86
title = 'danny the dragon danny the dragon'

distance = 776
spam score = 39
title = 'grocery shopping for healthy family eating danny the dragon'

distance = 786
spam score = 54
title = 'multi awardwinning children8217s author tina turbin takes first place for best illustrations in prestigious book contest danny the dragon'

distance = 786
spam score = 83
title = 'print calendar danny the dragon'

distance = 788
spam score = 68
title = 'natural remedies for your childs tinnitus danny the dragon'

distance = 805
spam score = 76
title = 'keeping your celiac child safe at school danny the dragon'

distance = 811
spam score = 46
title = 'increased awareness of celiac disease in us brings increased support danny the dragon'

distance = 820
spam score = 45
title = 'read my interview on bfkbookscom danny the dragon'

distance = 828
spam score = 46
title = 'danny the dragon supports celiac awareness danny the dragon'

distance = 842
spam score = 48
title = 'five questions to find celiac disease in children danny the dragon'

distance = 846
spam score = 42
title = 'tea time mixup danny the dragon'

distance = 1138
spam score = 58
title = 'how is sjgrens syndrome diagnosed danny the dragon'

distance = 225
spam score = 64
title = ''

distance = 304
spam score = 58
title = ''

distance = 324
spam score = 57
title = ''

distance = 327
spam score = 48
title = ''

distance = 342
spam score = 57
title = ''

distance = 395
spam score = 48
title = ''

distance = 410
spam score = 51
title = ''

distance = 439
spam score = 84
title = ''

distance = 447
spam score = 47
title = ''

distance = 487
spam score = 69
title = ''

distance = 517
spam score = 57
title = ''

distance = 525
spam score = 60
title = ''

distance = 528
spam score = 34
title = ''

distance = 549
spam score = 85
title = ''

distance = 567
spam score = 60
title = ''

distance = 615
spam score = 56
title = ''

distance = 644
spam score = 59
title = ''

distance = 772
spam score = 52
title = ''

distance = 856
spam score = 27
title = ''

distance = 186
spam score = 90
title = 'broadcasting board of governors statement on media restrictions in azerbaijan'

distance = 191
spam score = 96
title = 'bbg board meeting april 2012'

distance = 195
spam score = 94
title = 'board meeting december 17 2010'

distance = 206
spam score = 94
title = 'board meeting october 12 2010'

distance = 214
spam score = 94
title = 'bbg governance committee meeting february 9'

distance = 216
spam score = 95
title = 'bbg governance committee meeting march 7 and 9'

distance = 223
spam score = 93
title = 'bbg opens board meeting for first time via webcast'

distance = 225
spam score = 89
title = 'bbg 2011 meeting schedule'

distance = 226
spam score = 91
title = 'flooding in pakistan focus of voa8217s south asia division'

distance = 243
spam score = 95
title = 'board meeting january 2011'

distance = 252
spam score = 96
title = 'mission'

distance = 256
spam score = 89
title = 'bbgs 50 million audience increase how and where'

distance = 276
spam score = 94
title = 'videos our people'

distance = 287
spam score = 92
title = 'bbg board meeting march 2012'

distance = 293
spam score = 92
title = 'celebrate 2012 national women8217s history month'

distance = 304
spam score = 96
title = 'awards'

distance = 305
spam score = 90
title = 'radio sawa lands exclusive interview with secretary of state colin l powell'

distance = 320
spam score = 86
title = 'one year after journalist8217s murder still no answers'

distance = 341
spam score = 88
title = 'ambassador stephens named to key dos post'

distance = 343
spam score = 87
title = 'bbcbbg joint protest of threats to the independent media in iran'

distance = 348
spam score = 86
title = 'us senator says georgia8217s future should not be 8216sacrificed for reset8217'

distance = 349
spam score = 93
title = 'board meeting march 2011'

distance = 357
spam score = 90
title = 'broadcasting board of governors meets on october 13'

distance = 357
spam score = 91
title = 'international broadcasters call for action over jamming'

distance = 377
spam score = 96
title = 'town halls and public meetings'

distance = 383
spam score = 86
title = 'rfa in china8217s tibetan regions covering the growing crises'

distance = 383
spam score = 93
title = 'voa lao turns 50'

distance = 383
spam score = 94
title = 'bbg special session february 11'

distance = 390
spam score = 90
title = 'for bbg gov ashe a busy se asia agenda'

distance = 390
spam score = 81
title = 'ocb publishes images from zapata anniversary in cuba'

distance = 396
spam score = 92
title = 'strategy'

distance = 399
spam score = 93
title = 'bbg shortwave sorting the fact from the fiction'

distance = 406
spam score = 91
title = 'radio marti expands its news magazine las noticias como son'

distance = 424
spam score = 82
title = 'an rfa exclusive with yu jie'

distance = 427
spam score = 95
title = 'fy 2012 budget request for the broadcasting board of governors'

distance = 428
spam score = 97
title = 'victor h ashe'

distance = 429
spam score = 98
title = 's enders wimbush'

distance = 430
spam score = 94
title = 'under secretary of state tara sonenshine visits the bbg'

distance = 430
spam score = 92
title = 'richard lobo joins rias berlin commission'

distance = 440
spam score = 87
title = 'rferl correspondent freed from turkmenistan prison'

distance = 444
spam score = 93
title = 'photo gallery voa rfa cover burma8217s historic election'

distance = 452
spam score = 84
title = 'bbg condemns signal interference as rights threat'

distance = 452
spam score = 90
title = 'alhurra interviews george clooney outside the sudanese embassy'

distance = 452
spam score = 92
title = 'ibb director richard lobo sworn in'

distance = 458
spam score = 92
title = 'reportage covers the us withdrawal from iraq'

distance = 461
spam score = 88
title = 'broadcasting board emphasizes prevalence of threats to journalists in pakistan syria and azerbaijan'

distance = 461
spam score = 82
title = 'lynne weil named director of communications and external affairs at bbg'

distance = 462
spam score = 92
title = 'gallup joins bbg to examine media freedom'

distance = 467
spam score = 87
title = 'about'

distance = 469
spam score = 78
title = 'staying ahead of the digital curve us global engagement in the new media era'

distance = 471
spam score = 99
title = 'business'

distance = 472
spam score = 92
title = 'david ensor director of the voice of america'

distance = 473
spam score = 95
title = 'marie skiba lennon chief of staff'

distance = 477
spam score = 92
title = 'a voa exclusive with us ambassador to russia mcfaul'

distance = 477
spam score = 84
title = 'avanza cuba looks at cuban baseballs past present and future'

distance = 481
spam score = 93
title = 'ibb director richard lobo sworn in'

distance = 485
spam score = 89
title = 'ibb director richard m lobo visits overseas broadcast operations'

distance = 491
spam score = 93
title = 'radio free asia commemorates 15 years of broadcasting'

distance = 498
spam score = 85
title = 'cubans respond with enthusiasm to marti listener contest'

distance = 505
spam score = 96
title = 'middle east'

distance = 507
spam score = 94
title = 'gary thatcher director of external liaison'

distance = 508
spam score = 77
title = 'tv mart obtains video of chaviano arrest in cuba'

distance = 514
spam score = 89
title = 'media advisory us international broadcasting experts available for interviewscommentaryanalysis'

distance = 526
spam score = 94
title = 'carlos a garcaprez director office of cuba broadcasting'

distance = 527
spam score = 84
title = 'avanza cuba big help for small business'

distance = 531
spam score = 90
title = 'in prague rferl premiers one day on earth'

distance = 533
spam score = 95
title = 'join the bbg in rededicating the edward r murrow transmitting station'

distance = 536
spam score = 96
title = 'bbg forms commission on innovation'

distance = 537
spam score = 89
title = 'michael lynton becomes the bbgs interim presiding governor'

distance = 540
spam score = 98
title = 'careers'

distance = 545
spam score = 97
title = 'broadcasting standards and principles'

distance = 553
spam score = 95
title = 'steven korn president and chief executive officer rferl'

distance = 554
spam score = 95
title = 'the board'

distance = 558
spam score = 90
title = 'rfe president gedmin meets kazakh pm discusses media freedom'

distance = 561
spam score = 89
title = 'new pressure on jammers of international broadcasts'

distance = 561
spam score = 93
title = 'experts assemble to craft new tools for us international broadcasting'

distance = 562
spam score = 92
title = 'budget request reflects longterm strategy changing media environment'

distance = 565
spam score = 93
title = 'radio free asia launches nightly televised news show in burma'

distance = 570
spam score = 89
title = 'fy 2011 budget request for the broadcasting board of governors'

distance = 586
spam score = 88
title = 'radio free asia launches weekly qampa with aung san suu kyi'

distance = 587
spam score = 96
title = 'doing business with bbg'

distance = 595
spam score = 94
title = 'sec clinton salutes radio sawa on its 10th anniversary'

distance = 609
spam score = 92
title = 'alhurra puts a spotlight on torture in syria'

distance = 615
spam score = 84
title = 'alhurra8217s al youm turns two'

distance = 636
spam score = 97
title = 'richard m lobo ibb director'

distance = 646
spam score = 93
title = 'paul kollmerdorsey deputy general counsel'

distance = 657
spam score = 97
title = 'russian journalist seminar on migration 038 tolerance 8211 april 1013 2012'

distance = 661
spam score = 91
title = 'rferl czech republic announce vaclav havel journalism fellowship'

distance = 691
spam score = 84
title = 'alhurra exclusive with rep james mcgovern'

distance = 703
spam score = 99
title = 'internships'

distance = 709
spam score = 80
title = 'radio and tv mart'

distance = 739
spam score = 97
title = 'organizational chart'

distance = 789
spam score = 71
title = 'bbg broadcasting board of governors page 4'

distance = 789
spam score = 80
title = 'bbg broadcasting board of governors page 3'

distance = 804
spam score = 99
title = 'our broadcasters'

distance = 817
spam score = 94
title = 'international broadcasters call for end of satellite jamming'

distance = 833
spam score = 87
title = 'radio free europeradio liberty'

distance = 855
spam score = 62
title = 'journalism under fire'

distance = 864
spam score = 65
title = 'radio free asia'

distance = 895
spam score = 80
title = 'bbg broadcasting board of governors page 73'

distance = 1023
spam score = 85
title = 'alhurra tv radio sawa'

distance = 53
spam score = 58
title = 'links for 20080630 maxa blog'

distance = 68
spam score = 67
title = 'richfaces article 8211 over 100000 reads maxa blog'

distance = 68
spam score = 64
title = 'links for 20080724 maxa blog'

distance = 82
spam score = 64
title = 'state of richfaces maxa blog'

distance = 82
spam score = 65
title = 'learning jsf 2 series maxa blog'

distance = 84
spam score = 66
title = 'links for 20080122 maxa blog'

distance = 90
spam score = 75
title = 'links for 20080415 maxa blog'

distance = 91
spam score = 65
title = 'what8217s new in jsf 22 maxa blog'

distance = 91
spam score = 67
title = 'dependency injection maxa blog'

distance = 95
spam score = 66
title = 'how many ajax frameworks maxa blog'

distance = 95
spam score = 68
title = 'exadel blog relaunched maxa blog'

distance = 98
spam score = 67
title = 'united 1k many jsfrichfaces trainings maxa blog'

distance = 98
spam score = 63
title = 'exadel studio end of the road maxa blog'

distance = 100
spam score = 70
title = 'exadel tiggr and beautiful richfaces application maxa blog'

distance = 103
spam score = 74
title = 'vote for future richfaces components and see what8217s in the next release maxa blog'

distance = 103
spam score = 64
title = 'new getting started tutorial for tiggr interactive prototypes maxa blog'

distance = 105
spam score = 68
title = 'eclipsecon 2010 review maxa blog'

distance = 106
spam score = 71
title = 'android mcommerce client by exadel maxa blog'

distance = 107
spam score = 75
title = 'i8217m speaking at eclipsecon 2008 maxa blog'

distance = 113
spam score = 62
title = '10 discount for richfaces workshop in germany maxa blog'

distance = 173
spam score = 71
title = 'speaking at the ajax experience 2008 boston maxa blog'

distance = 173
spam score = 65
title = 'theserversidecom reply to java on the client again maxa blog'

distance = 173
spam score = 61
title = 'learn richfaces in 1 day in vienna austria maxa blog'

distance = 173
spam score = 61
title = 'tiggr prototypes update collaboration now works behind firewall maxa blog'

distance = 175
spam score = 67
title = 'richfaces confirmation dialog 8211 complete edition maxa blog'

distance = 177
spam score = 68
title = 'javaone schedule 8211 june 4rd 2009 maxa blog'

distance = 178
spam score = 69
title = 'learning jsf 2 maxa blog'

distance = 178
spam score = 62
title = 'getting started with android tutorial updated maxa blog'

distance = 178
spam score = 68
title = 'javaone presentations maxa blog'

distance = 179
spam score = 66
title = 'opensourcelive jsf and richfaces training in portland maxa blog'

distance = 199
spam score = 67
title = 'mobile apps builder 8211 trial period is now 30 days maxa blog'

distance = 199
spam score = 66
title = 'webinar recording ajax applications with jsf 2 and new richfaces 4 maxa blog'

distance = 200
spam score = 67
title = 'richfaces 4 release plans maxa blog'

distance = 201
spam score = 80
title = 'exadel javafx plugin for eclipse version 124 maxa blog'

distance = 202
spam score = 77
title = 'richfaces 3 to richfaces 4 maxa blog'

distance = 202
spam score = 59
title = 'building mobile apps using cloud services slides maxa blog'

distance = 204
spam score = 66
title = 'ajax4jsfrichfaces presentations at jsfone maxa blog'

distance = 205
spam score = 68
title = 'powering mobile applications with exadel flamingo maxa blog'

distance = 207
spam score = 65
title = 'eclipseworld 2007 november 68th reston va maxa blog'

distance = 207
spam score = 70
title = 'webinar using jsf and flex components together maxa blog'

distance = 236
spam score = 60
title = 'awesome webinar building mobile apps in the cloud with jquery mobile and phonegap maxa blog'

distance = 237
spam score = 42
title = 'how to build a mobile app in the cloud with jquery mobile rest video maxa blog'

distance = 238
spam score = 74
title = 'exadel javafx plugin for eclipse 8211 go to member feature in pictures maxa blog'

distance = 239
spam score = 72
title = 'tiggzi 8211 the cloudbased html5 and hybrid mobile app builder now free maxa blog'

distance = 240
spam score = 67
title = 'recent conferences jbossworld jsfdays08 presentations posted maxa blog'

distance = 241
spam score = 64
title = 'ajax4jsf 8211 techtalk with joseph ottinger from theserversidecom maxa blog'

distance = 242
spam score = 69
title = 'seam hotel booking with javafx maxa blog'

distance = 244
spam score = 77
title = 'javafx plugin for eclipse suggest features try nightly builds maxa blog'

distance = 246
spam score = 66
title = 'fiji is free until december 31 8211 jsf and flex together maxa blog'

distance = 247
spam score = 65
title = 'try this on your mobile phone maxa blog'

distance = 288
spam score = 74
title = 'javafx and cdi at javaone 2010 maxa blog'

distance = 288
spam score = 56
title = 'enterprise javafx with seam and flamingo 8211 complete edition maxa blog'

distance = 292
spam score = 68
title = 'citytech uses exadel flamingo to build javafx dashboard maxa blog'

distance = 294
spam score = 74
title = 'exadel javafx plugin for eclipse version 132 is now available maxa blog'

distance = 295
spam score = 64
title = 'presenting at theserverside java symposium 8211 theclientside maxa blog'

distance = 296
spam score = 61
title = 'exadel flamingo 8211 mobile for iphone and android maxa blog'

distance = 297
spam score = 73
title = 'practical richfaces book 2nd edition is almost finished maxa blog'

distance = 299
spam score = 52
title = 'slides handson with richfaces 8211 javaone 2010 maxa blog'

distance = 300
spam score = 72
title = '1day richfaces workshop in vienna and discount maxa blog'

distance = 300
spam score = 67
title = '12 day richfaces training idea maxa blog'

distance = 347
spam score = 65
title = 'join wac and exadel for a beer at the mobile world congress in barcelona maxa blog'

distance = 347
spam score = 70
title = 'jsf summit 2009 get 200 discount maxa blog'

distance = 348
spam score = 62
title = 'exadel javafx plugin for eclipse version 134 with organize imports maxa blog'

distance = 349
spam score = 72
title = 'exadel javafx plugin for eclipse version 133 maxa blog'

distance = 352
spam score = 60
title = 'tiggzi plugins the prepackaged approach to consuming rest apis in jquery mobile app webinar recording maxa blog'

distance = 358
spam score = 68
title = 'building mobile apps in the cloud at gigaom mobilize maxa blog'

distance = 359
spam score = 70
title = 'handson with richfaces at javaone maxa blog'

distance = 362
spam score = 76
title = 'tiggzi mobile app builder april roadmap ios build jquery mobile and phonegap updates maxa blog'

distance = 365
spam score = 70
title = 'hibernate validator with javafx maxa blog'

distance = 366
spam score = 58
title = 'getting richfaces version in runtime maxa blog'

distance = 431
spam score = 56
title = 'running javafx sdk examples with eclipse maxa blog'

distance = 432
spam score = 69
title = 'what is going to happen with exadel javafx plugin for eclipse maxa blog'

distance = 433
spam score = 68
title = 'exadel flamingo now supports cdi and bean validation for javafx maxa blog'

distance = 433
spam score = 83
title = 'about me maxa blog'

distance = 437
spam score = 57
title = 'richfaces workshop in germany maxa blog'

distance = 445
spam score = 55
title = 'javafx 20 8211 no mac or linux support maxa blog'

distance = 448
spam score = 52
title = 'enterprise mobile for iphone and android webinar maxa blog'

distance = 457
spam score = 56
title = 'visual mapper jquery mobile to rest services maxa blog'

distance = 462
spam score = 58
title = 'going to atampt mobile hackathon and mobile monday multiplatform build tools maxa blog'

distance = 463
spam score = 65
title = 'learn richfaces at confess2011 conference in vienna session workshop maxa blog'

distance = 597
spam score = 51
title = 'why you need interactive and clickable ui prototypes for your next project maxa blog'

distance = 602
spam score = 79
title = 'tiggr html prototypes adds powerful new features eventsactions page templates custom components and annotations maxa blog'

distance = 610
spam score = 77
title = 'introducing tiggr 8211 create and share mockups in real time maxa blog'

distance = 621
spam score = 56
title = 'mapping the tools in the mobile development ecosystem 8211 and how tiggzi mobile app builder fits in maxa blog'

distance = 621
spam score = 80
title = 'jsfrichfaces training maxa blog'

distance = 624
spam score = 74
title = 'tiggr mobile apps builder upgrades with brand new ui new exportbuild for android ios mobile web and much more maxa blog'

distance = 628
spam score = 69
title = 'using richcolorpicker in richfaces maxa blog'

distance = 633
spam score = 76
title = 'practical richfaces book 2nd edition is now available maxa blog'

distance = 666
spam score = 60
title = 'truly rapid mobile apps prototyping with stackmob and tiggr maxa blog'

distance = 681
spam score = 60
title = 'jsf mojarra extension tags 8211 validation focus maxa blog'

distance = 916
spam score = 51
title = 'richfaces builtin sorting 8211 via external contros maxa blog'

distance = 917
spam score = 73
title = 'jbosstools maxa blog'

distance = 922
spam score = 53
title = 'easy start with jboss richfaces maxa blog'

distance = 924
spam score = 73
title = 'book review jsf 20 cookbook maxa blog'

distance = 926
spam score = 35
title = 'richfaces builtin sorting maxa blog'

distance = 932
spam score = 75
title = 'activejdbc new java orm and an activerecord implementation maxa blog'

distance = 936
spam score = 48
title = 'seam conversations from javafx maxa blog'

distance = 944
spam score = 53
title = 'changing richfaces skins in runtime maxa blog'

distance = 952
spam score = 42
title = 'jsf flex and elections 2008 maxa blog'

distance = 966
spam score = 54
title = '2010 august maxa blog'

distance = 1460
spam score = 61
title = 'flamingo maxa blog'

distance = 155
spam score = 93
title = 'researcher involve'

distance = 185
spam score = 91
title = 'involvement involve'

distance = 191
spam score = 93
title = 'journal involve'

distance = 192
spam score = 91
title = 'participant involve'

distance = 217
spam score = 90
title = 'commissioning involve'

distance = 217
spam score = 93
title = 'collaboration involve'

distance = 218
spam score = 93
title = 'research involve'

distance = 224
spam score = 90
title = 'commissioner involve'

distance = 224
spam score = 91
title = 'monitoring research involve'

distance = 225
spam score = 91
title = 'abstract involve'

distance = 227
spam score = 91
title = 'methodology involve'

distance = 228
spam score = 95
title = 'case study 2 involve'

distance = 229
spam score = 91
title = 'data involve'

distance = 229
spam score = 90
title = 'research proposal involve'

distance = 235
spam score = 95
title = 'case study 1 involve'

distance = 238
spam score = 91
title = 'research partner involve'

distance = 239
spam score = 91
title = 'questionnaire involve'

distance = 245
spam score = 93
title = 'intervention involve'

distance = 254
spam score = 95
title = 'how we work involve'

distance = 256
spam score = 94
title = 'dissemination involve'

distance = 299
spam score = 94
title = 'jo ellins involve'

distance = 299
spam score = 92
title = 'ethics involve'

distance = 301
spam score = 94
title = 'veronica swallow involve'

distance = 301
spam score = 94
title = 'involve group minutes may 2011 involve'

distance = 302
spam score = 94
title = 'involve group minutes october 2006 involve'

distance = 302
spam score = 91
title = 'clinical research involve'

distance = 303
spam score = 89
title = 'public health research involve'

distance = 307
spam score = 94
title = 'participatory research involve'

distance = 307
spam score = 95
title = 'tara mistry involve'

distance = 307
spam score = 92
title = 'lay lay person involve'

distance = 328
spam score = 94
title = 'action research involve'

distance = 329
spam score = 96
title = 'accessibility involve'

distance = 335
spam score = 92
title = 'my clippings involve'

distance = 338
spam score = 94
title = 'my clippings involve'

distance = 339
spam score = 92
title = 'audit involve'

distance = 341
spam score = 96
title = 'not if but when involve'

distance = 342
spam score = 93
title = 'lost password involve'

distance = 343
spam score = 96
title = 'contact us involve'

distance = 346
spam score = 92
title = 'commissioning board commissioning panel involve'

distance = 348
spam score = 96
title = 'research network involve'

distance = 385
spam score = 92
title = 'new book critical perspectives on user involvement involve'

distance = 388
spam score = 89
title = 'outcome measures involve'

distance = 388
spam score = 95
title = 'richard baker strategic alliances involve'

distance = 391
spam score = 92
title = 'evidence base involve'

distance = 391
spam score = 90
title = 'information for researchers involve'

distance = 395
spam score = 97
title = 'david evans empowerment involve'

distance = 396
spam score = 97
title = 'pam carter involve'

distance = 397
spam score = 91
title = 'honorary contract involve'

distance = 397
spam score = 91
title = 'placebo involve'

distance = 399
spam score = 97
title = 'poonam jain empowerment involve'

distance = 437
spam score = 95
title = 'sarah howlett involve'

distance = 445
spam score = 95
title = 'sarah bayliss involve'

distance = 445
spam score = 92
title = 'user controlled research user led research involve'

distance = 446
spam score = 94
title = 'involve people as early as possible involve'

distance = 449
spam score = 96
title = 'lucy simons involve'

distance = 452
spam score = 97
title = 'helen hayes involve'

distance = 452
spam score = 93
title = 'new handbook of user involvement in nursing and healthcare research involve'

distance = 452
spam score = 98
title = 'mark petticrew empowerment involve'

distance = 452
spam score = 97
title = 'hugh mclaughlin empowerment involve'

distance = 455
spam score = 94
title = 'statistics and statistical analysis involve'

distance = 482
spam score = 93
title = 'find out more involve'

distance = 486
spam score = 91
title = 'an evaluation of service user involvement in studies adopted by the mental health research network involve'

distance = 487
spam score = 97
title = 'ray fitzpatrick evidence knowledge and learning involve'

distance = 491
spam score = 97
title = 'sarah buckland involve'

distance = 496
spam score = 97
title = 'christine vial empowerment involve'

distance = 499
spam score = 91
title = 'randomised controlled trial involve'

distance = 500
spam score = 98
title = 'patsy staddon empowerment involve'

distance = 503
spam score = 96
title = 'involve involve supporting public involvement in nhs public health and social care research'

distance = 503
spam score = 96
title = 'involve involve supporting public involvement in nhs public health and social care research'

distance = 504
spam score = 97
title = 'diana rose evidence knowledge and learning involve'

distance = 538
spam score = 96
title = 'vanessa pinfold evidence knowledge and learning involve'

distance = 538
spam score = 95
title = 'jim elliott evidence knowledge and learning involve'

distance = 539
spam score = 98
title = 'stuart eglin strategic alliances involve'

distance = 543
spam score = 93
title = 'autumn 2011 involve'

distance = 544
spam score = 93
title = 'involve involve supporting public involvement in nhs public health and social care research'

distance = 546
spam score = 97
title = 'simon denegri chair involve'

distance = 547
spam score = 95
title = 'contribute to the newsletter involve'

distance = 552
spam score = 94
title = 'winter 201011 involve'

distance = 555
spam score = 96
title = 'loucamai brady evidence knowledge and learning involve'

distance = 556
spam score = 96
title = 'summer 2010 involve'

distance = 583
spam score = 94
title = 'involving marginalised and vulnerable people in research involve'

distance = 586
spam score = 86
title = 'user controlled research involve'

distance = 587
spam score = 97
title = 'peter fleischmann observer involve'

distance = 590
spam score = 96
title = 'briefing note seven collaboration involve'

distance = 593
spam score = 93
title = 'changing our worlds summary report involve'

distance = 596
spam score = 95
title = 'briefing note five offer training and support involve'

distance = 601
spam score = 93
title = 'autumn 2008 8211 conference edition involve'

distance = 602
spam score = 96
title = 'nihr public health research programme involve'

distance = 604
spam score = 93
title = 'public involvement in research applications to the national research ethics service nres involve'

distance = 607
spam score = 94
title = 'briefing note seven user controlled research involve'

distance = 678
spam score = 94
title = 'child surveillance unit publishes a review of patient and public involvement involve'

distance = 679
spam score = 96
title = 'partnership gives a voice to pressure ulcer patients involve'

distance = 686
spam score = 97
title = 'involve members involve part 8'

distance = 688
spam score = 94
title = 'briefing note five clarify organisational responsibilities involve'

distance = 691
spam score = 88
title = 'frequently asked questions involve'

distance = 696
spam score = 90
title = 'frequently asked questions involve'

distance = 705
spam score = 96
title = 'briefing note seven consultation involve'

distance = 714
spam score = 96
title = 'models for learning making learning work in a diverse group of research projects involve'

distance = 725
spam score = 89
title = 'interested in getting involved involve'

distance = 733
spam score = 97
title = 'involve members involve part 6'

distance = 963
spam score = 90
title = 'involve documents involve'

distance = 1076
spam score = 83
title = 'publications by involve involve'

distance = 1368
spam score = 20
title = 'contact us skechers outlet'

distance = 1689
spam score = 74
title = 'ipsos mori poll public attitudes to science 2011'

distance = 1760
spam score = 93
title = 'atsea mortality of seabirds based on beachcast and offshore surveys'

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 69
title = ''

distance = 1
spam score = 69
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 69
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 69
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 69
title = ''

distance = 1
spam score = 70
title = ''

distance = 1
spam score = 70
title = ''

distance = 2
spam score = 70
title = ''

distance = 3
spam score = 69
title = ''

distance = 3
spam score = 69
title = ''

distance = 4
spam score = 70
title = ''

distance = 4
spam score = 70
title = ''

distance = 4
spam score = 70
title = ''

distance = 4
spam score = 69
title = ''

distance = 5
spam score = 69
title = ''

distance = 5
spam score = 70
title = ''

distance = 5
spam score = 70
title = ''

distance = 5
spam score = 69
title = ''

distance = 5
spam score = 69
title = ''

distance = 7
spam score = 70
title = ''

distance = 7
spam score = 70
title = ''

distance = 7
spam score = 70
title = ''

distance = 11
spam score = 70
title = ''

distance = 16
spam score = 70
title = ''

distance = 46
spam score = 70
title = ''

distance = 666
spam score = 81
title = ''

distance = 667
spam score = 77
title = ''

distance = 699
spam score = 83
title = ''

distance = 709
spam score = 79
title = ''

distance = 725
spam score = 75
title = ''

distance = 745
spam score = 75
title = ''

distance = 757
spam score = 80
title = ''

distance = 964
spam score = 16
title = ''

distance = 982
spam score = 84
title = ''

distance = 1011
spam score = 86
title = ''

distance = 1014
spam score = 81
title = ''

distance = 1025
spam score = 89
title = ''

distance = 1032
spam score = 20
title = ''

distance = 1127
spam score = 77
title = ''

distance = 1134
spam score = 27
title = ''

distance = 1170
spam score = 67
title = ''

distance = 161
spam score = 81
title = ''

distance = 206
spam score = 84
title = ''

distance = 243
spam score = 76
title = ''

distance = 272
spam score = 75
title = ''

distance = 275
spam score = 83
title = ''

distance = 280
spam score = 81
title = ''

distance = 324
spam score = 80
title = ''

distance = 338
spam score = 76
title = ''

distance = 342
spam score = 69
title = ''

distance = 345
spam score = 79
title = ''

distance = 356
spam score = 73
title = ''

distance = 358
spam score = 75
title = ''

distance = 361
spam score = 77
title = ''

distance = 366
spam score = 84
title = ''

distance = 367
spam score = 81
title = ''

distance = 381
spam score = 75
title = ''

distance = 384
spam score = 83
title = ''

distance = 408
spam score = 87
title = ''

distance = 408
spam score = 73
title = ''

distance = 417
spam score = 86
title = ''

distance = 417
spam score = 73
title = ''

distance = 420
spam score = 75
title = ''

distance = 423
spam score = 71
title = ''

distance = 428
spam score = 72
title = ''

distance = 432
spam score = 80
title = ''

distance = 438
spam score = 84
title = ''

distance = 445
spam score = 78
title = ''

distance = 451
spam score = 76
title = ''

distance = 454
spam score = 68
title = ''

distance = 455
spam score = 77
title = ''

distance = 463
spam score = 75
title = ''

distance = 464
spam score = 77
title = ''

distance = 466
spam score = 75
title = ''

distance = 466
spam score = 75
title = ''

distance = 466
spam score = 77
title = ''

distance = 476
spam score = 81
title = ''

distance = 478
spam score = 80
title = ''

distance = 479
spam score = 85
title = ''

distance = 481
spam score = 76
title = ''

distance = 485
spam score = 72
title = ''

distance = 486
spam score = 73
title = ''

distance = 486
spam score = 82
title = ''

distance = 490
spam score = 69
title = ''

distance = 493
spam score = 68
title = ''

distance = 503
spam score = 73
title = ''

distance = 515
spam score = 67
title = ''

distance = 517
spam score = 73
title = ''

distance = 521
spam score = 75
title = ''

distance = 521
spam score = 80
title = ''

distance = 521
spam score = 79
title = ''

distance = 525
spam score = 73
title = ''

distance = 527
spam score = 71
title = ''

distance = 530
spam score = 77
title = ''

distance = 533
spam score = 72
title = ''

distance = 536
spam score = 76
title = ''

distance = 554
spam score = 84
title = ''

distance = 560
spam score = 83
title = ''

distance = 563
spam score = 78
title = ''

distance = 567
spam score = 77
title = ''

distance = 578
spam score = 69
title = ''

distance = 583
spam score = 77
title = ''

distance = 591
spam score = 80
title = ''

distance = 598
spam score = 89
title = ''

distance = 599
spam score = 65
title = ''

distance = 603
spam score = 79
title = ''

distance = 614
spam score = 58
title = ''

distance = 632
spam score = 72
title = ''

distance = 636
spam score = 79
title = ''

distance = 637
spam score = 78
title = ''

distance = 644
spam score = 76
title = ''

distance = 654
spam score = 70
title = ''

distance = 654
spam score = 78
title = ''

distance = 674
spam score = 81
title = ''

distance = 680
spam score = 76
title = ''

distance = 707
spam score = 88
title = ''

distance = 808
spam score = 77
title = ''

distance = 819
spam score = 78
title = ''

distance = 835
spam score = 78
title = ''

distance = 995
spam score = 95
title = ''

distance = 82
spam score = 78
title = 'wine bike tour 038 wine pleasures in the high peneds 43 winepleasurescom'

distance = 82
spam score = 77
title = 'wine bike tour 038 wine pleasures in the high peneds 43 winepleasurescom'

distance = 110
spam score = 75
title = 'how to start andor increase wine exports to china wine pleasures in chinese winepleasurescom'

distance = 114
spam score = 78
title = 'wine producers 8220don8217t let your ego get in the way of reasonable pricing8221 speciality wine cellars at wine pleasures winepleasurescom'

distance = 117
spam score = 81
title = 'wine tasting tours in catalonia8217s cava region spain horse winepleasurescom'

distance = 117
spam score = 81
title = 'wine tasting tours in catalonia8217s cava region spain horse winepleasurescom'

distance = 125
spam score = 80
title = 'grape escape portugal 7th annual wine pleasures fam trip 038 workshop wine tourism workshop 2010 winepleasurescom'

distance = 129
spam score = 77
title = 'wine bike tour 038 wine pleasures in the high peneds foto20 winepleasurescom'

distance = 129
spam score = 78
title = 'wine bike tour 038 wine pleasures in the high peneds foto16 winepleasurescom'

distance = 129
spam score = 77
title = 'wine bike tour 038 wine pleasures in the high peneds foto16 winepleasurescom'

distance = 129
spam score = 77
title = 'wine bike tour 038 wine pleasures in the high peneds foto16 winepleasurescom'

distance = 142
spam score = 78
title = 'wine bike tour 038 wine pleasures in the high peneds rentadors winepleasurescom'

distance = 142
spam score = 77
title = 'wine bike tour 038 wine pleasures in the high peneds rentadors winepleasurescom'

distance = 144
spam score = 81
title = 'vijazz vilafranca del peneds wine 038 jazz festival street jazz band winepleasurescom'

distance = 145
spam score = 79
title = 'conference preview 2nd wine pleasures annual international wine tourism conference now available wine travel spain winepleasurescom'

distance = 147
spam score = 79
title = 'wine bike tour 038 wine pleasures in the high peneds wine amp bike web winepleasurescom'

distance = 159
spam score = 79
title = 'finca mas rod wine pleasuressummer visit to a young winery with a lot of potential mas rodo5 winepleasurescom'

distance = 159
spam score = 79
title = 'finca mas rod wine pleasuressummer visit to a young winery with a lot of potential mas rodo2 winepleasurescom'

distance = 159
spam score = 79
title = 'finca mas rod wine pleasuressummer visit to a young winery with a lot of potential mas rodo5 winepleasurescom'

distance = 159
spam score = 78
title = 'finca mas rod wine pleasuressummer visit to a young winery with a lot of potential mas rodo1 winepleasurescom'

distance = 190
spam score = 81
title = 'winelands portugal 8211 a new concept for wine tourism susanna tocca at wine pleasures winepleasurescom'

distance = 195
spam score = 80
title = 'vijazz vilafranca del peneds wine 038 jazz festival logo vijazz winepleasurescom'

distance = 195
spam score = 78
title = 'porto to host 2011 wine pleasures international wine tourism conference 038 workshop porto 2011 wine pleasures wine tourism workshop venue winepleasurescom'

distance = 199
spam score = 79
title = 'buyer meets catalonian cellar catalonia wheres that winepleasurescom'

distance = 200
spam score = 77
title = 'los placeres del vino zarpa a italia international wine tourism ready for italy winepleasurescom'

distance = 206
spam score = 75
title = 'day 1 of the 3rd international wine tourism conference 2011 michael oudyn with pinky winepleasurescom'

distance = 208
spam score = 79
title = 'vijazz vilafranca del peneds wine 038 jazz festival gente vijazz winepleasurescom'

distance = 213
spam score = 77
title = 'wine pleasures teams up with catavins to create buyer meets catalonian cellar reverse trade mission to spain winepleasurescom'

distance = 214
spam score = 77
title = 'es buyer meets spanish cellar 2011 wine import export winepleasurescom'

distance = 226
spam score = 77
title = 'iberian fine wine collections massachusetts bound fine wines buyer meets iberian cellar winepleasurescom'

distance = 239
spam score = 74
title = 'reverse trade mission 2012 wine pleasures workshop winepleasurescom'

distance = 239
spam score = 74
title = 'reverse trade mission 2012 wine pleasures workshops winepleasurescom'

distance = 240
spam score = 76
title = 'buyer meets iberian cellar 2012 wine pleasures workshop winepleasurescom'

distance = 251
spam score = 77
title = 'reverse trade mission 2012 wine importers at wine pleasures winepleasurescom'

distance = 271
spam score = 77
title = 'mas beltran balma winepleasurescom'

distance = 272
spam score = 80
title = 'buyer meets catalonian cellar bodegas pinord at wine pleasures 2010 winepleasurescom'

distance = 283
spam score = 72
title = 'cmo captar ms clientes utilizando las redes sociales exportar vinos a china winepleasurescom'

distance = 289
spam score = 77
title = 'reverse trade mission 2012 cava at wine pleasures winepleasurescom'

distance = 320
spam score = 78
title = 'what8217s cooking chef chef rui paula teams up with chef holli ugalde winepleasurescom'

distance = 320
spam score = 78
title = 'boutique vinho verde producers get thumbs up from bloggers 038 media blogger fam trip wine tourism vinho verde winepleasurescom'

distance = 357
spam score = 74
title = 'reverse trade mission 2012 wine pleasures reverse trade mission winepleasurescom'

distance = 357
spam score = 75
title = 'reverse trade mission 2012 wine pleasures reverse trade mission winepleasurescom'

distance = 371
spam score = 78
title = 'reverse trade mission 2012 wine pleasures reverse trade mission to spain winepleasurescom'

distance = 381
spam score = 69
title = 'adeus portugal people amp places 2011 international wine tourism conference winepleasurescom'

distance = 385
spam score = 88
title = 'buyer meets cellar winepleasurescom'

distance = 393
spam score = 78
title = 'the surprising diversity of iberian wines winepleasurescom'

distance = 398
spam score = 78
title = 'social media group for the wine pleasures wine tourism conference amp workshop now available winepleasurescom'

distance = 419
spam score = 69
title = 'reign with spain winepleasurescom'

distance = 424
spam score = 81
title = 'coming up wine pleasures workshop buyer meets iberian cellar winepleasurescom'

distance = 425
spam score = 61
title = 'live streaming celebrity wine review tv leveraging social media to engage online audiences and share our passion for wine winepleasurescom'

distance = 515
spam score = 63
title = 'cw selection aims to sparkle us wine lovers winepleasurescom'

distance = 520
spam score = 69
title = 'wine pleasures workshop buyer meets italian cellar 2010 winepleasurescom'

distance = 521
spam score = 81
title = 'importadores workshop spanish cellar 2011 winepleasurescom'

distance = 524
spam score = 75
title = 'wine producers 8220don8217t let your ego get in the way of reasonable pricing8221 winepleasurescom'

distance = 528
spam score = 77
title = 'buyer meets iberian cellar 2012 winepleasurescom'

distance = 528
spam score = 84
title = 'conference preview 2nd wine pleasures annual international wine tourism conference now available winepleasurescom'

distance = 538
spam score = 67
title = 'enrico pieranunzi amp cava 8211 a match made in sensory heaven winepleasurescom'

distance = 552
spam score = 74
title = 'diy wine travel 8211 winelands of portugal winepleasurescom'

distance = 555
spam score = 61
title = 'rioja ice wine attracts aliens from outer space winepleasurescom'

distance = 568
spam score = 67
title = 'south american wine importers cross the atlantic for spanish wines winepleasurescom'

distance = 585
spam score = 78
title = 'bordeaux peybonhomme went organic after apocalyptic night winepleasurescom'

distance = 591
spam score = 73
title = 'tall order exporting wines to india winepleasurescom'

distance = 591
spam score = 77
title = 'blogging and social media for wineries winepleasurescom'

distance = 592
spam score = 84
title = 'wine pleasures wine tourism preview conference programme released winepleasurescom'

distance = 597
spam score = 83
title = 'selected wineries an innovative approach for the portuguese market winepleasurescom'

distance = 609
spam score = 86
title = 'mas passamaner rings wedding bells for spanish wine lovers winepleasurescom'

distance = 610
spam score = 68
title = 'only the best terroirs for toronto based wine importer winepleasurescom'

distance = 612
spam score = 71
title = 'catalonia 8211 where8217s that winepleasurescom'

distance = 623
spam score = 80
title = 'wine travel spain plenary session by rainer brusis winepleasurescom'

distance = 624
spam score = 66
title = 'birthday bike tour through the hillsides of the penedes winepleasurescom'

distance = 649
spam score = 63
title = 'iberian fine wine collections massachusetts bound winepleasurescom'

distance = 652
spam score = 85
title = 'graphic art meets spanish wine at ferr i catass winepleasurescom'

distance = 654
spam score = 77
title = 'canals i munn sparkles in ebook 50 great cavas winepleasurescom'

distance = 655
spam score = 50
title = 'wine travel bloggers hunt for white deer winepleasurescom'

distance = 655
spam score = 54
title = 'what8217s cooking chef winepleasurescom'

distance = 655
spam score = 82
title = 'organic viticulture in the comunidad of valenciana winepleasurescom'

distance = 657
spam score = 80
title = 'life on the downhillbiking through wine country in the penedes winepleasurescom'

distance = 662
spam score = 91
title = 'international wine tourism conference amp workshop in sitges winepleasurescom'

distance = 664
spam score = 73
title = 'is it all just exam technique to become a master of wine winepleasurescom'

distance = 668
spam score = 81
title = 'grape escape portugal 7th annual wine pleasures fam trip amp workshop winepleasurescom'

distance = 690
spam score = 75
title = 'quality spanish wine lacking in lithuania winepleasurescom'

distance = 692
spam score = 73
title = 'marble hill cellars pays no attention to wine scores winepleasurescom'

distance = 693
spam score = 66
title = 'domaine bassac luckily avoid buying coca cola factory winepleasurescom'

distance = 694
spam score = 61
title = 'cycling spain8217s cava amp peneds wine regions winepleasurescom'

distance = 697
spam score = 87
title = 'learning about spanish wine in a cave at felix massana winepleasurescom'

distance = 704
spam score = 84
title = 'vins mussons from priorat8217s stairway to heaven winepleasurescom'

distance = 707
spam score = 78
title = 'cava amp peneds bike tour delights iowa family amp friends winepleasurescom'

distance = 708
spam score = 64
title = 'paul is clear when it comes to importing spanish wine to the usa winepleasurescom'

distance = 722
spam score = 84
title = 'workshop wine tourism grow wine sales for jmiquel jan winepleasurescom'

distance = 730
spam score = 89
title = 'wine bike tour amp wine pleasures in the high peneds winepleasurescom'

distance = 749
spam score = 88
title = 'spanish wine bike tour to peneds jmiquel jan winepleasurescom'

distance = 762
spam score = 82
title = 'wine tasting improves student8217s spanish fluency winepleasurescom'

distance = 763
spam score = 62
title = 'thinking spanish wine amp tapas in the philippines think barcino winepleasurescom'

distance = 763
spam score = 86
title = 'it8217s tough at the top8230of conca de barber winepleasurescom'

distance = 770
spam score = 79
title = 'new world wine tourism streets ahead of the old world winepleasurescom'

distance = 773
spam score = 75
title = 'douro quinta to bring 8220freshness8221 to wine pleasures workshop winepleasurescom'

distance = 777
spam score = 91
title = 'belgium a split nation when it comes to wine drinking winepleasurescom'

distance = 794
spam score = 70
title = 'celebrity desire anderson enhances spanish wine exposure worldwide winepleasurescom'

distance = 800
spam score = 80
title = 'shellseekers in search of grape escapes in portugal winepleasurescom'

distance = 808
spam score = 93
title = 'vintesa consorzio includes la luna del rospo 8211 loacker 8211 punset 8211 fasoli gino 8211 antica entoria wine pleasures international organic workshop winepleasurescom'

distance = 928
spam score = 91
title = 'a tribute to the spanish summer peach winepleasurescom'

distance = 1028
spam score = 88
title = 'fam trip for agents winepleasurescom'

distance = 123
spam score = 91
title = 'project on middle east democracy pomed'

distance = 136
spam score = 90
title = 'georgia on their mind project on middle east democracy pomed'

distance = 147
spam score = 90
title = '8220who throws a shoe8230honestly8221 project on middle east democracy pomed'

distance = 147
spam score = 90
title = '8220who throws a shoe8230honestly8221 project on middle east democracy pomed'

distance = 148
spam score = 94
title = 'project on middle east democracy pomed'

distance = 161
spam score = 92
title = 'the day after8230 project on middle east democracy pomed'

distance = 161
spam score = 91
title = 'the day after8230 project on middle east democracy pomed'

distance = 163
spam score = 95
title = 'photo wsj8217s alex delmarmorgan arrested in bahrain project on middle east democracy pomed'

distance = 163
spam score = 95
title = 'photo wsj8217s alex delmarmorgan arrested in bahrain project on middle east democracy pomed'

distance = 168
spam score = 93
title = '8220the problem is not diplomacy rather it is inattention to timing8221 project on middle east democracy pomed'

distance = 177
spam score = 92
title = 'project on middle east democracy pomed'

distance = 179
spam score = 94
title = 'advice for the new president project on middle east democracy pomed'

distance = 186
spam score = 90
title = 'obama prays for egypt project on middle east democracy pomed'

distance = 196
spam score = 95
title = 'project on middle east democracy pomed'

distance = 199
spam score = 89
title = 'winning hearts and minds project on middle east democracy pomed'

distance = 199
spam score = 93
title = 'bahrain update journalists refused entry expelled project on middle east democracy pomed'

distance = 199
spam score = 95
title = 'ifes publishes tunisian election resource project on middle east democracy pomed'

distance = 201
spam score = 86
title = 'transitioning authority in iraq project on middle east democracy pomed'

distance = 201
spam score = 94
title = 'gordon brown on democracy promotion project on middle east democracy pomed'

distance = 201
spam score = 87
title = 'transitioning authority in iraq project on middle east democracy pomed'

distance = 311
spam score = 94
title = 'turkey iran and the west project on middle east democracy pomed'

distance = 311
spam score = 92
title = 'pillay bahrain has not punished security forces project on middle east democracy pomed'

distance = 311
spam score = 93
title = 'pillay bahrain has not punished security forces project on middle east democracy pomed'

distance = 311
spam score = 95
title = 'the next step for lebanon project on middle east democracy pomed'

distance = 311
spam score = 93
title = 'civil society and democratization in qatar project on middle east democracy pomed'

distance = 312
spam score = 86
title = 'france suspects manipulation in journalists8217death project on middle east democracy pomed'

distance = 312
spam score = 93
title = 'iraq almaliki threatens powersharing government project on middle east democracy pomed'

distance = 313
spam score = 94
title = 'pomed notes 8220the challenge of moderation in islam egypt8217s religious institution versus extremism8221 project on middle east democracy pomed'

distance = 313
spam score = 97
title = 'bahrain military trials continue in reversal of regime8217s promise project on middle east democracy pomed'

distance = 313
spam score = 94
title = 'pomed notes 8220the challenge of moderation in islam egypt8217s religious institution versus extremism8221 project on middle east democracy pomed'

distance = 353
spam score = 83
title = 'kuwait candidates disqualified from february elections project on middle east democracy pomed'

distance = 353
spam score = 95
title = 'will hariri tribunal be undermined by realpolitik considerations project on middle east democracy pomed'

distance = 353
spam score = 95
title = 'will hariri tribunal be undermined by realpolitik considerations project on middle east democracy pomed'

distance = 354
spam score = 86
title = 'morocco celebrates arab spring anniversary project on middle east democracy pomed'

distance = 355
spam score = 92
title = 'simultaneous withdrawal and crackdown in syria project on middle east democracy pomed'

distance = 355
spam score = 93
title = 'simultaneous withdrawal and crackdown in syria project on middle east democracy pomed'

distance = 355
spam score = 92
title = 'egypt international ngo conference shut down by security services project on middle east democracy pomed'

distance = 356
spam score = 94
title = 'new pomed policy brief confronting egypt8217s dangerous decline project on middle east democracy pomed'

distance = 356
spam score = 95
title = 'new pomed policy brief confronting egypt8217s dangerous decline project on middle east democracy pomed'

distance = 359
spam score = 93
title = 'bahrain un shows concern over human rights violations project on middle east democracy pomed'

distance = 392
spam score = 92
title = 'egypt recent freedom of expression and human rights violations project on middle east democracy pomed'

distance = 394
spam score = 88
title = 'bahrain white house 8220deeply concerned8221 mentions alkhawaja by name project on middle east democracy pomed'

distance = 395
spam score = 83
title = 'condemnation of syrian brutality by qatar and kuwait project on middle east democracy pomed'

distance = 399
spam score = 92
title = 'bahrain arms sale scrutinized in press briefing project on middle east democracy pomed'

distance = 399
spam score = 86
title = 'weekly wire 8211 april 9 project on middle east democracy pomed'

distance = 399
spam score = 88
title = 'obama and cameron united on iran project on middle east democracy pomed'

distance = 399
spam score = 85
title = 'weekly wire 8211 april 9 project on middle east democracy pomed'

distance = 401
spam score = 93
title = 'congressmen urge ngo access fundamental freedoms in bahrain project on middle east democracy pomed'

distance = 403
spam score = 84
title = 'yemen holds elections amid protests and violence project on middle east democracy pomed'

distance = 403
spam score = 83
title = 'yemen holds elections amid protests and violence project on middle east democracy pomed'

distance = 428
spam score = 84
title = 'twoyear sentence for burning king8217s picture project on middle east democracy pomed'

distance = 428
spam score = 83
title = 'twoyear sentence for burning king8217s picture project on middle east democracy pomed'

distance = 429
spam score = 90
title = 'saudi arabia cracks down on human rights defenders project on middle east democracy pomed'

distance = 429
spam score = 90
title = 'saudi arabia cracks down on human rights defenders project on middle east democracy pomed'

distance = 429
spam score = 90
title = 'saudi arabia cracks down on human rights defenders project on middle east democracy pomed'

distance = 433
spam score = 94
title = 'steven cook 8220istanbul on the nile8221 project on middle east democracy pomed'

distance = 433
spam score = 88
title = 'jordan new cyber crime law a tool for repression project on middle east democracy pomed'

distance = 433
spam score = 95
title = 'gabriel 8220change reform and progress in morocco8221 project on middle east democracy pomed'

distance = 433
spam score = 88
title = 'jordan new cyber crime law a tool for repression project on middle east democracy pomed'

distance = 433
spam score = 95
title = 'steven cook 8220istanbul on the nile8221 project on middle east democracy pomed'

distance = 456
spam score = 89
title = 'un security council votes on sending observers to syria project on middle east democracy pomed'

distance = 463
spam score = 94
title = 'libyan draft constitutional charter project on middle east democracy pomed'

distance = 463
spam score = 94
title = 'libyan draft constitutional charter project on middle east democracy pomed'

distance = 464
spam score = 95
title = 'state department and usaid release fy 2013 budget project on middle east democracy pomed'

distance = 465
spam score = 94
title = 'state department and usaid release fy 2013 budget project on middle east democracy pomed'

distance = 467
spam score = 92
title = 'sunni youth group protests against dialogue in bahrain project on middle east democracy pomed'

distance = 467
spam score = 93
title = 'sunni youth group protests against dialogue in bahrain project on middle east democracy pomed'

distance = 468
spam score = 87
title = '3 years in jail for insult to king in morocco project on middle east democracy pomed'

distance = 468
spam score = 86
title = '3 years in jail for insult to king in morocco project on middle east democracy pomed'

distance = 469
spam score = 89
title = 'activists call for massive protests in tahrir muslim brotherhood elections project on middle east democracy pomed'

distance = 494
spam score = 89
title = 'eight american ngos refused licenses in egypt project on middle east democracy pomed'

distance = 495
spam score = 87
title = 'egyptian minister us funded ngos to undermine egypt project on middle east democracy pomed'

distance = 495
spam score = 97
title = 'more than rhetorical support needed for democracy project on middle east democracy pomed'

distance = 495
spam score = 97
title = 'more than rhetorical support needed for democracy project on middle east democracy pomed'

distance = 496
spam score = 79
title = 'kuwait parliament provisionally passes death penalty for blasphemy project on middle east democracy pomed'

distance = 496
spam score = 78
title = 'kuwait parliament provisionally passes death penalty for blasphemy project on middle east democracy pomed'

distance = 496
spam score = 79
title = 'kuwait parliament provisionally passes death penalty for blasphemy project on middle east democracy pomed'

distance = 496
spam score = 85
title = 'mosley f1 will become bahrain government8217s 8220instrument of repression8221 project on middle east democracy pomed'

distance = 496
spam score = 84
title = 'mosley f1 will become bahrain government8217s 8220instrument of repression8221 project on middle east democracy pomed'

distance = 498
spam score = 82
title = 'yemen8217s army purged of saleh loyalists project on middle east democracy pomed'

distance = 530
spam score = 88
title = 'bahrain receives us congressional delegation project on middle east democracy pomed'

distance = 546
spam score = 95
title = 'the future of the libyan muslim brotherhood project on middle east democracy pomed'

distance = 551
spam score = 92
title = 'approaching algerian elections raises questions about islamists project on middle east democracy pomed'

distance = 551
spam score = 92
title = 'approaching algerian elections raises questions about islamists project on middle east democracy pomed'

distance = 555
spam score = 93
title = 'dc lobbying firm contracts with libyan rebels project on middle east democracy pomed'

distance = 559
spam score = 85
title = 'yemen8217s alqaeda presence hinders transition project on middle east democracy pomed'

distance = 559
spam score = 86
title = 'yemen8217s alqaeda presence hinders transition project on middle east democracy pomed'

distance = 560
spam score = 85
title = 'shadi hamid considers reconceptualizing usegyptian relations project on middle east democracy pomed'

distance = 565
spam score = 91
title = 'egypt8217s parliament votes on constituent assembly framework project on middle east democracy pomed'

distance = 565
spam score = 91
title = 'egypt8217s parliament votes on constituent assembly framework project on middle east democracy pomed'

distance = 630
spam score = 94
title = 'antigovernment protests in northern morocco and 8216reform and progress8221 according to former ambassador gabriel project on middle east democracy pomed'

distance = 658
spam score = 89
title = 'pomed notes a year of turmoil the arab uprising and the challenges of reconstruction project on middle east democracy pomed'

distance = 658
spam score = 89
title = 'pomed notes a year of turmoil the arab uprising and the challenges of reconstruction project on middle east democracy pomed'

distance = 664
spam score = 81
title = 'bahraini human rights defender prevented from entering egypt project on middle east democracy pomed'

distance = 664
spam score = 80
title = 'bahraini human rights defender prevented from entering egypt project on middle east democracy pomed'

distance = 685
spam score = 78
title = 'pomed notes voices from bahrain anniversary of the uprising project on middle east democracy pomed'

distance = 685
spam score = 77
title = 'pomed notes voices from bahrain anniversary of the uprising project on middle east democracy pomed'

distance = 691
spam score = 93
title = 'pomed event 8211 8220us 8211 libya relations beyond silence8221 project on middle east democracy pomed'

distance = 691
spam score = 93
title = 'pomed event 8211 8220us 8211 libya relations beyond silence8221 project on middle east democracy pomed'

distance = 695
spam score = 86
title = 'confrontation between conservatives and liberals in tunisian university project on middle east democracy pomed'

distance = 1176
spam score = 97
title = 'articles project on middle east democracy pomed'

distance = 1221
spam score = 98
title = 'pomed congratulates egyptian people project on middle east democracy pomed'

distance = 1274
spam score = 86
title = 'analyzing obama8217s speech to the muslim world project on middle east democracy pomed'

distance = 1322
spam score = 97
title = 'representatives of the young global leaders forum project on middle east democracy pomed'

distance = 1341
spam score = 93
title = 'after the bici report what next for bahrain project on middle east democracy pomed'

distance = 1393
spam score = 96
title = 'beyond moroccos elections prospects for genuine reform project on middle east democracy pomed'

distance = 1393
spam score = 97
title = 'turkish democracy a model abroad troubled at home project on middle east democracy pomed'

distance = 1602
spam score = 87
title = 'educators study foundations of democracy at annual institute oklahoma bar association'

distance = 1636
spam score = 79
title = 'fride europe a new role in the middle east'

distance = 132
spam score = 84
title = 'maine quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 142
spam score = 84
title = 'maine custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 147
spam score = 81
title = 'washington quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 147
spam score = 82
title = 'new york quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 149
spam score = 82
title = 'texas quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 150
spam score = 83
title = 'minnesota quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 153
spam score = 82
title = 'california quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 154
spam score = 83
title = 'kentucky quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 155
spam score = 83
title = 'nebraska quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 155
spam score = 84
title = 'delaware quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 155
spam score = 83
title = 'ohio quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 157
spam score = 83
title = 'utah quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 159
spam score = 82
title = 'maryland quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 159
spam score = 83
title = 'tennessee quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 159
spam score = 83
title = 'new york custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 160
spam score = 83
title = 'michigan quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 160
spam score = 84
title = 'connecticut quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 160
spam score = 82
title = 'illinois quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 161
spam score = 82
title = 'iowa quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 162
spam score = 82
title = 'new jersey quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 184
spam score = 82
title = 'arizona custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 184
spam score = 82
title = 'louisiana custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 185
spam score = 83
title = 'new mexico custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 185
spam score = 82
title = 'kansas custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 185
spam score = 84
title = 'wyoming custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 187
spam score = 82
title = 'nevada custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 187
spam score = 82
title = 'north dakota quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 189
spam score = 83
title = 'massachussets quality assurance and testing strativia software application development mobile amp wireless development financial software amp more'

distance = 189
spam score = 84
title = 'colorado custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 190
spam score = 83
title = 'north dakota custom web application development strativia software application development mobile amp wireless development financial software amp more'

distance = 228
spam score = 82
title = 'minnesota mobile and wireless development strativia software application development mobile amp wireless development financial software amp more'

distance = 229
spam score = 82
title = 'new hampshire mobile and wireless development strativia software application development mobile amp wireless development financial software amp more'

distance = 229
spam score = 82
title = 'missouri mobile and wireless development strativia software application development mobile amp wireless development financial software amp more'

distance = 229
spam score = 80
title = 'utah mobile and wireless development strativia software application development mobile amp wireless development financial software amp more'

distance = 230
spam score = 81
title = 'mississippi source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 230
spam score = 81
title = 'texas source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 230
spam score = 82
title = 'ohio source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 230
spam score = 83
title = 'minnesota source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 230
spam score = 81
title = 'new jersey source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 230
spam score = 86
title = 'florida source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 237
spam score = 82
title = 'georgia source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 237
spam score = 82
title = 'maryland source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 237
spam score = 81
title = 'north carolina mobile and wireless development strativia software application development mobile amp wireless development financial software amp more'

distance = 239
spam score = 83
title = 'wyoming mobile and wireless development strativia software application development mobile amp wireless development financial software amp more'

distance = 239
spam score = 81
title = 'south carolina mobile and wireless development strativia software application development mobile amp wireless development financial software amp more'

distance = 240
spam score = 82
title = 'rhode mobile and wireless development strativia software application development mobile amp wireless development financial software amp more'

distance = 240
spam score = 82
title = 'wisconsin source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 240
spam score = 81
title = 'vermont source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 241
spam score = 81
title = 'pennsylvania source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 241
spam score = 79
title = 'kansas source code audits and project rescue strativia software application development mobile amp wireless development financial software amp more'

distance = 368
spam score = 74
title = 'strativia washington dc custom web application development dc website and software development strativia software application development mobile amp wireless development financial software amp more'

distance = 401
spam score = 76
title = 'hello world strativia software application development mobile amp wireless development financial software amp more'

distance = 403
spam score = 64
title = 'sitemap strativia software application development mobile amp wireless development financial software amp more'

distance = 405
spam score = 73
title = 'schweiz strativia software application development mobile amp wireless development financial software amp more'

distance = 421
spam score = 62
title = 'strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 421
spam score = 65
title = '8211 strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 423
spam score = 60
title = '8211 strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 425
spam score = 61
title = 'strativia global solution strativia software application development mobile amp wireless development financial software amp more'

distance = 428
spam score = 62
title = '8212 strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 430
spam score = 70
title = 'application testing quality assurance services 8211 strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 526
spam score = 78
title = 'life sciences strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 527
spam score = 73
title = 'enterprise web portal development custom web portals development company 8211 strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 527
spam score = 54
title = 'news strativia software application development mobile amp wireless development financial software amp more'

distance = 534
spam score = 80
title = 'it managed services 8211 strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 539
spam score = 74
title = 'php software development company php web developers 8211 strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 542
spam score = 81
title = 'cyber security cyber security consulting company 8211 strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 542
spam score = 74
title = 'internet resources strativia software application development mobile amp wireless development financial software amp more'

distance = 544
spam score = 72
title = 'energy amp utilities strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 545
spam score = 71
title = 'money management resources strativia software application development mobile amp wireless development financial software amp more'

distance = 558
spam score = 82
title = 'document management service provider document management services strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 603
spam score = 72
title = 'malaysia strativia software application development mobile amp wireless development financial software amp more'

distance = 603
spam score = 72
title = 'uganda strativia software application development mobile amp wireless development financial software amp more'

distance = 603
spam score = 72
title = 'spain strativia software application development mobile amp wireless development financial software amp more'

distance = 604
spam score = 73
title = 'thailand strativia software application development mobile amp wireless development financial software amp more'

distance = 605
spam score = 70
title = 'philppines strativia software application development mobile amp wireless development financial software amp more'

distance = 605
spam score = 74
title = 'united kingdom strativia software application development mobile amp wireless development financial software amp more'

distance = 606
spam score = 71
title = 'nigeria strativia software application development mobile amp wireless development financial software amp more'

distance = 607
spam score = 72
title = 'germany strativia software application development mobile amp wireless development financial software amp more'

distance = 607
spam score = 71
title = 'hungary strativia software application development mobile amp wireless development financial software amp more'

distance = 609
spam score = 72
title = 'sweden strativia software application development mobile amp wireless development financial software amp more'

distance = 686
spam score = 93
title = 'maine website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 686
spam score = 74
title = 'sharepoint development customization and integration company 8211 strativia strativia software application development mobile amp wireless development financial software amp more'

distance = 690
spam score = 92
title = 'new york website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 691
spam score = 92
title = 'utah website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 692
spam score = 72
title = 'link to us strativia software application development mobile amp wireless development financial software amp more'

distance = 693
spam score = 80
title = 'tier two sap service providers offers strategic advantages 8211 strativia insights strativia software application development mobile amp wireless development financial software amp more'

distance = 694
spam score = 92
title = 'michigan website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 696
spam score = 91
title = 'kentucky website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 697
spam score = 92
title = 'district of columbia website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 699
spam score = 92
title = 'tennessee website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 712
spam score = 92
title = 'connecticut website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 713
spam score = 80
title = 'privacy strativia software application development mobile amp wireless development financial software amp more'

distance = 713
spam score = 92
title = 'montana website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 714
spam score = 92
title = 'north carolina website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 715
spam score = 92
title = 'louisiana website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 719
spam score = 92
title = 'wyoming website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 719
spam score = 92
title = 'rhode website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 722
spam score = 92
title = 'south carolina website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 723
spam score = 92
title = 'idaho website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 724
spam score = 92
title = 'vermont website design amp development amp section 508 compliant websites strativia software application development mobile amp wireless development financial software amp more'

distance = 1197
spam score = 53
title = 'global technology services en technical staffing nederland 8211 strativia global solutions strativia software application development mobile amp wireless development financial software amp more'

distance = 1230
spam score = 54
title = 'global technology services s mszaki szemlyzet magyarorszg 8211 strativiaglobal solutions strativia software application development mobile amp wireless development financial software amp more'

distance = 1787
spam score = 91
title = 'llli preoperative fasting and breastfeeding'

distance = 1787
spam score = 90
title = 'llli preoperative fasting and breastfeeding'

distance = 1788
spam score = 3
title = 'baby names baby unisex names shu'

distance = 63
spam score = 84
title = 'body of belief children becket fund'

distance = 65
spam score = 84
title = 'thank you becket fund'

distance = 65
spam score = 84
title = 'cmd 2011 place setting becket fund'

distance = 70
spam score = 80
title = 'temp post 2 becket fund'

distance = 71
spam score = 81
title = 'temp post becket fund'

distance = 72
spam score = 80
title = 'cmd 2011 reception becket fund'

distance = 72
spam score = 82
title = 'us litigation becket fund'

distance = 73
spam score = 85
title = 'body of belief head covering becket fund'

distance = 75
spam score = 83
title = 'blaine amendments becket fund'

distance = 75
spam score = 82
title = 'olympus digital camera becket fund'

distance = 75
spam score = 81
title = 'olympus digital camera becket fund'

distance = 75
spam score = 81
title = 'olympus digital camera becket fund'

distance = 78
spam score = 83
title = 'congressional becket fund'

distance = 79
spam score = 81
title = 'olympus digital camera becket fund'

distance = 79
spam score = 81
title = 'olympus digital camera becket fund'

distance = 79
spam score = 81
title = 'olympus digital camera becket fund'

distance = 79
spam score = 81
title = 'olympus digital camera becket fund'

distance = 81
spam score = 83
title = 'body of belief exhibit in nyc becket fund'

distance = 81
spam score = 79
title = 'support us becket fund'

distance = 83
spam score = 78
title = 'employment becket fund'

distance = 162
spam score = 74
title = 'colorado christian university takes federal government to court becket fund'

distance = 163
spam score = 82
title = 'conferences becket fund'

distance = 164
spam score = 78
title = 'our press release on the lautsi decision becket fund'

distance = 168
spam score = 78
title = 'youtubecom eric metaxas accepts the 2011 canterbury medal part ii becket fund'

distance = 169
spam score = 86
title = 'media center becket fund'

distance = 171
spam score = 80
title = 'cmd 2011founder kevin j 8220seamus8221 hasson becket fund'

distance = 171
spam score = 83
title = 'who we defend becket fund'

distance = 172
spam score = 78
title = 'youtubecom homeowner forced to remove cross from lawn sparking debate over first amendment rights becket fund'

distance = 172
spam score = 85
title = 'unacceptable becket fund'

distance = 173
spam score = 85
title = 'congressional international religious freedom reception becket fund'

distance = 232
spam score = 86
title = 'salazar v buono 20092010 becket fund'

distance = 233
spam score = 64
title = 'where we work becket fund'

distance = 237
spam score = 85
title = 'van orden v perry 2005 becket fund'

distance = 237
spam score = 83
title = 'elk grove unified school district v newdow 2003 becket fund'

distance = 244
spam score = 81
title = 'kristina arriaga becket fund'

distance = 246
spam score = 80
title = 'jeff gasser becket fund'

distance = 247
spam score = 83
title = 'lori windham becket fund'

distance = 248
spam score = 82
title = 'maria montserrat alvarado becket fund'

distance = 251
spam score = 73
title = 'cnncom graffiti is illegal antiislam remarks are not becket fund'

distance = 251
spam score = 88
title = 'ocean county register 8220tina ramirez california don8217t run roughshod over houses of worship8221 becket fund'

distance = 298
spam score = 84
title = 'our founder becket fund'

distance = 299
spam score = 83
title = 'hannah smith speaks to the j reuben clark law society dallas chapter becket fund'

distance = 302
spam score = 87
title = 'joshua hawley becket fund'

distance = 307
spam score = 84
title = 'national catholic register 8220obamacare mandated contraception collides with religious freedom8221 becket fund'

distance = 312
spam score = 73
title = 'newdow v carey 2010 becket fund'

distance = 319
spam score = 82
title = 'eric kniffin becket fund'

distance = 320
spam score = 87
title = 'pleasant grove v summum 2009 becket fund'

distance = 321
spam score = 84
title = 'boy scouts of america v dale 2000 becket fund'

distance = 322
spam score = 86
title = 'laura keivel becket fund'

distance = 323
spam score = 88
title = 'kenneth townsend becket fund'

distance = 374
spam score = 55
title = 'president obama echoes becket fund8217s pledge of allegiance argument becket fund'

distance = 374
spam score = 70
title = 'hhs approves contraception mandates becket fund'

distance = 375
spam score = 70
title = 'seamus hasson on hhs in the ncr becket fund'

distance = 376
spam score = 85
title = 'arizona christian school tuition organization v winn 1997present becket fund'

distance = 381
spam score = 77
title = 'merced v euless 2009 becket fund'

distance = 382
spam score = 87
title = 'christian legal society v martinez 2010 becket fund'

distance = 384
spam score = 83
title = 'fraternal order of police v city of newark new jersey 19981999 becket fund'

distance = 385
spam score = 70
title = 'ahmed shqeirat et al vs us airways minnesota 2007 becket fund'

distance = 387
spam score = 77
title = 'tommy deforest cullman alabama 2007 becket fund'

distance = 388
spam score = 85
title = 'moss v spartanburg county school district no 7 south carolina 2009 8211 present becket fund'

distance = 444
spam score = 80
title = 'the pew forum on religion and public life praises the becket fund as a top religious advocacy group becket fund'

distance = 446
spam score = 64
title = 'the washington times faith groups call for greater efforts to promote tolerance becket fund'

distance = 458
spam score = 63
title = 'our cases becket fund'

distance = 467
spam score = 70
title = 'health care reform and the hhs mandate on sterilization and all fdaapproved contraceptives 2010present becket fund'

distance = 475
spam score = 90
title = 'asma uddin becket fund'

distance = 478
spam score = 83
title = 'national review online 8211 whats at stake for religious liberty in the hosannatabor case becket fund'

distance = 482
spam score = 77
title = 'supreme court rejects yet another challenge to the pledge of allegiance becket fund'

distance = 484
spam score = 65
title = 'becket fund'

distance = 484
spam score = 79
title = 'church wins legal battle against taxhungry city hall becket fund'

distance = 485
spam score = 82
title = 'unitarian universalist church of akron v city of fairlawn ohio 200001 becket fund'

distance = 547
spam score = 84
title = 'schools becket fund'

distance = 547
spam score = 84
title = 'property rights becket fund'

distance = 550
spam score = 78
title = 'associations becket fund'

distance = 551
spam score = 77
title = 'yoder v morristown new york 2006 8211 present becket fund'

distance = 552
spam score = 66
title = 'fifth circuit does justice in rluipa case stops short of clarifying law becket fund'

distance = 552
spam score = 82
title = 'employment becket fund'

distance = 555
spam score = 74
title = 'issues amp topics becket fund'

distance = 556
spam score = 81
title = 'public square becket fund'

distance = 556
spam score = 65
title = 'presenting the 2011 ebenezer award becket fund'

distance = 561
spam score = 81
title = 'litigation highlights becket fund'

distance = 642
spam score = 65
title = 'san antonio express leon valley church wins zoning fight becket fund'

distance = 645
spam score = 60
title = 'becket fund files lawsuit for nun8217s tv network against obama8217s abortion drug mandate becket fund'

distance = 655
spam score = 68
title = 'florida may put blaine repeal on the ballot this fall becket fund'

distance = 658
spam score = 61
title = 'san francisco appeals court rejects religious discrimination claims against christian shelter becket fund'

distance = 662
spam score = 60
title = 'what the supreme court8217s rluipa decision means becket fund'

distance = 669
spam score = 60
title = 'american atheists v duncan utah 2005 8211 current becket fund'

distance = 674
spam score = 70
title = 'matter of congregation kol shafar 2006 becket fund'

distance = 679
spam score = 54
title = 'christian post 8211 should religious institutions follow antidiscrimination laws supreme court decides becket fund'

distance = 680
spam score = 83
title = 'capitol hill luncheon briefing series becket fund'

distance = 682
spam score = 76
title = 'supreme court brief filed in groundbreaking church employment case becket fund'

distance = 818
spam score = 85
title = 'becket fund on abc cnn fox nbc hannity and geraldo denouncing 8220false compromise8221 becket fund'

distance = 825
spam score = 69
title = 'jasvir singh v france bikramjit singh v france 200409 becket fund'

distance = 831
spam score = 72
title = 'conviction of assassin in pakistan is a victory for freedom of religion hannah smith in deseret news becket fund'

distance = 836
spam score = 64
title = 'ambiguity causes concern for freedoms of military chaplains after repeal of 8216don8217t ask don8217t tell8217 hannah smith in the deseret news becket fund'

distance = 837
spam score = 70
title = 'video the truth should not be a secret myth 3 becket fund'

distance = 838
spam score = 42
title = 'detroit metro times court and cross michigan case puts church v state before the us supreme court becket fund'

distance = 839
spam score = 79
title = 'anonymous v eric holder 2012 becket fund'

distance = 846
spam score = 83
title = 'the truth should not be a secret myth 1 becket fund'

distance = 849
spam score = 65
title = 'archdiocese of new york 8211 secularism in action in the supreme court becket fund'

distance = 850
spam score = 68
title = 'video the truth should not be a secret myth 1 becket fund'

distance = 1454
spam score = 72
title = 'reload new york 2012'

distance = 1480
spam score = 91
title = 'kris jenner for zestra increased arousal natural female sexual enhancement'

distance = 1604
spam score = 98
title = 'bread for the city raquo no really'

distance = 1607
spam score = 98
title = 'bread for the city raquo city orchard'

distance = 1827
spam score = 20
title = 'britify daily spotify playlists from awesome bbc radio'

distance = 116
spam score = 43
title = 'maine reminisce'

distance = 135
spam score = 43
title = '1 reminisce'

distance = 135
spam score = 45
title = '1912 reminisce'

distance = 142
spam score = 43
title = 'b17 reminisce'

distance = 143
spam score = 49
title = '1950 reminisce'

distance = 155
spam score = 43
title = 'or reminisce'

distance = 159
spam score = 41
title = 'ny reminisce'

distance = 159
spam score = 49
title = 'film reminisce'

distance = 166
spam score = 48
title = 'cowboys reminisce'

distance = 168
spam score = 40
title = 'jitterbug reminisce'

distance = 169
spam score = 47
title = 'kresge8217s reminisce'

distance = 171
spam score = 46
title = 'snow reminisce'

distance = 172
spam score = 39
title = 'skirts reminisce'

distance = 172
spam score = 48
title = 'emergency reminisce'

distance = 173
spam score = 44
title = 'aging reminisce'

distance = 176
spam score = 43
title = 'ma reminisce'

distance = 179
spam score = 39
title = 'milwaukee reminisce'

distance = 180
spam score = 41
title = 'teenagers reminisce'

distance = 183
spam score = 41
title = 'midwest reminisce'

distance = 183
spam score = 46
title = 'modeling reminisce'

distance = 230
spam score = 40
title = 'thanksgiving day reminisce'

distance = 231
spam score = 43
title = 'cheese reminisce'

distance = 231
spam score = 42
title = 'washington reminisce'

distance = 234
spam score = 39
title = 'camper reminisce'

distance = 234
spam score = 37
title = 'parakeet reminisce'

distance = 235
spam score = 46
title = 'doll reminisce'

distance = 235
spam score = 45
title = 'limburger reminisce'

distance = 236
spam score = 48
title = 'millville reminisce'

distance = 236
spam score = 47
title = 'knitting reminisce'

distance = 237
spam score = 38
title = 'blind date reminisce'

distance = 252
spam score = 42
title = 'photographers reminisce'

distance = 253
spam score = 38
title = 'air raid reminisce'

distance = 253
spam score = 39
title = 'perm reminisce'

distance = 253
spam score = 46
title = 'fairteen club reminisce'

distance = 255
spam score = 40
title = 'thanksgiving turkeys reminisce'

distance = 256
spam score = 43
title = 'auction reminisce'

distance = 256
spam score = 43
title = 'oldtime radio reminisce'

distance = 256
spam score = 38
title = '1940 reminisce'

distance = 257
spam score = 39
title = 'house car reminisce'

distance = 257
spam score = 45
title = 'rain shower reminisce'

distance = 276
spam score = 42
title = 'don rickels reminisce'

distance = 276
spam score = 49
title = 'songs reminisce'

distance = 276
spam score = 42
title = 'deer hunter reminisce'

distance = 276
spam score = 44
title = 'in reminisce'

distance = 276
spam score = 38
title = 'doris day reminisce'

distance = 277
spam score = 43
title = 'scrap drives reminisce'

distance = 278
spam score = 40
title = 'athol mass reminisce'

distance = 278
spam score = 48
title = 'hazelton pa reminisce'

distance = 278
spam score = 51
title = 'christmas food reminisce'

distance = 279
spam score = 44
title = 'anniversary reminisce'

distance = 298
spam score = 45
title = 'first shave reminisce'

distance = 299
spam score = 39
title = 'mo reminisce'

distance = 299
spam score = 39
title = 'goebel8217s lion farm reminisce'

distance = 299
spam score = 48
title = 'porter the barber reminisce'

distance = 300
spam score = 40
title = 'st louis reminisce'

distance = 301
spam score = 46
title = 'musical reminisce'

distance = 301
spam score = 50
title = 'long beach reminisce'

distance = 302
spam score = 43
title = 'washing machine reminisce'

distance = 302
spam score = 49
title = 'crystal white reminisce'

distance = 302
spam score = 48
title = 'best friends images reminisce'

distance = 330
spam score = 44
title = 'national kids day reminisce'

distance = 331
spam score = 40
title = 'pot reminisce'

distance = 334
spam score = 47
title = 'holiday classic reminisce'

distance = 334
spam score = 41
title = 'foundation department reminisce'

distance = 335
spam score = 43
title = 'swimming reminisce'

distance = 337
spam score = 48
title = 'thumbsucking reminisce'

distance = 337
spam score = 44
title = 'butter churns reminisce'

distance = 337
spam score = 45
title = 'sacramento ca reminisce'

distance = 338
spam score = 50
title = 'meat loaf reminisce'

distance = 338
spam score = 44
title = 'da schnoz reminisce'

distance = 394
spam score = 33
title = 'fate reminisce'

distance = 396
spam score = 38
title = 'crosley reminisce'

distance = 396
spam score = 48
title = 'fuller brush man reminisce'

distance = 402
spam score = 44
title = 'enewsletter reminisce'

distance = 402
spam score = 46
title = 'collectibles reminisce'

distance = 405
spam score = 41
title = 'camp talahi reminisce'

distance = 410
spam score = 48
title = 'pop dunlap8217s europeantype walkathon reminisce'

distance = 415
spam score = 45
title = 'san rafael valley reminisce'

distance = 425
spam score = 44
title = 'flower girl reminisce'

distance = 425
spam score = 32
title = 'twins reminisce'

distance = 682
spam score = 59
title = 'twingirlsumbrellas reminisce'

distance = 682
spam score = 56
title = 'brotherlylove reminisce'

distance = 687
spam score = 61
title = '1950sslumberparty reminisce'

distance = 689
spam score = 58
title = 'swimminghole1943 reminisce'

distance = 690
spam score = 59
title = 'femalequartet1950s reminisce'

distance = 691
spam score = 62
title = 'thanksgivingturkeygirl1950s reminisce'

distance = 692
spam score = 60
title = '1950sm1garandshooters reminisce'

distance = 692
spam score = 21
title = 'memories of the 1950s reminisce page 4'

distance = 694
spam score = 59
title = 'couplecouchradio reminisce'

distance = 698
spam score = 59
title = 'dancebandmusician1950s reminisce'

distance = 807
spam score = 52
title = 'tupperwareparty1950sbank reminisce'

distance = 815
spam score = 54
title = 'print the answers to crossword puzzle no 3 reminisce'

distance = 842
spam score = 45
title = 'time capsule trivia 2007 no 5 reminisce'

distance = 851
spam score = 51
title = 'familyowljarcollection reminisce'

distance = 852
spam score = 18
title = 'children reminisce'

distance = 853
spam score = 69
title = 'print crossword puzzle no 2 reminisce'

distance = 855
spam score = 54
title = 'scrubbing the summer off of boys reminisce'

distance = 858
spam score = 55
title = 'time capsule trivia 2007 no 6 reminisce'

distance = 864
spam score = 52
title = 'enjoying 8216carney8217 summers reminisce'

distance = 865
spam score = 46
title = 'business dealings reminisce'

distance = 1561
spam score = 62
title = 'pharma best practices rmi part 2'

distance = 1577
spam score = 69
title = 'pharma best practices rmi part 3'

distance = 1600
spam score = 76
title = 'inside rmi rmi'

distance = 1601
spam score = 68
title = 'budget limitations rmi'

distance = 1612
spam score = 22
title = 'official magic spells blog learn the secrets of magic spells and witchcraft page 2'

distance = 1837
spam score = 10
title = 'martina hingis picture'

distance = 235
spam score = 99
title = ''

distance = 243
spam score = 99
title = ''

distance = 270
spam score = 99
title = ''

distance = 271
spam score = 99
title = ''

distance = 276
spam score = 99
title = ''

distance = 280
spam score = 99
title = ''

distance = 283
spam score = 99
title = ''

distance = 289
spam score = 99
title = ''

distance = 292
spam score = 99
title = ''

distance = 300
spam score = 99
title = ''

distance = 317
spam score = 99
title = ''

distance = 329
spam score = 99
title = ''

distance = 359
spam score = 99
title = ''

distance = 365
spam score = 98
title = ''

distance = 386
spam score = 99
title = ''

distance = 410
spam score = 98
title = ''

distance = 423
spam score = 98
title = ''

distance = 423
spam score = 99
title = ''

distance = 430
spam score = 99
title = ''

distance = 436
spam score = 97
title = ''

distance = 439
spam score = 99
title = ''

distance = 445
spam score = 98
title = ''

distance = 455
spam score = 99
title = ''

distance = 455
spam score = 98
title = ''

distance = 460
spam score = 99
title = ''

distance = 470
spam score = 99
title = ''

distance = 480
spam score = 99
title = ''

distance = 483
spam score = 99
title = ''

distance = 497
spam score = 98
title = ''

distance = 498
spam score = 99
title = ''

distance = 502
spam score = 97
title = ''

distance = 519
spam score = 99
title = ''

distance = 522
spam score = 98
title = ''

distance = 542
spam score = 98
title = ''

distance = 551
spam score = 99
title = ''

distance = 578
spam score = 96
title = ''