tree path: root node -> d6d3cf0e0
clusters in node: 857
spam scores: The spammiest documents have a score of 0, and the least spammy have a score of 99. The spam score is the percentage of documents in the collection more spammy than this document. Cluster spam scores are averaged across all documents in a cluster.

clusterid = d6df381b0
RMSE = 0
spam score = 16
documents = 1
clusterid = d6d684e90
RMSE = 0
spam score = 19.1616
documents = 328
clusterid = d6df01d20
RMSE = 0
spam score = 8
documents = 1
clusterid = d6dd324f0
RMSE = 0
spam score = 3
documents = 1
clusterid = d6da6b6c0
RMSE = 0
spam score = 96
documents = 1
clusterid = d6dbbda90
RMSE = 0
spam score = 63
documents = 1
clusterid = d6de1c270
RMSE = 0
spam score = 72
documents = 2
clusterid = d6dc112d0
RMSE = 0
spam score = 69
documents = 1
clusterid = d6e1d43b0
RMSE = 0
spam score = 59
documents = 1
clusterid = d6d89be90
RMSE = 0
spam score = 35
documents = 1
clusterid = d6d859190
RMSE = 0
spam score = 45
documents = 1
clusterid = d6dec32f0
RMSE = 0
spam score = 43
documents = 1
clusterid = d6d84c920
RMSE = 0
spam score = 69
documents = 1
clusterid = d6e19df20
RMSE = 0
spam score = 58
documents = 3
clusterid = d6dcef7f0
RMSE = 0
spam score = 14
documents = 1
clusterid = d6e01dc60
RMSE = 0
spam score = 31
documents = 1
clusterid = d6d4b9330
RMSE = 0
spam score = 55
documents = 1
clusterid = d6d618570
RMSE = 8.544
spam score = 52
documents = 2
clusterid = d6d508aa0
RMSE = 13.7295
spam score = 53
documents = 2
clusterid = d6e2839d0
RMSE = 21.362
spam score = 44.6667
documents = 3
clusterid = d6d82f570
RMSE = 28.1904
spam score = 53.4
documents = 10
clusterid = d6da6f990
RMSE = 41
spam score = 53
documents = 1
clusterid = d6e2987e0
RMSE = 51.1222
spam score = 52.7315
documents = 14315
clusterid = d6e0dddc0
RMSE = 53.4498
spam score = 53.301
documents = 31881
clusterid = d6dcbd630
RMSE = 64
spam score = 37
documents = 1
clusterid = d6e375cf0
RMSE = 68.5181
spam score = 52.2066
documents = 21796
clusterid = d6dbacf50
RMSE = 70.8834
spam score = 59.65
documents = 20
clusterid = d6df55560
RMSE = 75.0095
spam score = 52.7433
documents = 15961
clusterid = d6dd603e0
RMSE = 76.7963
spam score = 14
documents = 3
clusterid = d6e15f4f0
RMSE = 82.3704
spam score = 52.7716
documents = 40091
clusterid = d6d9a7290
RMSE = 86.8778
spam score = 53.627
documents = 11542
clusterid = d6e0e2090
RMSE = 135.172
spam score = 62.2981
documents = 530
clusterid = d6d46e090
RMSE = 151.185
spam score = 29.7444
documents = 90
clusterid = d6dde1b10
RMSE = 153.988
spam score = 87.7895
documents = 361
clusterid = d6d7a9370
RMSE = 164.258
spam score = 77.7416
documents = 329
clusterid = d6e2170b0
RMSE = 180.72
spam score = 50.1667
documents = 66
clusterid = d6e382560
RMSE = 181.502
spam score = 20
documents = 4
clusterid = d6daf5390
RMSE = 194.865
spam score = 28.2057
documents = 418
clusterid = d6d6bf5f0
RMSE = 195.936
spam score = 0.183971
documents = 549
clusterid = d6dd646b0
RMSE = 197.927
spam score = 27.3829
documents = 175
clusterid = d6e25e080
RMSE = 204.081
spam score = 85.6531
documents = 591
clusterid = d6dac74a0
RMSE = 225.551
spam score = 50.1158
documents = 95
clusterid = d6d92e100
RMSE = 227.202
spam score = 36.6495
documents = 465
clusterid = d6d689160
RMSE = 232.183
spam score = 30.4646
documents = 99
clusterid = d6d7a50a0
RMSE = 239.165
spam score = 26.7778
documents = 36
clusterid = d6d52e3f0
RMSE = 243.34
spam score = 52.3662
documents = 71
clusterid = d6d472360
RMSE = 248.133
spam score = 38.0333
documents = 90
clusterid = d6de73d80
RMSE = 248.72
spam score = 41.8889
documents = 9
clusterid = d6daecdf0
RMSE = 253.218
spam score = 38.8661
documents = 127
clusterid = d6d7492c0
RMSE = 254.336
spam score = 38.8108
documents = 37
clusterid = d6e234460
RMSE = 267.369
spam score = 59.0667
documents = 15
clusterid = d6d9087b0
RMSE = 269.362
spam score = 20.4685
documents = 476
clusterid = d6dd53b70
RMSE = 278.565
spam score = 62.5647
documents = 464
clusterid = d6dacb770
RMSE = 287.502
spam score = 16.3915
documents = 1341
clusterid = d6dc5d580
RMSE = 289.274
spam score = 15.8775
documents = 10650
clusterid = d6d968860
RMSE = 293.443
spam score = 16.3758
documents = 1429
clusterid = d6dfdf230
RMSE = 305.938
spam score = 18.3271
documents = 535
clusterid = d6dfa0800
RMSE = 309.026
spam score = 39.5
documents = 2
clusterid = d6d476630
RMSE = 310.235
spam score = 23.5183
documents = 876
clusterid = d6d7065c0
RMSE = 328.788
spam score = 23.1268
documents = 552
clusterid = d6dfd6c90
RMSE = 334.561
spam score = 24.6154
documents = 13
clusterid = d6dfb98e0
RMSE = 336.595
spam score = 16.8192
documents = 9415
clusterid = d6d5afb20
RMSE = 350.107
spam score = 51.3172
documents = 2831
clusterid = d6dba06e0
RMSE = 352.567
spam score = 28.1343
documents = 2674
clusterid = d6d68d430
RMSE = 353.797
spam score = 42.5225
documents = 423
clusterid = d6d8f39a0
RMSE = 354.397
spam score = 46.4375
documents = 16
clusterid = d6dec75c0
RMSE = 354.457
spam score = 65.5
documents = 2
clusterid = d6def9780
RMSE = 372.096
spam score = 88.3488
documents = 43
clusterid = d6d5047d0
RMSE = 380.83
spam score = 20.3019
documents = 1358
clusterid = d6e2fcb60
RMSE = 384.421
spam score = 69.75
documents = 64
clusterid = d6d6ed4e0
RMSE = 385.044
spam score = 85.3741
documents = 139
clusterid = d6e10bcb0
RMSE = 388.392
spam score = 14.4044
documents = 413
clusterid = d6d7301e0
RMSE = 390.133
spam score = 36.989
documents = 182
clusterid = d6e332ff0
RMSE = 394.9
spam score = 21.1803
documents = 233
clusterid = d6de9d9a0
RMSE = 394.908
spam score = 4.25646
documents = 967
clusterid = d6e1d00e0
RMSE = 399.247
spam score = 80.1289
documents = 1327
clusterid = d6d7ca9f0
RMSE = 399.864
spam score = 47.3432
documents = 3703
clusterid = d6d6aeab0
RMSE = 400.767
spam score = 55.8883
documents = 349
clusterid = d6e064c30
RMSE = 409.987
spam score = 44.4584
documents = 373
clusterid = d6db1efb0
RMSE = 410.288
spam score = 18.2262
documents = 1198
clusterid = d6e120ac0
RMSE = 412.609
spam score = 54.9856
documents = 975
clusterid = d6dc50d10
RMSE = 414.199
spam score = 55.3835
documents = 133
clusterid = d6e1bf5a0
RMSE = 418.047
spam score = 0
documents = 23
clusterid = d6d5ea280
RMSE = 419.434
spam score = 21.0233
documents = 172
clusterid = d6e04bb50
RMSE = 426.842
spam score = 22.9775
documents = 1512
clusterid = d6d511040
RMSE = 430.849
spam score = 46.6923
documents = 13
clusterid = d6db2b820
RMSE = 431.641
spam score = 20.3049
documents = 1020
clusterid = d6d5a7580
RMSE = 434.646
spam score = 46.3571
documents = 28
clusterid = d6e35cc10
RMSE = 436.092
spam score = 15.9583
documents = 312
clusterid = d6e371a20
RMSE = 443.602
spam score = 45.7444
documents = 90
clusterid = d6e2ec020
RMSE = 443.652
spam score = 51.6
documents = 10
clusterid = d6d925b60
RMSE = 443.943
spam score = 21.1845
documents = 168
clusterid = d6e2b18c0
RMSE = 446.369
spam score = 50.0438
documents = 662
clusterid = d6d646460
RMSE = 446.389
spam score = 59.4605
documents = 936
clusterid = d6e20a840
RMSE = 451.747
spam score = 61.8259
documents = 201
clusterid = d6e03f2e0
RMSE = 455.132
spam score = 73
documents = 2
clusterid = d6df98260
RMSE = 458.333
spam score = 48.6192
documents = 541
clusterid = d6e02e7a0
RMSE = 459.009
spam score = 20.8819
documents = 9872
clusterid = d6d872270
RMSE = 466.734
spam score = 46.6996
documents = 223
clusterid = d6d5fb1c0
RMSE = 468.911
spam score = 69.5029
documents = 173
clusterid = d6db55440
RMSE = 469.503
spam score = 82.4022
documents = 92
clusterid = d6d9b3b00
RMSE = 470.51
spam score = 78
documents = 2
clusterid = d6e1c3870
RMSE = 472.569
spam score = 39.7943
documents = 175
clusterid = d6dc54fe0
RMSE = 478.503
spam score = 71.2391
documents = 548
clusterid = d6e26ebc0
RMSE = 479.036
spam score = 93.5833
documents = 12
clusterid = d6e047880
RMSE = 483.292
spam score = 20.4593
documents = 810
clusterid = d6df7f180
RMSE = 491.03
spam score = 33.0156
documents = 64
clusterid = d6d5dda10
RMSE = 492.855
spam score = 40.9059
documents = 1584
clusterid = d6ddfabf0
RMSE = 493.444
spam score = 56.3333
documents = 15
clusterid = d6d900210
RMSE = 494.897
spam score = 50
documents = 96
clusterid = d6e09f390
RMSE = 496.787
spam score = 4.7766
documents = 1034
clusterid = d6d450be0
RMSE = 496.844
spam score = 79.5819
documents = 177
clusterid = d6da289c0
RMSE = 497.804
spam score = 11.6892
documents = 74
clusterid = d6d57d960
RMSE = 499.601
spam score = 81.9556
documents = 45
clusterid = d6e036d40
RMSE = 500.121
spam score = 0.5
documents = 2
clusterid = d6e2ca9a0
RMSE = 500.486
spam score = 72.3045
documents = 660
clusterid = d6d674350
RMSE = 502.031
spam score = 40.9091
documents = 88
clusterid = d6d787cf0
RMSE = 503.062
spam score = 70.8571
documents = 28
clusterid = d6d6290b0
RMSE = 503.262
spam score = 55.6244
documents = 3099
clusterid = d6ddaf950
RMSE = 504.108
spam score = 54.3427
documents = 286
clusterid = d6e240cd0
RMSE = 504.925
spam score = 52.2564
documents = 117
clusterid = d6d5e1ce0
RMSE = 507.954
spam score = 36.8135
documents = 1008
clusterid = d6db51170
RMSE = 507.988
spam score = 41.4693
documents = 733
clusterid = d6d4c5ba0
RMSE = 508.047
spam score = 37.4281
documents = 1745
clusterid = d6daf9660
RMSE = 511.71
spam score = 51.4066
documents = 241
clusterid = d6da246f0
RMSE = 514.787
spam score = 75.1818
documents = 11
clusterid = d6de805f0
RMSE = 518.105
spam score = 34.4141
documents = 99
clusterid = d6e026200
RMSE = 520.733
spam score = 54.2609
documents = 23
clusterid = d6d6c38c0
RMSE = 522.297
spam score = 67.6603
documents = 315
clusterid = d6e319f10
RMSE = 522.685
spam score = 44.7714
documents = 35
clusterid = d6d620b10
RMSE = 523.667
spam score = 63.75
documents = 16
clusterid = d6d691700
RMSE = 531.514
spam score = 36.4028
documents = 72
clusterid = d6d3dff00
RMSE = 532.197
spam score = 40.3333
documents = 108
clusterid = d6d816490
RMSE = 535.009
spam score = 4.81305
documents = 1578
clusterid = d6d58a1d0
RMSE = 540.366
spam score = 50.5734
documents = 11682
clusterid = d6e1785d0
RMSE = 543.702
spam score = 74.087
documents = 230
clusterid = d6d59ad10
RMSE = 544.73
spam score = 64.4286
documents = 7
clusterid = d6dc8b470
RMSE = 546.099
spam score = 78.7876
documents = 678
clusterid = d6e266620
RMSE = 547.911
spam score = 0.5
documents = 12
clusterid = d6d8b4f70
RMSE = 548.529
spam score = 7.80576
documents = 139
clusterid = d6d7b1910
RMSE = 551.386
spam score = 39.1875
documents = 144
clusterid = d6da8cd40
RMSE = 557.445
spam score = 41.6364
documents = 88
clusterid = d6d53ef30
RMSE = 558.333
spam score = 24.9157
documents = 261
clusterid = d6db6e520
RMSE = 559.331
spam score = 54.2188
documents = 160
clusterid = d6d8a4430
RMSE = 559.542
spam score = 56.064
documents = 4955
clusterid = d6dc6e0c0
RMSE = 562.672
spam score = 16.2159
documents = 1714
clusterid = d6ddf2650
RMSE = 570.384
spam score = 61.0247
documents = 243
clusterid = d6d8deb90
RMSE = 572.487
spam score = 49.7227
documents = 732
clusterid = d6d9471e0
RMSE = 572.607
spam score = 52.4343
documents = 1287
clusterid = d6d99aa20
RMSE = 576.059
spam score = 1.75435
documents = 460
clusterid = d6e36d750
RMSE = 582.121
spam score = 56.2318
documents = 1484
clusterid = d6da9d880
RMSE = 582.961
spam score = 23.9802
documents = 1261
clusterid = d6d6d0130
RMSE = 586.677
spam score = 36.3466
documents = 929
clusterid = d6e1fdfd0
RMSE = 589.846
spam score = 34.9954
documents = 5403
clusterid = d6e1a21f0
RMSE = 591.743
spam score = 83.9943
documents = 175
clusterid = d6e142140
RMSE = 593.358
spam score = 7.78373
documents = 541
clusterid = d6dbc6030
RMSE = 593.447
spam score = 35
documents = 4
clusterid = d6e277160
RMSE = 599.996
spam score = 36.9563
documents = 663
clusterid = d6e199c50
RMSE = 600.273
spam score = 82.4386
documents = 57
clusterid = d6d869cd0
RMSE = 602.284
spam score = 48.0473
documents = 317
clusterid = d6d9af830
RMSE = 604.216
spam score = 48.1888
documents = 143
clusterid = d6e0008b0
RMSE = 608.127
spam score = 45.5
documents = 10
clusterid = d6d635920
RMSE = 608.703
spam score = 48.9494
documents = 79
clusterid = d6d7e7da0
RMSE = 609.43
spam score = 42.6551
documents = 403
clusterid = d6dc93a10
RMSE = 610.816
spam score = 59.5594
documents = 143
clusterid = d6dbf81f0
RMSE = 615.674
spam score = 53.8538
documents = 691
clusterid = d6da77f30
RMSE = 617.402
spam score = 47.0484
documents = 248
clusterid = d6dd9ab40
RMSE = 617.447
spam score = 57.4553
documents = 6576
clusterid = d6d56ce20
RMSE = 622.256
spam score = 20.9959
documents = 3159
clusterid = d6e230190
RMSE = 623.336
spam score = 46.2982
documents = 114
clusterid = d6d5ff490
RMSE = 624.819
spam score = 22.5172
documents = 29
clusterid = d6e096df0
RMSE = 633.625
spam score = 37
documents = 4
clusterid = d6e3a7eb0
RMSE = 634.813
spam score = 76.4931
documents = 146
clusterid = d6d40de50
RMSE = 635.491
spam score = 51.5535
documents = 1019
clusterid = d6e0f6ea0
RMSE = 636.003
spam score = 38.4744
documents = 234
clusterid = d6d4a0250
RMSE = 641.025
spam score = 70.2174
documents = 23
clusterid = d6d93a970
RMSE = 642.069
spam score = 37.0556
documents = 36
clusterid = d6d7f88e0
RMSE = 645.964
spam score = 49.8284
documents = 437
clusterid = d6e1dc950
RMSE = 648.795
spam score = 9.09091
documents = 11
clusterid = d6db05ed0
RMSE = 649.542
spam score = 5.63099
documents = 355
clusterid = d6dcc9ea0
RMSE = 655.477
spam score = 44.7815
documents = 119
clusterid = d6da7c200
RMSE = 657.661
spam score = 27.3462
documents = 130
clusterid = d6d58e4a0
RMSE = 658.157
spam score = 32.6973
documents = 185
clusterid = d6dca8820
RMSE = 658.715
spam score = 72.7541
documents = 244
clusterid = d6d8f7c70
RMSE = 660.254
spam score = 71.25
documents = 408
clusterid = d6dd70f20
RMSE = 662.532
spam score = 62.924
documents = 329
clusterid = d6db61cb0
RMSE = 668.835
spam score = 89.3119
documents = 1260
clusterid = d6e060960
RMSE = 673.794
spam score = 33.1077
documents = 130
clusterid = d6ddd0fd0
RMSE = 675.917
spam score = 68.3261
documents = 276
clusterid = d6e146410
RMSE = 677.521
spam score = 8.91295
documents = 471
clusterid = d6d581c30
RMSE = 678.92
spam score = 47.5183
documents = 191
clusterid = d6de996d0
RMSE = 679
spam score = 64
documents = 1
clusterid = d6ddc0490
RMSE = 679.166
spam score = 43.1381
documents = 268
clusterid = d6d3f4d30
RMSE = 680.514
spam score = 28.5556
documents = 54
clusterid = d6e08e850
RMSE = 683.311
spam score = 34.4789
documents = 5049
clusterid = d6da0b610
RMSE = 683.323
spam score = 49.1989
documents = 548
clusterid = d6dea1c70
RMSE = 688.578
spam score = 35.17
documents = 447
clusterid = d6dd43030
RMSE = 689.464
spam score = 56.7586
documents = 87
clusterid = d6d5326c0
RMSE = 689.77
spam score = 53.5192
documents = 1196
clusterid = d6dad3d10
RMSE = 691.669
spam score = 59.6667
documents = 3
clusterid = d6dca4550
RMSE = 692.146
spam score = 69.1176
documents = 17
clusterid = d6d5d5470
RMSE = 692.838
spam score = 71.3265
documents = 49
clusterid = d6debf020
RMSE = 695.918
spam score = 41.0315
documents = 127
clusterid = d6df87720
RMSE = 703.001
spam score = 40.3527
documents = 1052
clusterid = d6e326780
RMSE = 703.035
spam score = 56.3333
documents = 3
clusterid = d6dde5de0
RMSE = 703.778
spam score = 44.102
documents = 98
clusterid = d6d53ac60
RMSE = 706.886
spam score = 42.8732
documents = 71
clusterid = d6dbca300
RMSE = 708.334
spam score = 7.73333
documents = 60
clusterid = d6d5605b0
RMSE = 708.6
spam score = 54.3825
documents = 285
clusterid = d6d3ec790
RMSE = 709.412
spam score = 59.034
documents = 294
clusterid = d6ddb3c20
RMSE = 709.953
spam score = 25.8484
documents = 409
clusterid = d6d4400a0
RMSE = 710.053
spam score = 37.0104
documents = 193
clusterid = d6dcb0dc0
RMSE = 710.281
spam score = 7.67886
documents = 246
clusterid = d6db27550
RMSE = 711.837
spam score = 66.3137
documents = 153
clusterid = d6d8d65f0
RMSE = 712.38
spam score = 36.3261
documents = 2251
clusterid = d6e354670
RMSE = 714.384
spam score = 54.0922
documents = 1833
clusterid = d6d7ad640
RMSE = 714.909
spam score = 36.5948
documents = 1187
clusterid = d6dbfc4c0
RMSE = 722.808
spam score = 88.8519
documents = 27
clusterid = d6deb27b0
RMSE = 722.86
spam score = 32.3451
documents = 9831
clusterid = d6dbdae40
RMSE = 725.195
spam score = 49.2381
documents = 147
clusterid = d6db8fba0
RMSE = 727.196
spam score = 27.1555
documents = 238
clusterid = d6d83bde0
RMSE = 728.243
spam score = 18.9571
documents = 140
clusterid = d6d751860
RMSE = 728.548
spam score = 33.3614
documents = 10588
clusterid = d6e00d120
RMSE = 728.913
spam score = 16.6987
documents = 156
clusterid = d6d448640
RMSE = 729.175
spam score = 17.3333
documents = 6
clusterid = d6deecf10
RMSE = 730.611
spam score = 50.9961
documents = 258
clusterid = d6d607a30
RMSE = 731.324
spam score = 21.586
documents = 3860
clusterid = d6df93f90
RMSE = 735.836
spam score = 37.8837
documents = 86
clusterid = d6dc21e10
RMSE = 736.577
spam score = 42.9858
documents = 845
clusterid = d6e38ab00
RMSE = 737.24
spam score = 19.8125
documents = 80
clusterid = d6d9bc0a0
RMSE = 737.673
spam score = 59.7733
documents = 322
clusterid = d6d801980
RMSE = 738.514
spam score = 15.5
documents = 2
clusterid = d6de569d0
RMSE = 742.216
spam score = 60
documents = 22
clusterid = d6d85d460
RMSE = 742.611
spam score = 41.1429
documents = 14
clusterid = d6decb890
RMSE = 745.429
spam score = 45.0133
documents = 679
clusterid = d6d42b290
RMSE = 745.514
spam score = 13
documents = 2
clusterid = d6d3cf390
RMSE = 747
spam score = 1
documents = 1
clusterid = d6e2cec70
RMSE = 747.855
spam score = 57.5
documents = 30
clusterid = d6dba49b0
RMSE = 748.677
spam score = 73.0389
documents = 180
clusterid = d6db5d9e0
RMSE = 750.25
spam score = 50.7646
documents = 633
clusterid = d6da45d70
RMSE = 751.58
spam score = 47.0156
documents = 320
clusterid = d6d9ee260
RMSE = 754.111
spam score = 19.5117
documents = 213
clusterid = d6e305100
RMSE = 756.296
spam score = 11.1181
documents = 288
clusterid = d6d7df800
RMSE = 762.316
spam score = 27.7391
documents = 23
clusterid = d6e167a90
RMSE = 762.418
spam score = 38.227
documents = 1612
clusterid = d6e2df7b0
RMSE = 765.774
spam score = 31.7759
documents = 1450
clusterid = d6e0abc00
RMSE = 767.39
spam score = 38.9255
documents = 255
clusterid = d6e33f860
RMSE = 768.079
spam score = 10.0955
documents = 1162
clusterid = d6d624de0
RMSE = 768.224
spam score = 14.3543
documents = 4090
clusterid = d6da525e0
RMSE = 770.743
spam score = 57.9489
documents = 959
clusterid = d6d86dfa0
RMSE = 771.314
spam score = 63.6005
documents = 2911
clusterid = d6d4164a0
RMSE = 771.396
spam score = 63.2873
documents = 275
clusterid = d6d3dbc50
RMSE = 778.922
spam score = 39.4143
documents = 4663
clusterid = d6dbc1d60
RMSE = 779.604
spam score = 54.4858
documents = 562
clusterid = d6d755b30
RMSE = 780.315
spam score = 12.4545
documents = 11
clusterid = d6ddd52a0
RMSE = 781.223
spam score = 39.1765
documents = 51
clusterid = d6d992480
RMSE = 783.504
spam score = 43.5
documents = 2
clusterid = d6d738780
RMSE = 784.748
spam score = 21.6267
documents = 1144
clusterid = d6e156f50
RMSE = 788.571
spam score = 74.6129
documents = 31
clusterid = d6df05ff0
RMSE = 789.311
spam score = 49.5
documents = 76
clusterid = d6dd219b0
RMSE = 789.791
spam score = 51.9607
documents = 3482
clusterid = d6e1b7000
RMSE = 790.07
spam score = 61.4139
documents = 476
clusterid = d6dd96870
RMSE = 793.341
spam score = 33.1333
documents = 345
clusterid = d6e131600
RMSE = 793.529
spam score = 59.5985
documents = 655
clusterid = d6d6959d0
RMSE = 793.763
spam score = 29.75
documents = 4
clusterid = d6e3224b0
RMSE = 794.973
spam score = 21.25
documents = 96
clusterid = d6dd9ee10
RMSE = 796.188
spam score = 61.2091
documents = 6652
clusterid = d6d87a810
RMSE = 798.317
spam score = 19.5484
documents = 2739
clusterid = d6debad50
RMSE = 799.15
spam score = 40.6058
documents = 416
clusterid = d6d579690
RMSE = 799.669
spam score = 46.5
documents = 24
clusterid = d6d67c8f0
RMSE = 803.646
spam score = 46.1143
documents = 140
clusterid = d6da07340
RMSE = 803.739
spam score = 49.8803
documents = 37165
clusterid = d6e0cd280
RMSE = 808.355
spam score = 47.5906
documents = 112340
clusterid = d6d77b480
RMSE = 810.706
spam score = 47.0357
documents = 28
clusterid = d6d6e9210
RMSE = 812.904
spam score = 52.7852
documents = 135
clusterid = d6d4f3c90
RMSE = 814.299
spam score = 17.9134
documents = 127
clusterid = d6d717100
RMSE = 815.659
spam score = 45.8571
documents = 7
clusterid = d6db16a10
RMSE = 817.163
spam score = 50.1295
documents = 278
clusterid = d6d97d670
RMSE = 817.895
spam score = 72.0194
documents = 103
clusterid = d6e075770
RMSE = 820.156
spam score = 20.3333
documents = 18
clusterid = d6e3ac180
RMSE = 823.012
spam score = 59.2593
documents = 401
clusterid = d6d723970
RMSE = 823.318
spam score = 62.8156
documents = 141
clusterid = d6e2f02f0
RMSE = 825.614
spam score = 28.2887
documents = 142
clusterid = d6e09b0c0
RMSE = 827.312
spam score = 46.6287
documents = 501
clusterid = d6e1637c0
RMSE = 829.362
spam score = 47.3932
documents = 79081
clusterid = d6d7db530
RMSE = 830.744
spam score = 44.6722
documents = 726
clusterid = d6dfce6f0
RMSE = 832.031
spam score = 53.9896
documents = 961
clusterid = d6dda30e0
RMSE = 834.325
spam score = 45.7952
documents = 83
clusterid = d6d8a0160
RMSE = 838.249
spam score = 39.6667
documents = 6
clusterid = d6e311970
RMSE = 838.409
spam score = 36.6241
documents = 681
clusterid = d6e0b8470
RMSE = 840.966
spam score = 67.6667
documents = 6
clusterid = d6d69df70
RMSE = 841.138
spam score = 56.825
documents = 40
clusterid = d6dc155a0
RMSE = 841.306
spam score = 27.9478
documents = 920
clusterid = d6e3b4720
RMSE = 843.252
spam score = 47.9696
documents = 11863
clusterid = d6d3d7970
RMSE = 843.907
spam score = 57.0051
documents = 9105
clusterid = d6d4d66e0
RMSE = 844.715
spam score = 31.7051
documents = 156
clusterid = d6e1c7b40
RMSE = 844.841
spam score = 49.9249
documents = 29790
clusterid = d6db65f80
RMSE = 844.974
spam score = 38.4417
documents = 858
clusterid = d6d7623a0
RMSE = 845.995
spam score = 56.0909
documents = 143
clusterid = d6d596a40
RMSE = 849.529
spam score = 25.4216
documents = 1689
clusterid = d6d7c2450
RMSE = 849.711
spam score = 50.5412
documents = 656
clusterid = d6e124d90
RMSE = 850.035
spam score = 49.0172
documents = 58
clusterid = d6de2cdb0
RMSE = 851.431
spam score = 26.9655
documents = 724
clusterid = d6dc7a930
RMSE = 858.686
spam score = 47.3852
documents = 16738
clusterid = d6d54b7a0
RMSE = 860.462
spam score = 47.3827
documents = 141311
clusterid = d6e37e290
RMSE = 860.945
spam score = 47.541
documents = 64501
clusterid = d6d699ca0
RMSE = 862.682
spam score = 62.8028
documents = 502
clusterid = d6e2c2400
RMSE = 866
spam score = 89
documents = 1
clusterid = d6dfad070
RMSE = 866.329
spam score = 30.8472
documents = 1636
clusterid = d6d8bd510
RMSE = 866.984
spam score = 48.0165
documents = 144852
clusterid = d6d740d20
RMSE = 869.449
spam score = 32.6757
documents = 37
clusterid = d6e27b430
RMSE = 870.89
spam score = 45.5844
documents = 1215
clusterid = d6d8ef6d0
RMSE = 871.519
spam score = 43.8313
documents = 575
clusterid = d6da4e310
RMSE = 873.215
spam score = 49.2129
documents = 14753
clusterid = d6d55c2e0
RMSE = 876.079
spam score = 45.9085
documents = 164
clusterid = d6e347e00
RMSE = 876.449
spam score = 27.2208
documents = 1232
clusterid = d6db12740
RMSE = 878.916
spam score = 49.6404
documents = 42273
clusterid = d6dce2f80
RMSE = 879.388
spam score = 75.6207
documents = 58
clusterid = d6d9c4640
RMSE = 880.558
spam score = 60.2651
documents = 249
clusterid = d6e2e3a80
RMSE = 881.286
spam score = 36.4545
documents = 99
clusterid = d6da88a70
RMSE = 881.947
spam score = 44.9736
documents = 531
clusterid = d6e0afed0
RMSE = 882.212
spam score = 5.51765
documents = 85
clusterid = d6db59710
RMSE = 882.95
spam score = 44.6933
documents = 163
clusterid = d6e379fc0
RMSE = 885.542
spam score = 48.7829
documents = 53995
clusterid = d6d4da9b0
RMSE = 885.566
spam score = 45.522
documents = 4644
clusterid = d6da13bb0
RMSE = 885.731
spam score = 48.5872
documents = 90640
clusterid = d6e2022a0
RMSE = 885.882
spam score = 16.9365
documents = 63
clusterid = d6d553d40
RMSE = 886.109
spam score = 16.5
documents = 42
clusterid = d6de07460
RMSE = 886.273
spam score = 86.2647
documents = 68
clusterid = d6e1b2d30
RMSE = 886.901
spam score = 48.1817
documents = 6138
clusterid = d6de52700
RMSE = 887.8
spam score = 27.6667
documents = 6
clusterid = d6df2fc10
RMSE = 887.94
spam score = 66.3429
documents = 140
clusterid = d6d60bd00
RMSE = 888.195
spam score = 71.0602
documents = 83
clusterid = d6e0ee900
RMSE = 888.489
spam score = 38.6364
documents = 5115
clusterid = d6e2c66d0
RMSE = 889.509
spam score = 48.1369
documents = 20666
clusterid = d6d8e2e60
RMSE = 890.227
spam score = 34.2308
documents = 13
clusterid = d6dbce5d0
RMSE = 891.465
spam score = 46.1964
documents = 8034
clusterid = d6d964590
RMSE = 892.149
spam score = 41.0163
documents = 246
clusterid = d6dca0280
RMSE = 892.672
spam score = 48.1909
documents = 330
clusterid = d6da17e80
RMSE = 893.503
spam score = 43.625
documents = 8
clusterid = d6d558010
RMSE = 893.521
spam score = 69.1887
documents = 53
clusterid = d6d4deff0
RMSE = 893.816
spam score = 49.2972
documents = 49279
clusterid = d6dc871a0
RMSE = 897.889
spam score = 53.0196
documents = 51
clusterid = d6e2d7210
RMSE = 899.69
spam score = 48.3412
documents = 7579
clusterid = d6da63120
RMSE = 899.706
spam score = 41.375
documents = 8
clusterid = d6d568b50
RMSE = 899.726
spam score = 65.5
documents = 2
clusterid = d6e32ed20
RMSE = 900.158
spam score = 40.6564
documents = 422
clusterid = d6dafd930
RMSE = 900.402
spam score = 43.661
documents = 59
clusterid = d6e3d5da0
RMSE = 901.773
spam score = 54.5907
documents = 30026
clusterid = d6d8121c0
RMSE = 902.082
spam score = 51.6667
documents = 3
clusterid = d6dfdaf60
RMSE = 902.649
spam score = 48.1429
documents = 14
clusterid = d6e180b70
RMSE = 902.667
spam score = 48.3529
documents = 1091
clusterid = d6de35350
RMSE = 903.02
spam score = 48.5925
documents = 7085
clusterid = d6d957d20
RMSE = 903.621
spam score = 51.5676
documents = 7098
clusterid = d6e0862b0
RMSE = 904
spam score = 5
documents = 1
clusterid = d6e019990
RMSE = 904.351
spam score = 48.1604
documents = 64573
clusterid = d6dabac30
RMSE = 908.138
spam score = 68.0465
documents = 43
clusterid = d6e300e30
RMSE = 912.435
spam score = 78.8651
documents = 126
clusterid = d6d6a6510
RMSE = 912.633
spam score = 63.2704
documents = 773
clusterid = d6deb6a80
RMSE = 913.035
spam score = 74.011
documents = 181
clusterid = d6d7022f0
RMSE = 914.536
spam score = 43.915
documents = 306
clusterid = d6e079a40
RMSE = 915.087
spam score = 47.9903
documents = 8982
clusterid = d6da1c150
RMSE = 917.867
spam score = 21.5907
documents = 215
clusterid = d6e1e91c0
RMSE = 919
spam score = 31
documents = 1
clusterid = d6e3b89f0
RMSE = 921.264
spam score = 41.3171
documents = 20385
clusterid = d6d88b350
RMSE = 921.449
spam score = 70.3333
documents = 21
clusterid = d6d48f710
RMSE = 921.769
spam score = 46.3041
documents = 148
clusterid = d6d8c5ab0
RMSE = 922.16
spam score = 68.9689
documents = 225
clusterid = d6dd0cba0
RMSE = 923.404
spam score = 44.2044
documents = 2285
clusterid = d6dc08d30
RMSE = 925.737
spam score = 30.3632
documents = 212
clusterid = d6da952e0
RMSE = 925.75
spam score = 65.5
documents = 2
clusterid = d6d854ec0
RMSE = 925.802
spam score = 27.7644
documents = 208
clusterid = d6e3b0450
RMSE = 927.078
spam score = 61.5
documents = 2
clusterid = d6d7e3ad0
RMSE = 927.258
spam score = 59.913
documents = 46
clusterid = d6da41aa0
RMSE = 928.939
spam score = 45.8878
documents = 32583
clusterid = d6ddab680
RMSE = 931.735
spam score = 53.0969
documents = 258
clusterid = d6e3de340
RMSE = 932.952
spam score = 21.2569
documents = 253
clusterid = d6dd6cc50
RMSE = 932.962
spam score = 46.6027
documents = 10860
clusterid = d6db9c410
RMSE = 935.063
spam score = 34.4211
documents = 114
clusterid = d6d876540
RMSE = 935.262
spam score = 44.375
documents = 112
clusterid = d6d61c840
RMSE = 935.776
spam score = 74.2273
documents = 132
clusterid = d6def54b0
RMSE = 938.383
spam score = 45.2857
documents = 7
clusterid = d6d9dd720
RMSE = 939.522
spam score = 50.6684
documents = 18561
clusterid = d6d9a2fc0
RMSE = 940.524
spam score = 46.5096
documents = 14552
clusterid = d6d4dec80
RMSE = 941.748
spam score = 15.3333
documents = 3
clusterid = d6d6fe020
RMSE = 944.101
spam score = 55.9684
documents = 95
clusterid = d6dc1db40
RMSE = 947.06
spam score = 48.1315
documents = 18767
clusterid = d6dac31d0
RMSE = 947.477
spam score = 22.9448
documents = 181
clusterid = d6df9c530
RMSE = 948.777
spam score = 36.7207
documents = 1400
clusterid = d6d70a890
RMSE = 948.821
spam score = 57.3929
documents = 224
clusterid = d6d5b3df0
RMSE = 949.179
spam score = 59.4369
documents = 103
clusterid = d6e21b380
RMSE = 949.965
spam score = 65.9051
documents = 390
clusterid = d6d4c9e70
RMSE = 950.852
spam score = 69.1219
documents = 41
clusterid = d6d850bf0
RMSE = 950.964
spam score = 47.778
documents = 9742
clusterid = d6db44900
RMSE = 951.08
spam score = 32.5556
documents = 54
clusterid = d6d6bb320
RMSE = 952.4
spam score = 36.7241
documents = 261
clusterid = d6daa5e20
RMSE = 952.868
spam score = 49.0764
documents = 942
clusterid = d6d64a730
RMSE = 954.243
spam score = 48.983
documents = 4228
clusterid = d6dd8a000
RMSE = 956.094
spam score = 74.4857
documents = 35
clusterid = d6dc65b20
RMSE = 956.311
spam score = 72
documents = 3
clusterid = d6d848650
RMSE = 957.206
spam score = 41.5484
documents = 31
clusterid = d6d9192f0
RMSE = 957.499
spam score = 28.4452
documents = 2590
clusterid = d6de78050
RMSE = 957.983
spam score = 29.6765
documents = 34
clusterid = d6df1f0d0
RMSE = 958.315
spam score = 51.6608
documents = 3199
clusterid = d6d465af0
RMSE = 959.544
spam score = 26
documents = 2
clusterid = d6dfb5610
RMSE = 959.678
spam score = 48.6667
documents = 3
clusterid = d6da5ab80
RMSE = 959.983
spam score = 37.4167
documents = 12
clusterid = d6e118520
RMSE = 960.088
spam score = 36.5
documents = 2
clusterid = d6dc19870
RMSE = 960.643
spam score = 59.6494
documents = 713
clusterid = d6d801cf0
RMSE = 965.637
spam score = 61.0758
documents = 501
clusterid = d6d9e19f0
RMSE = 966.116
spam score = 10
documents = 2
clusterid = d6db48bd0
RMSE = 966.133
spam score = 61.6724
documents = 818
clusterid = d6d942f10
RMSE = 967.141
spam score = 52.3978
documents = 8593
clusterid = d6df12860
RMSE = 970.621
spam score = 47.3754
documents = 4720
clusterid = d6e3c0f90
RMSE = 974.292
spam score = 46.2095
documents = 19500
clusterid = d6d910d50
RMSE = 975.936
spam score = 35.788
documents = 1901
clusterid = d6e28bf70
RMSE = 976.237
spam score = 29.7134
documents = 171
clusterid = d6e11c7f0
RMSE = 976.401
spam score = 51.3846
documents = 13478
clusterid = d6e259db0
RMSE = 978.422
spam score = 16.3544
documents = 601
clusterid = d6e3cd800
RMSE = 979.22
spam score = 68.1579
documents = 38
clusterid = d6d9e9f90
RMSE = 979.862
spam score = 50.3786
documents = 13889
clusterid = d6dff8310
RMSE = 981.801
spam score = 72.7703
documents = 74
clusterid = d6db727f0
RMSE = 982.356
spam score = 51.0692
documents = 17974
clusterid = d6dd57e40
RMSE = 985.005
spam score = 48.3706
documents = 18013
clusterid = d6da20420
RMSE = 985.5
spam score = 58.8814
documents = 59
clusterid = d6d6142a0
RMSE = 986.351
spam score = 21.9608
documents = 102
clusterid = d6d459180
RMSE = 989.373
spam score = 43.476
documents = 229
clusterid = d6dba8c80
RMSE = 992.857
spam score = 47.1772
documents = 24124
clusterid = d6d4b0d90
RMSE = 992.934
spam score = 45.8647
documents = 14548
clusterid = d6e2b9e60
RMSE = 993.212
spam score = 52.4649
documents = 8843
clusterid = d6d76a940
RMSE = 997
spam score = 51
documents = 1
clusterid = d6e10ff80
RMSE = 997.404
spam score = 40.7092
documents = 337
clusterid = d6d5ab850
RMSE = 997.681
spam score = 12.1124
documents = 169
clusterid = d6e0e6360
RMSE = 998.829
spam score = 57.381
documents = 517
clusterid = d6d82b2a0
RMSE = 1000.47
spam score = 51.7864
documents = 398
clusterid = d6d4fc230
RMSE = 1000.69
spam score = 47.9707
documents = 6931
clusterid = d6dabef00
RMSE = 1001.93
spam score = 39.25
documents = 4
clusterid = d6e31e1e0
RMSE = 1002.13
spam score = 44.1824
documents = 499
clusterid = d6d48b440
RMSE = 1003.26
spam score = 49.3851
documents = 148
clusterid = d6d47ebd0
RMSE = 1003.28
spam score = 55.3704
documents = 54
clusterid = d6e360ee0
RMSE = 1003.52
spam score = 42
documents = 9
clusterid = d6e294510
RMSE = 1003.67
spam score = 50.1021
documents = 28030
clusterid = d6d90ca80
RMSE = 1003.67
spam score = 19.6364
documents = 33
clusterid = d6e16bd60
RMSE = 1003.9
spam score = 46.5916
documents = 4109
clusterid = d6d985c10
RMSE = 1005.69
spam score = 61.4211
documents = 114
clusterid = d6e0bc740
RMSE = 1006.09
spam score = 43.8462
documents = 13
clusterid = d6db23280
RMSE = 1008.03
spam score = 53.7097
documents = 93
clusterid = d6d7344b0
RMSE = 1009.33
spam score = 22.5882
documents = 17
clusterid = d6df6e640
RMSE = 1010.39
spam score = 46.7511
documents = 3302
clusterid = d6dd04600
RMSE = 1010.63
spam score = 65.4286
documents = 35
clusterid = d6e290240
RMSE = 1011.19
spam score = 50
documents = 5
clusterid = d6e07dd10
RMSE = 1013.29
spam score = 49.75
documents = 72
clusterid = d6dcf3ac0
RMSE = 1016.85
spam score = 24.6239
documents = 896
clusterid = d6df0a2c0
RMSE = 1018.21
spam score = 23.6071
documents = 56
clusterid = d6e0d1550
RMSE = 1021.08
spam score = 52.2132
documents = 13591
clusterid = d6e262350
RMSE = 1024.67
spam score = 60.3333
documents = 6
clusterid = d6ded3e30
RMSE = 1026.32
spam score = 54.2574
documents = 11921
clusterid = d6ddb7ef0
RMSE = 1027.12
spam score = 50.75
documents = 580
clusterid = d6d8b9240
RMSE = 1029.41
spam score = 50.4379
documents = 1514
clusterid = d6d727c40
RMSE = 1029.79
spam score = 36.926
documents = 1325
clusterid = d6dbb54f0
RMSE = 1031.19
spam score = 39.725
documents = 40
clusterid = d6d9b7dd0
RMSE = 1033.51
spam score = 57.5059
documents = 170
clusterid = d6de45e90
RMSE = 1034.6
spam score = 26.7736
documents = 106
clusterid = d6d5c0660
RMSE = 1034.73
spam score = 46.5343
documents = 18123
clusterid = d6d5bc390
RMSE = 1034.85
spam score = 47.3446
documents = 2124
clusterid = d6e26a8f0
RMSE = 1035.86
spam score = 4.8
documents = 5
clusterid = d6e386830
RMSE = 1036.02
spam score = 40.1634
documents = 3813
clusterid = d6d5b80c0
RMSE = 1036.74
spam score = 38.9989
documents = 944
clusterid = d6db33dc0
RMSE = 1041.5
spam score = 71.67
documents = 300
clusterid = d6e2ad5f0
RMSE = 1044.28
spam score = 51.7797
documents = 295
clusterid = d6df33ee0
RMSE = 1045.26
spam score = 48.984
documents = 4371
clusterid = d6d65f540
RMSE = 1045.3
spam score = 53.081
documents = 543
clusterid = d6da3d7d0
RMSE = 1049.24
spam score = 48.0319
documents = 658
clusterid = d6d63dec0
RMSE = 1050.2
spam score = 48.7846
documents = 246
clusterid = d6dd3aa90
RMSE = 1050.29
spam score = 7.16667
documents = 42
clusterid = d6dd19410
RMSE = 1051.79
spam score = 75.5625
documents = 16
clusterid = d6d7fcbb0
RMSE = 1052.3
spam score = 47.1443
documents = 402
clusterid = d6deae4e0
RMSE = 1052.43
spam score = 48.0869
documents = 7425
clusterid = d6db2faf0
RMSE = 1052.92
spam score = 49.9895
documents = 7415
clusterid = d6d51d8b0
RMSE = 1053.72
spam score = 36.5222
documents = 2342
clusterid = d6d4f7f60
RMSE = 1056.04
spam score = 41.4802
documents = 4223
clusterid = d6d4592e0
RMSE = 1056.32
spam score = 69.3043
documents = 23
clusterid = d6e397370
RMSE = 1057.94
spam score = 35.5758
documents = 66
clusterid = d6d8d2320
RMSE = 1058.12
spam score = 30.4401
documents = 593
clusterid = d6dcc1900
RMSE = 1059.93
spam score = 58.625
documents = 8
clusterid = d6e0a7930
RMSE = 1069.77
spam score = 51.2313
documents = 13931
clusterid = d6d9c8910
RMSE = 1070.79
spam score = 49.5678
documents = 18623
clusterid = d6d98e1b0
RMSE = 1072.36
spam score = 25.955
documents = 200
clusterid = d6d953a50
RMSE = 1077.13
spam score = 51.7087
documents = 3533
clusterid = d6e1079e0
RMSE = 1077.65
spam score = 24.7636
documents = 1320
clusterid = d6ded8100
RMSE = 1078.11
spam score = 50.212
documents = 2387
clusterid = d6dd4b5d0
RMSE = 1080.6
spam score = 45.3917
documents = 3505
clusterid = d6de20540
RMSE = 1082.56
spam score = 62.1885
documents = 6871
clusterid = d6d6c7b90
RMSE = 1084.18
spam score = 76.9429
documents = 35
clusterid = d6df16b30
RMSE = 1084.19
spam score = 45.1262
documents = 34002
clusterid = d6d639bf0
RMSE = 1084.71
spam score = 48.2857
documents = 21
clusterid = d6d4163f0
RMSE = 1086.19
spam score = 65.4793
documents = 290
clusterid = d6df660a0
RMSE = 1087.14
spam score = 31.3368
documents = 9284
clusterid = d6dd68980
RMSE = 1087.2
spam score = 22.186
documents = 43
clusterid = d6e358940
RMSE = 1087.77
spam score = 12.4623
documents = 106
clusterid = d6d9feda0
RMSE = 1087.98
spam score = 51.9168
documents = 3824
clusterid = d6dfebaa0
RMSE = 1088.54
spam score = 29.4
documents = 5
clusterid = d6d712e30
RMSE = 1088.64
spam score = 75.7778
documents = 9
clusterid = d6d9323d0
RMSE = 1092.08
spam score = 52
documents = 3
clusterid = d6e2f45c0
RMSE = 1092.95
spam score = 55.748
documents = 123
clusterid = d6e3d1ad0
RMSE = 1093.23
spam score = 31.5476
documents = 42
clusterid = d6df1ae00
RMSE = 1094.16
spam score = 44.503
documents = 670
clusterid = d6e174300
RMSE = 1095.26
spam score = 46.4182
documents = 5567
clusterid = d6dae8b20
RMSE = 1096.19
spam score = 49.8191
documents = 4875
clusterid = d6d6b7050
RMSE = 1097.69
spam score = 42.6644
documents = 295
clusterid = d6d5c4930
RMSE = 1099.13
spam score = 57.9492
documents = 59
clusterid = d6d81a760
RMSE = 1099.37
spam score = 28.6027
documents = 73
clusterid = d6e3c5260
RMSE = 1099.82
spam score = 75.9628
documents = 323
clusterid = d6d4acac0
RMSE = 1101.31
spam score = 74.2195
documents = 205
clusterid = d6d6d86d0
RMSE = 1101.37
spam score = 48.2348
documents = 264
clusterid = d6dae4850
RMSE = 1102.98
spam score = 44.7296
documents = 196
clusterid = d6d487170
RMSE = 1103.18
spam score = 27.3333
documents = 3
clusterid = d6e0f2bd0
RMSE = 1105.46
spam score = 52.3878
documents = 49
clusterid = d6d9366a0
RMSE = 1108.31
spam score = 53.3463
documents = 2824
clusterid = d6d44c910
RMSE = 1108.95
spam score = 48.5731
documents = 965
clusterid = d6d8a8700
RMSE = 1110.19
spam score = 37.1579
documents = 38
clusterid = d6dcda9e0
RMSE = 1110.56
spam score = 51.4828
documents = 3451
clusterid = d6de5aca0
RMSE = 1113.1
spam score = 49.7778
documents = 9
clusterid = d6e3e2610
RMSE = 1115.42
spam score = 58.0355
documents = 141
clusterid = d6e021f30
RMSE = 1115.46
spam score = 48.4578
documents = 734
clusterid = d6de41bc0
RMSE = 1115.86
spam score = 52.1349
documents = 17981
clusterid = d6db0e470
RMSE = 1117.55
spam score = 49.9819
documents = 6173
clusterid = d6d603760
RMSE = 1118.37
spam score = 44.7379
documents = 2373
clusterid = d6e0156c0
RMSE = 1119.3
spam score = 60.2847
documents = 144
clusterid = d6e2e7d50
RMSE = 1119.32
spam score = 52.7627
documents = 177
clusterid = d6dcd2440
RMSE = 1121.61
spam score = 31.1935
documents = 31
clusterid = d6d794560
RMSE = 1123.99
spam score = 41.3333
documents = 51
clusterid = d6e2a0d80
RMSE = 1127.11
spam score = 26.1822
documents = 225
clusterid = d6e3930a0
RMSE = 1128.5
spam score = 38.8897
documents = 2221
clusterid = d6d7d2f90
RMSE = 1129.59
spam score = 15.8852
documents = 540
clusterid = d6e114250
RMSE = 1131.7
spam score = 52.4953
documents = 3864
clusterid = d6d8016c0
RMSE = 1132.29
spam score = 31.2857
documents = 7
clusterid = d6d42f560
RMSE = 1135.64
spam score = 38.6729
documents = 107
clusterid = d6d996750
RMSE = 1138.28
spam score = 22.4444
documents = 9
clusterid = d6d592770
RMSE = 1139.42
spam score = 43.7617
documents = 407
clusterid = d6e2b5b90
RMSE = 1141.69
spam score = 53.6505
documents = 1133
clusterid = d6d5e5fb0
RMSE = 1142.49
spam score = 44.2135
documents = 356
clusterid = d6d536990
RMSE = 1143.52
spam score = 69.75
documents = 4
clusterid = d6d59efe0
RMSE = 1143.63
spam score = 74.4211
documents = 19
clusterid = d6de0b730
RMSE = 1144.86
spam score = 53.7211
documents = 3836
clusterid = d6d47a900
RMSE = 1145.78
spam score = 52.0441
documents = 68
clusterid = d6d642190
RMSE = 1147.7
spam score = 13.7159
documents = 535
clusterid = d6dd2e220
RMSE = 1148.07
spam score = 32.5503
documents = 398
clusterid = d6db0a1a0
RMSE = 1150.46
spam score = 8.5443
documents = 79
clusterid = d6d81ea30
RMSE = 1150.66
spam score = 49.4251
documents = 5020
clusterid = d6da0f8e0
RMSE = 1150.91
spam score = 32.4859
documents = 8670
clusterid = d6dee4970
RMSE = 1151.36
spam score = 43.2148
documents = 270
clusterid = d6dbe76b0
RMSE = 1151.79
spam score = 48.0248
documents = 322
clusterid = d6e2be130
RMSE = 1152.12
spam score = 54.9382
documents = 2006
clusterid = d6def11e0
RMSE = 1154.43
spam score = 47.0296
documents = 372
clusterid = d6e14a6e0
RMSE = 1155.37
spam score = 24.8134
documents = 134
clusterid = d6d482ea0
RMSE = 1155.67
spam score = 43.2976
documents = 383
clusterid = d6dd85d30
RMSE = 1156.09
spam score = 46.5109
documents = 505
clusterid = d6dffc5e0
RMSE = 1157.06
spam score = 51.5263
documents = 1102
clusterid = d6e0c8fb0
RMSE = 1157.29
spam score = 55.3333
documents = 3
clusterid = d6d970e00
RMSE = 1157.42
spam score = 51.7513
documents = 792
clusterid = d6d9ab560
RMSE = 1162.59
spam score = 47.094
documents = 234
clusterid = d6d6e0c70
RMSE = 1163.02
spam score = 55.5
documents = 6
clusterid = d6d6e4f40
RMSE = 1163.5
spam score = 44.9387
documents = 163
clusterid = d6d6f9d50
RMSE = 1165.01
spam score = 45.7576
documents = 33
clusterid = d6e3da070
RMSE = 1166.47
spam score = 49.9626
documents = 107
clusterid = d6df0e590
RMSE = 1169.65
spam score = 51.4743
documents = 1031
clusterid = d6d9602c0
RMSE = 1169.66
spam score = 56
documents = 4
clusterid = d6e068f00
RMSE = 1169.96
spam score = 50.1176
documents = 34
clusterid = d6dbf3f20
RMSE = 1170.21
spam score = 46.381
documents = 21
clusterid = d6d3f4dc0
RMSE = 1172.48
spam score = 37.8253
documents = 3583
clusterid = d6e18d3e0
RMSE = 1172.59
spam score = 54.6576
documents = 14771
clusterid = d6daa1b50
RMSE = 1172.76
spam score = 71.2857
documents = 21
clusterid = d6e3093d0
RMSE = 1173.16
spam score = 44.4566
documents = 3309
clusterid = d6d9f2530
RMSE = 1175.25
spam score = 52.3159
documents = 3931
clusterid = d6e249270
RMSE = 1177.67
spam score = 58.6667
documents = 3
clusterid = d6d9faad0
RMSE = 1181.23
spam score = 50.5702
documents = 591
clusterid = d6dbb1220
RMSE = 1181.62
spam score = 49.0573
documents = 6864
clusterid = d6d837b10
RMSE = 1183.11
spam score = 46.9804
documents = 51
clusterid = d6dacfa40
RMSE = 1183.41
spam score = 31
documents = 2
clusterid = d6e1aea60
RMSE = 1184
spam score = 36.0128
documents = 3115
clusterid = d6dc97ce0
RMSE = 1185.64
spam score = 55.2443
documents = 3136
clusterid = d6df61dd0
RMSE = 1187.61
spam score = 70.7586
documents = 58
clusterid = d6d73ca50
RMSE = 1187.7
spam score = 45.0714
documents = 70
clusterid = d6d7c6720
RMSE = 1189.49
spam score = 25.6667
documents = 6
clusterid = d6d75e0d0
RMSE = 1193.24
spam score = 49
documents = 51
clusterid = d6dd1d6e0
RMSE = 1194.29
spam score = 60.4777
documents = 515
clusterid = d6ddc4760
RMSE = 1195.12
spam score = 43.4159
documents = 113
clusterid = d6db40630
RMSE = 1196.25
spam score = 32.994
documents = 167
clusterid = d6dc2a3b0
RMSE = 1196.82
spam score = 41.7138
documents = 842
clusterid = d6daaa0f0
RMSE = 1197.31
spam score = 25.1
documents = 10
clusterid = d6d9d9450
RMSE = 1197.77
spam score = 47.4
documents = 5
clusterid = d6d4b5060
RMSE = 1200.86
spam score = 44.9782
documents = 3351
clusterid = d6da03070
RMSE = 1201.25
spam score = 51.1266
documents = 20111
clusterid = d6dfe3500
RMSE = 1204.4
spam score = 26.9238
documents = 105
clusterid = d6d7f4610
RMSE = 1206.04
spam score = 55.2308
documents = 26
clusterid = d6df233a0
RMSE = 1207.15
spam score = 15.1003
documents = 379
clusterid = d6d4bd600
RMSE = 1207.29
spam score = 60.8418
documents = 196
clusterid = d6d6aa7e0
RMSE = 1209.92
spam score = 55.5788
documents = 8372
clusterid = d6d64ea00
RMSE = 1211.67
spam score = 59.6952
documents = 1926
clusterid = d6d915020
RMSE = 1212
spam score = 55.7042
documents = 4631
clusterid = d6d9750d0
RMSE = 1212.19
spam score = 57.3569
documents = 5262
clusterid = d6df27670
RMSE = 1212.62
spam score = 52.5714
documents = 7
clusterid = d6e39f910
RMSE = 1213.13
spam score = 44.2442
documents = 729
clusterid = d6d822d00
RMSE = 1214.07
spam score = 48.2308
documents = 13
clusterid = d6d759e00
RMSE = 1215.62
spam score = 49.6376
documents = 447
clusterid = d6e184e40
RMSE = 1218.25
spam score = 58.9116
documents = 181
clusterid = d6db3c360
RMSE = 1218.96
spam score = 61.625
documents = 8
clusterid = d6dd15140
RMSE = 1223.74
spam score = 59.2033
documents = 1977
clusterid = d6dfca420
RMSE = 1224.48
spam score = 45.5107
documents = 6336
clusterid = d6e1e4ef0
RMSE = 1224.53
spam score = 58
documents = 21
clusterid = d6de28ae0
RMSE = 1225.11
spam score = 65.2606
documents = 660
clusterid = d6de5ef70
RMSE = 1225.27
spam score = 40.8333
documents = 24
clusterid = d6e0d5820
RMSE = 1225.52
spam score = 49.0584
documents = 137
clusterid = d6d4eb6f0
RMSE = 1226.65
spam score = 55.5726
documents = 7017
clusterid = d6e206570
RMSE = 1229.14
spam score = 58.1667
documents = 24
clusterid = d6d929e30
RMSE = 1230.49
spam score = 30.6048
documents = 3806
clusterid = d6e189110
RMSE = 1231.8
spam score = 55.9295
documents = 156
clusterid = d6d500500
RMSE = 1233.16
spam score = 55.7919
documents = 221
clusterid = d6dd00330
RMSE = 1233.19
spam score = 7.5
documents = 2
clusterid = d6d49bf80
RMSE = 1233.81
spam score = 8.5
documents = 2
clusterid = d6dceb520
RMSE = 1235.21
spam score = 51.5556
documents = 18
clusterid = d6dbeb980
RMSE = 1236.49
spam score = 51.6513
documents = 304
clusterid = d6d95bff0
RMSE = 1240.17
spam score = 62.5625
documents = 16
clusterid = d6d652cd0
RMSE = 1242.14
spam score = 52.3595
documents = 10253
clusterid = d6dcc5bd0
RMSE = 1243.59
spam score = 32.6
documents = 5
clusterid = d6d79cb00
RMSE = 1244.05
spam score = 24.75
documents = 4
clusterid = d6dc69df0
RMSE = 1245
spam score = 73.8
documents = 5
clusterid = d6d667ae0
RMSE = 1247.32
spam score = 56.1667
documents = 6
clusterid = d6dee8c40
RMSE = 1247.44
spam score = 26.8214
documents = 224
clusterid = d6e3651b0
RMSE = 1247.55
spam score = 28.4677
documents = 1208
clusterid = d6e092b20
RMSE = 1248.09
spam score = 54.375
documents = 8
clusterid = d6e0540f0
RMSE = 1251.3
spam score = 48.0276
documents = 181
clusterid = d6dfc6150
RMSE = 1251.68
spam score = 43
documents = 2
clusterid = d6d9f6800
RMSE = 1252.64
spam score = 61.0639
documents = 2190
clusterid = d6e20eb10
RMSE = 1254.6
spam score = 40.4
documents = 5
clusterid = d6dfc1e80
RMSE = 1255.08
spam score = 49.0151
documents = 265
clusterid = d6e33b590
RMSE = 1255.91
spam score = 38.7547
documents = 53
clusterid = d6e14e9b0
RMSE = 1255.97
spam score = 56.2485
documents = 2109
clusterid = d6d515310
RMSE = 1258.64
spam score = 36.4463
documents = 1154
clusterid = d6e2a9320
RMSE = 1258.64
spam score = 28.4062
documents = 96
clusterid = d6e30d6a0
RMSE = 1259.44
spam score = 56.2045
documents = 1066
clusterid = d6e1e0c20
RMSE = 1262.93
spam score = 43.7759
documents = 58
clusterid = d6d7f0340
RMSE = 1264.45
spam score = 19.1778
documents = 45
clusterid = d6dd29f50
RMSE = 1265.51
spam score = 52.6895
documents = 525
clusterid = d6e0435b0
RMSE = 1266.91
spam score = 37.8889
documents = 9
clusterid = d6db01c00
RMSE = 1267.56
spam score = 73.4
documents = 30
clusterid = d6d71f6a0
RMSE = 1270.19
spam score = 54.3482
documents = 336
clusterid = d6d833840
RMSE = 1270.49
spam score = 48.7321
documents = 2583
clusterid = d6e152c80
RMSE = 1274.8
spam score = 50.4583
documents = 24
clusterid = d6de6b7e0
RMSE = 1276.3
spam score = 53.2768
documents = 9759
clusterid = d6dd367c0
RMSE = 1276.86
spam score = 36.6429
documents = 14
clusterid = d6e3e68e0
RMSE = 1277.19
spam score = 55.4159
documents = 1070
clusterid = d6d454eb0
RMSE = 1278.77
spam score = 48.8711
documents = 1272
clusterid = d6dea5f40
RMSE = 1280.12
spam score = 31.65
documents = 520
clusterid = d6e251810
RMSE = 1281.7
spam score = 58.5949
documents = 79
clusterid = d6e0b41a0
RMSE = 1283.64
spam score = 54.1838
documents = 1921
clusterid = d6d3e41f0
RMSE = 1283.9
spam score = 43.118
documents = 924
clusterid = d6e1bb2d0
RMSE = 1284
spam score = 46.3886
documents = 8491
clusterid = d6e1cbe10
RMSE = 1284.59
spam score = 34.5088
documents = 57
clusterid = d6dc260e0
RMSE = 1286.01
spam score = 38.6364
documents = 11
clusterid = d6e3503a0
RMSE = 1286.35
spam score = 34.3939
documents = 4880
clusterid = d6d6f5a80
RMSE = 1286.57
spam score = 58.1687
documents = 1168
clusterid = d6de4e430
RMSE = 1288.85
spam score = 54.4743
documents = 6529
clusterid = d6d9d0eb0
RMSE = 1289.4
spam score = 40.8008
documents = 4383
clusterid = d6d865a00
RMSE = 1290.31
spam score = 38.2667
documents = 15
clusterid = d6e12d330
RMSE = 1290.65
spam score = 47.0925
documents = 6248
clusterid = d6d8ce050
RMSE = 1291.17
spam score = 49.1429
documents = 7
clusterid = d6e008e50
RMSE = 1291.93
spam score = 38.7313
documents = 320
clusterid = d6dd088d0
RMSE = 1292.92
spam score = 40.0309
documents = 8993
clusterid = d6d801da0
RMSE = 1293.56
spam score = 47.4221
documents = 2826
clusterid = d6e343b30
RMSE = 1296.45
spam score = 44.0526
documents = 19
clusterid = d6d8eb400
RMSE = 1296.69
spam score = 56.0781
documents = 1409
clusterid = d6d663810
RMSE = 1298.21
spam score = 44.1333
documents = 15
clusterid = d6df8b9f0
RMSE = 1298.58
spam score = 31.1173
documents = 375
clusterid = d6e03b010
RMSE = 1298.72
spam score = 52.0816
documents = 1115
clusterid = d6e0c4ce0
RMSE = 1300.35
spam score = 56.8492
documents = 2679
clusterid = d6dbd6b70
RMSE = 1303.25
spam score = 55.0137
documents = 4463
clusterid = d6d96cb30
RMSE = 1304.19
spam score = 47.0723
documents = 470
clusterid = d6df76be0
RMSE = 1305.27
spam score = 59.8889
documents = 198
clusterid = d6d656fa0
RMSE = 1306.46
spam score = 54.3904
documents = 2487
clusterid = d6dc9bfb0
RMSE = 1307.34
spam score = 47.8333
documents = 6
clusterid = d6d87eae0
RMSE = 1308.46
spam score = 41.3939
documents = 66
clusterid = d6de13cd0
RMSE = 1309.5
spam score = 39.0459
documents = 283
clusterid = d6d6f17b0
RMSE = 1309.53
spam score = 19.8545
documents = 55
clusterid = d6d5ea540
RMSE = 1310.04
spam score = 47.7692
documents = 13
clusterid = d6e34c0d0
RMSE = 1311.86
spam score = 45.8041
documents = 2287
clusterid = d6d54fa70
RMSE = 1312.11
spam score = 62.8
documents = 5
clusterid = d6d4058b0
RMSE = 1312.3
spam score = 31.8571
documents = 14
clusterid = d6dd794c0
RMSE = 1313.2
spam score = 49.4
documents = 5
clusterid = d6d422cf0
RMSE = 1314.02
spam score = 36.7727
documents = 22
clusterid = d6e1f1760
RMSE = 1315.86
spam score = 54.3019
documents = 53
clusterid = d6d826fd0
RMSE = 1315.94
spam score = 56.5
documents = 12
clusterid = d6e129060
RMSE = 1316.39
spam score = 49.5716
documents = 4580
clusterid = d6d7b5be0
RMSE = 1317.58
spam score = 44.3384
documents = 1442
clusterid = d6dfefd70
RMSE = 1317.72
spam score = 48.4653
documents = 245
clusterid = d6df2b940
RMSE = 1318.78
spam score = 61.0588
documents = 17
clusterid = d6d72bf10
RMSE = 1318.93
spam score = 49.225
documents = 40
clusterid = d6d989ee0
RMSE = 1318.93
spam score = 58.6276
documents = 392
clusterid = d6d8400b0
RMSE = 1319.52
spam score = 35.8
documents = 5
clusterid = d6d4def40
RMSE = 1320.69
spam score = 44.6364
documents = 11
clusterid = d6d882db0
RMSE = 1320.87
spam score = 42.6842
documents = 114
clusterid = d6d459230
RMSE = 1321.47
spam score = 48.6032
documents = 63
clusterid = d6dd4f8a0
RMSE = 1324.28
spam score = 52.4806
documents = 310
clusterid = d6dce7250
RMSE = 1325.32
spam score = 50.453
documents = 5867
clusterid = d6d43bdd0
RMSE = 1325.83
spam score = 32.3333
documents = 3
clusterid = d6e24d540
RMSE = 1325.86
spam score = 23.2832
documents = 678
clusterid = d6dee06a0
RMSE = 1326.89
spam score = 45.2857
documents = 7
clusterid = d6e1f9d00
RMSE = 1326.98
spam score = 42.2
documents = 5
clusterid = d6de4a160
RMSE = 1327.02
spam score = 66.873
documents = 614
clusterid = d6d93ec40
RMSE = 1328.62
spam score = 34.3971
documents = 622
clusterid = d6daf10c0
RMSE = 1328.83
spam score = 37.0357
documents = 56
clusterid = d6dd47300
RMSE = 1330.22
spam score = 49.014
documents = 4131
clusterid = d6d5710f0
RMSE = 1331.41
spam score = 57.3354
documents = 2367
clusterid = d6e08a580
RMSE = 1331.77
spam score = 46.0556
documents = 36
clusterid = d6da4a040
RMSE = 1332.08
spam score = 25.0176
documents = 454
clusterid = d6d4ce140
RMSE = 1334.27
spam score = 55.9193
documents = 2949
clusterid = d6d3e84c0
RMSE = 1334.72
spam score = 52.3253
documents = 83
clusterid = d6d7ec070
RMSE = 1335.5
spam score = 50.2083
documents = 24
clusterid = d6e004b80
RMSE = 1338.09
spam score = 62.2643
documents = 4223
clusterid = d6e032a70
RMSE = 1338.65
spam score = 53.8852
documents = 4250
clusterid = d6db6a250
RMSE = 1341.73
spam score = 21.1212
documents = 33
clusterid = d6d8b0ca0
RMSE = 1342.23
spam score = 51.8456
documents = 2280
clusterid = d6e103710
RMSE = 1343.01
spam score = 55.0401
documents = 1521
clusterid = d6dd10e70
RMSE = 1344.33
spam score = 51.5915
documents = 328
clusterid = d6d5c8c00
RMSE = 1344.81
spam score = 26.0909
documents = 33
clusterid = d6e22bec0
RMSE = 1345.06
spam score = 16.25
documents = 24
clusterid = d6dcd6710
RMSE = 1345.09
spam score = 29.8291
documents = 199
clusterid = d6d8ac9d0
RMSE = 1345.48
spam score = 23.1667
documents = 6
clusterid = d6dd25c80
RMSE = 1347.89
spam score = 58.8903
documents = 1085
clusterid = d6d62d380
RMSE = 1348.33
spam score = 29
documents = 6
clusterid = d6e39b640
RMSE = 1349.64
spam score = 49.7237
documents = 1647
clusterid = d6ddccd00
RMSE = 1352.49
spam score = 36.5945
documents = 1201
clusterid = d6db83330
RMSE = 1356.06
spam score = 48.0455
documents = 418
clusterid = d6de39620
RMSE = 1359.51
spam score = 60.8357
documents = 140
clusterid = d6d4a4520
RMSE = 1360.16
spam score = 32.954
documents = 87
clusterid = d6df40750
RMSE = 1360.68
spam score = 53.1797
documents = 7085
clusterid = d6dc8f740
RMSE = 1361.23
spam score = 9.55451
documents = 1064
clusterid = d6db4cea0
RMSE = 1364.34
spam score = 60.2743
documents = 1768
clusterid = d6d5d9740
RMSE = 1364.73
spam score = 52.5167
documents = 2369
clusterid = d6d437b00
RMSE = 1368.05
spam score = 51.3111
documents = 5525
clusterid = d6de63240
RMSE = 1369.44
spam score = 57.2812
documents = 64
clusterid = d6db38090
RMSE = 1369.46
spam score = 61.0595
documents = 4170
clusterid = d6e287ca0
RMSE = 1369.55
spam score = 44.5485
documents = 423
clusterid = d6d469dc0
RMSE = 1370.34
spam score = 58.3774
documents = 106
clusterid = d6e13de70
RMSE = 1370.98
spam score = 50.6923
documents = 312
clusterid = d6defda50
RMSE = 1372.07
spam score = 37.47
documents = 100
clusterid = d6e212de0
RMSE = 1373.07
spam score = 45.1035
documents = 802
clusterid = d6ddd9570
RMSE = 1373.49
spam score = 23.0541
documents = 555
clusterid = d6d525e50
RMSE = 1373.8
spam score = 44.7806
documents = 196
clusterid = d6d9d5180
RMSE = 1374.84
spam score = 57.072
documents = 389
clusterid = d6df44a20
RMSE = 1377.73
spam score = 37.8517
documents = 391
clusterid = d6dab2690
RMSE = 1378.45
spam score = 59.4691
documents = 4014
clusterid = d6da673f0
RMSE = 1379.61
spam score = 46.6587
documents = 167
clusterid = d6d99ecf0
RMSE = 1380.45
spam score = 55.8753
documents = 2902
clusterid = d6e23ca00
RMSE = 1382.61
spam score = 3.93103
documents = 29
clusterid = d6df83450
RMSE = 1382.65
spam score = 46.9067
documents = 1768
clusterid = d6dcf7d90
RMSE = 1385.8
spam score = 47.0322
documents = 2888
clusterid = d6e3372c0
RMSE = 1386.49
spam score = 42.0802
documents = 1533
clusterid = d6d5d11a0
RMSE = 1393.33
spam score = 48.2133
documents = 75
clusterid = d6da995b0
RMSE = 1394.8
spam score = 38.8093
documents = 1594
clusterid = d6df51290
RMSE = 1395.76
spam score = 47.1299
documents = 4836
clusterid = d6d6dc9a0
RMSE = 1395.9
spam score = 60.4252
documents = 769
clusterid = d6d426fc0
RMSE = 1397.51
spam score = 56.568
documents = 3220
clusterid = d6e3bccc0
RMSE = 1399.36
spam score = 60.318
documents = 4563
clusterid = d6de0fa00
RMSE = 1399.56
spam score = 34.5323
documents = 62
clusterid = d6e29cab0
RMSE = 1400.23
spam score = 16.4615
documents = 26
clusterid = d6da91010
RMSE = 1400.83
spam score = 53.9601
documents = 4710
clusterid = d6d9793a0
RMSE = 1401.79
spam score = 54.2581
documents = 31
clusterid = d6df72910
RMSE = 1402.95
spam score = 34.6701
documents = 673
clusterid = d6d680bc0
RMSE = 1403.49
spam score = 55.9491
documents = 2908
clusterid = d6ddc8a30
RMSE = 1403.81
spam score = 51.9548
documents = 1085
clusterid = d6dcdecb0
RMSE = 1403.95
spam score = 95.4444
documents = 27
clusterid = d6da847a0
RMSE = 1405
spam score = 52.8723
documents = 47
clusterid = d6d94b4b0
RMSE = 1405.81
spam score = 47.7311
documents = 119
clusterid = d6d631650
RMSE = 1407
spam score = 50.1071
documents = 28
clusterid = d6dc04a60
RMSE = 1407.49
spam score = 45.5069
documents = 73
clusterid = d6dbb97c0
RMSE = 1409.36
spam score = 46.1765
documents = 17
clusterid = d6df6a370
RMSE = 1410.87
spam score = 50.0343
documents = 2597
clusterid = d6d8c17e0
RMSE = 1411.96
spam score = 49.3983
documents = 585
clusterid = d6ddf6920
RMSE = 1414.39
spam score = 60.7826
documents = 69
clusterid = d6d50cd70
RMSE = 1415.15
spam score = 44.2119
documents = 2147
clusterid = d6e02a4d0
RMSE = 1416.65
spam score = 46.8903
documents = 1477
clusterid = d6d4a87f0
RMSE = 1417.77
spam score = 50.5689
documents = 2781
clusterid = d6e223920
RMSE = 1418
spam score = 46.0094
documents = 212
clusterid = d6d801c40
RMSE = 1418.28
spam score = 38.7408
documents = 355
clusterid = d6e1a64c0
RMSE = 1421.68
spam score = 48.2245
documents = 3969
clusterid = d6e1358d0
RMSE = 1423.05
spam score = 44.6667
documents = 1311
clusterid = d6d409b80
RMSE = 1425.21
spam score = 48.364
documents = 4211
clusterid = d6e255ae0
RMSE = 1425.26
spam score = 53.9951
documents = 809
clusterid = d6d5f6f10
RMSE = 1426.51
spam score = 49.92
documents = 50
clusterid = d6dfe77d0
RMSE = 1427.17
spam score = 51.534
documents = 294
clusterid = d6d766670
RMSE = 1429.16
spam score = 49.0052
documents = 7463
clusterid = d6e1aa790
RMSE = 1430.96
spam score = 51.4545
documents = 11
clusterid = d6dad7fe0
RMSE = 1431.43
spam score = 41.7231
documents = 65
clusterid = d6e0d9af0
RMSE = 1435.84
spam score = 50.916
documents = 4774
clusterid = d6e244fa0
RMSE = 1436.54
spam score = 44.3466
documents = 2138
clusterid = d6d5195e0
RMSE = 1439.02
spam score = 48.2751
documents = 229
clusterid = d6e0583c0
RMSE = 1441.19
spam score = 64.8667
documents = 30
clusterid = d6e2f8890
RMSE = 1443.35
spam score = 54.8692
documents = 887
clusterid = d6ddfeec0
RMSE = 1444.36
spam score = 30.5549
documents = 1429
clusterid = d6d91d5c0
RMSE = 1449.03
spam score = 56.1077
documents = 1587
clusterid = d6da568b0
RMSE = 1449.58
spam score = 53.1905
documents = 3779
clusterid = d6e3eabb0
RMSE = 1449.85
spam score = 49.6954
documents = 476
clusterid = d6e227bf0
RMSE = 1451.2
spam score = 51.9091
documents = 22
clusterid = d6d433830
RMSE = 1452.06
spam score = 31.3304
documents = 224
clusterid = d6d670080
RMSE = 1452.8
spam score = 48.5714
documents = 21
clusterid = d6d6cbe60
RMSE = 1457.9
spam score = 48.1872
documents = 235
clusterid = d6df7aeb0
RMSE = 1458.38
spam score = 52.6
documents = 15
clusterid = d6dcacaf0
RMSE = 1459.25
spam score = 49.87
documents = 2062
clusterid = d6d497cb0
RMSE = 1459.38
spam score = 32.5
documents = 6
clusterid = d6e369480
RMSE = 1461.84
spam score = 53
documents = 8
clusterid = d6d5ea800
RMSE = 1462.9
spam score = 34.7273
documents = 99
clusterid = d6e0ea630
RMSE = 1464
spam score = 17
documents = 1
clusterid = d6de31080
RMSE = 1464.76
spam score = 58.2835
documents = 1873
clusterid = d6d543200
RMSE = 1465.18
spam score = 32.6789
documents = 299
clusterid = d6decfb60
RMSE = 1466.7
spam score = 28.0526
documents = 57
clusterid = d6e170030
RMSE = 1467.14
spam score = 55.4324
documents = 37
clusterid = d6dcce170
RMSE = 1468.75
spam score = 54.4996
documents = 1233
clusterid = d6e1f5a30
RMSE = 1469.04
spam score = 44.6828
documents = 2295
clusterid = d6d66bdb0
RMSE = 1470.83
spam score = 57.5804
documents = 112
clusterid = d6d3f0a60
RMSE = 1473.69
spam score = 45.8329
documents = 808
clusterid = d6d4ef9c0
RMSE = 1479.41
spam score = 54.5627
documents = 574
clusterid = d6d8c9d80
RMSE = 1481.97
spam score = 52.7747
documents = 3294
clusterid = d6d921890
RMSE = 1482.2
spam score = 49.4871
documents = 3342
clusterid = d6d981940
RMSE = 1482.37
spam score = 47.5556
documents = 9
clusterid = d6db7f060
RMSE = 1485.57
spam score = 56.6667
documents = 27
clusterid = d6db93e70
RMSE = 1487.43
spam score = 20.4615
documents = 13
clusterid = d6d6a2240
RMSE = 1491.63
spam score = 45.9599
documents = 1422
clusterid = d6d3f9060
RMSE = 1492.7
spam score = 40.8936
documents = 47
clusterid = d6d9e5cc0
RMSE = 1494.64
spam score = 61.4667
documents = 45
clusterid = d6dfd29c0
RMSE = 1494.88
spam score = 49.1667
documents = 54
clusterid = d6db98140
RMSE = 1497.73
spam score = 41.1576
documents = 330
clusterid = d6e0113f0
RMSE = 1501.29
spam score = 56.4815
documents = 54
clusterid = d6ddbc1c0
RMSE = 1501.63
spam score = 52.4162
documents = 1002
clusterid = d6de88b90
RMSE = 1503.57
spam score = 55.0537
documents = 447
clusterid = d6dd925a0
RMSE = 1513.94
spam score = 46.9222
documents = 90
clusterid = d6dbd28a0
RMSE = 1516.66
spam score = 44.2829
documents = 251
clusterid = d6dcfc060
RMSE = 1517.61
spam score = 49.2661
documents = 109
clusterid = d6e17c8a0
RMSE = 1520.78
spam score = 58.2941
documents = 17
clusterid = d6e21f650
RMSE = 1525.63
spam score = 49.9648
documents = 199
clusterid = d6dd751f0
RMSE = 1526.06
spam score = 49.702
documents = 1084
clusterid = d6db8b8d0
RMSE = 1533.35
spam score = 53.1537
documents = 488
clusterid = d6e2db4e0
RMSE = 1544
spam score = 86
documents = 1
clusterid = d6d444370
RMSE = 1551.28
spam score = 61
documents = 16
clusterid = d6dc61850
RMSE = 1557.15
spam score = 44.3161
documents = 155
clusterid = d6dbe33e0
RMSE = 1563.53
spam score = 55.7732
documents = 313
clusterid = d6df59830
RMSE = 1573.29
spam score = 56.4623
documents = 385
clusterid = d6dbdf110
RMSE = 1575.74
spam score = 49.5
documents = 16
clusterid = d6da5ee50
RMSE = 1578.33
spam score = 14.4
documents = 5
clusterid = d6dd8e2d0
RMSE = 1579.04
spam score = 23
documents = 7
clusterid = d6db7ad90
RMSE = 1613.82
spam score = 37.1429
documents = 7
clusterid = d6d801140
RMSE = 1636.81
spam score = 47.4151
documents = 53
clusterid = d6d88f620
RMSE = 1637.93
spam score = 48.4928
documents = 69
clusterid = d6d4939e0
RMSE = 1645
spam score = 92
documents = 1
clusterid = d6e0ff440
RMSE = 1732.54
spam score = 45.5714
documents = 7
clusterid = d6d798830
RMSE = 1798
spam score = 33
documents = 1
distance = 0
spam score = 16
title = ''

distance = 0
spam score = 19
title = 'grid 5925'

distance = 0
spam score = 19
title = 'grid 5319'

distance = 0
spam score = 19
title = 'grid 5316'

distance = 0
spam score = 19
title = 'grid 5313'

distance = 0
spam score = 19
title = 'grid 5311'

distance = 0
spam score = 19
title = 'grid 5959'

distance = 0
spam score = 19
title = 'grid 5958'

distance = 0
spam score = 20
title = 'grid 5956'

distance = 0
spam score = 19
title = 'grid 5955'

distance = 0
spam score = 19
title = 'grid 5953'

distance = 0
spam score = 19
title = 'grid 5927'

distance = 0
spam score = 19
title = 'grid 5951'

distance = 0
spam score = 19
title = 'grid 5314'

distance = 0
spam score = 19
title = 'grid 5926'

distance = 0
spam score = 20
title = 'grid 5954'

distance = 0
spam score = 20
title = 'grid 5929'

distance = 0
spam score = 19
title = 'grid 5928'

distance = 0
spam score = 19
title = 'grid 5924'

distance = 0
spam score = 19
title = 'grid 5923'

distance = 0
spam score = 19
title = 'grid 5922'

distance = 0
spam score = 19
title = 'grid 5945'

distance = 0
spam score = 19
title = 'grid 5944'

distance = 0
spam score = 19
title = 'grid 5943'

distance = 0
spam score = 19
title = 'grid 5942'

distance = 0
spam score = 19
title = 'grid 5941'

distance = 0
spam score = 19
title = 'grid 5921'

distance = 0
spam score = 19
title = 'grid 5988'

distance = 0
spam score = 19
title = 'grid 5987'

distance = 0
spam score = 19
title = 'grid 5346'

distance = 0
spam score = 19
title = 'grid 5984'

distance = 0
spam score = 19
title = 'grid 5384'

distance = 0
spam score = 20
title = 'grid 5379'

distance = 0
spam score = 20
title = 'grid 5377'

distance = 0
spam score = 19
title = 'grid 5374'

distance = 0
spam score = 19
title = 'grid 5372'

distance = 0
spam score = 20
title = 'grid 5383'

distance = 0
spam score = 19
title = 'grid 5382'

distance = 0
spam score = 20
title = 'grid 5772'

distance = 0
spam score = 20
title = 'grid 5735'

distance = 0
spam score = 21
title = 'grid 5716'

distance = 0
spam score = 19
title = 'grid 5355'

distance = 0
spam score = 19
title = 'grid 5353'

distance = 0
spam score = 19
title = 'grid 5352'

distance = 0
spam score = 19
title = 'grid 5369'

distance = 0
spam score = 19
title = 'grid 5366'

distance = 0
spam score = 19
title = 'grid 5364'

distance = 0
spam score = 19
title = 'grid 5351'

distance = 0
spam score = 19
title = 'grid 5362'

distance = 0
spam score = 19
title = 'grid 5361'

distance = 0
spam score = 19
title = 'grid 5365'

distance = 0
spam score = 20
title = 'grid 5323'

distance = 0
spam score = 19
title = 'grid 5358'

distance = 0
spam score = 19
title = 'grid 5356'

distance = 0
spam score = 19
title = 'grid 5354'

distance = 0
spam score = 18
title = 'grid 5293'

distance = 0
spam score = 20
title = 'grid 5248'

distance = 0
spam score = 19
title = 'grid 5247'

distance = 0
spam score = 20
title = 'grid 5243'

distance = 0
spam score = 20
title = 'grid 5242'

distance = 0
spam score = 19
title = 'grid 5241'

distance = 0
spam score = 19
title = 'grid 5569'

distance = 0
spam score = 19
title = 'grid 5568'

distance = 0
spam score = 19
title = 'grid 5565'

distance = 0
spam score = 19
title = 'grid 5227'

distance = 0
spam score = 19
title = 'grid 5562'

distance = 0
spam score = 19
title = 'grid 5517'

distance = 0
spam score = 20
title = 'grid 5514'

distance = 0
spam score = 19
title = 'grid 5519'

distance = 0
spam score = 19
title = 'grid 5518'

distance = 0
spam score = 20
title = 'grid 5515'

distance = 0
spam score = 19
title = 'grid 5233'

distance = 0
spam score = 19
title = 'grid 5239'

distance = 0
spam score = 18
title = 'grid 5292'

distance = 0
spam score = 19
title = 'grid 5219'

distance = 0
spam score = 19
title = 'grid 5217'

distance = 0
spam score = 19
title = 'grid 5216'

distance = 0
spam score = 19
title = 'grid 5215'

distance = 0
spam score = 19
title = 'grid 5214'

distance = 0
spam score = 19
title = 'grid 5298'

distance = 0
spam score = 19
title = 'grid 5299'

distance = 0
spam score = 19
title = 'grid 5531'

distance = 0
spam score = 19
title = 'grid 5971'

distance = 0
spam score = 19
title = 'grid 5551'

distance = 0
spam score = 19
title = 'grid 5536'

distance = 0
spam score = 19
title = 'grid 5535'

distance = 0
spam score = 19
title = 'grid 5534'

distance = 0
spam score = 19
title = 'grid 5556'

distance = 0
spam score = 19
title = 'grid 5555'

distance = 0
spam score = 19
title = 'grid 5554'

distance = 0
spam score = 19
title = 'grid 5553'

distance = 0
spam score = 19
title = 'grid 5587'

distance = 0
spam score = 18
title = 'grid 5574'

distance = 0
spam score = 19
title = 'grid 5573'

distance = 0
spam score = 19
title = 'grid 5572'

distance = 0
spam score = 18
title = 'grid 5571'

distance = 0
spam score = 19
title = 'grid 5599'

distance = 0
spam score = 19
title = 'grid 5597'

distance = 0
spam score = 18
title = 'grid 5594'

distance = 0
spam score = 19
title = 'grid 5593'

distance = 0
spam score = 18
title = 'grid 5591'

distance = 0
spam score = 19
title = 'grid 5586'

distance = 0
spam score = 19
title = 'grid 5582'

distance = 0
spam score = 19
title = 'grid 5581'

distance = 0
spam score = 19
title = 'grid 5577'

distance = 0
spam score = 19
title = 'grid 5598'

distance = 0
spam score = 19
title = 'grid 5596'

distance = 0
spam score = 20
title = 'grid 5578'

distance = 0
spam score = 19
title = 'grid 5576'

distance = 0
spam score = 8
title = ''

distance = 0
spam score = 3
title = ''

distance = 0
spam score = 96
title = ''

distance = 0
spam score = 63
title = ''

distance = 0
spam score = 72
title = ''

distance = 0
spam score = 72
title = ''

distance = 0
spam score = 69
title = ''

distance = 0
spam score = 59
title = ''

distance = 0
spam score = 35
title = ''

distance = 0
spam score = 45
title = ''

distance = 0
spam score = 43
title = ''

distance = 0
spam score = 69
title = ''

distance = 0
spam score = 58
title = ''

distance = 0
spam score = 58
title = ''

distance = 0
spam score = 58
title = ''

distance = 0
spam score = 14
title = ''

distance = 0
spam score = 31
title = ''

distance = 0
spam score = 55
title = ''

distance = 5
spam score = 51
title = ''

distance = 11
spam score = 53
title = ''

distance = 11
spam score = 53
title = ''

distance = 16
spam score = 53
title = ''

distance = 0
spam score = 44
title = ''

distance = 0
spam score = 44
title = ''

distance = 37
spam score = 46
title = ''

distance = 3
spam score = 55
title = ''

distance = 6
spam score = 53
title = ''

distance = 6
spam score = 55
title = ''

distance = 10
spam score = 54
title = ''

distance = 14
spam score = 53
title = ''

distance = 14
spam score = 52
title = ''

distance = 27
spam score = 53
title = ''

distance = 40
spam score = 52
title = ''

distance = 41
spam score = 51
title = ''

distance = 58
spam score = 56
title = ''

distance = 41
spam score = 53
title = ''

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 51
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 1727
spam score = 44
title = ''

distance = 1731
spam score = 63
title = 'wikipedia on regular expressions and unicode the pug automatic'

distance = 1741
spam score = 46
title = ''

distance = 1745
spam score = 14
title = 'football stadiums of the world fussballstadien der welt stades de football du monde'

distance = 1755
spam score = 80
title = 'case 49'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 52
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 53
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 51
spam score = 54
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 52
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 54
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 54
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 54
title = 'free'

distance = 61
spam score = 53
title = 'free'

distance = 61
spam score = 54
title = 'free'

distance = 1753
spam score = 53
title = 'fourth workshop on nonlinear dynamics and earthquake prediction'

distance = 64
spam score = 37
title = ''

distance = 0
spam score = 51
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 51
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 52
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 91
spam score = 51
title = 'free'

distance = 1718
spam score = 61
title = 'cis 307 protected bounded buffers'

distance = 1783
spam score = 7
title = 'jian'

distance = 1804
spam score = 36
title = 'test monthly county query1'

distance = 1816
spam score = 2
title = 'propecia rogaine versus'

distance = 1851
spam score = 37
title = ''

distance = 1907
spam score = 65
title = 'sitalkuchi block'

distance = 0
spam score = 60
title = ''

distance = 0
spam score = 60
title = ''

distance = 0
spam score = 59
title = ''

distance = 0
spam score = 59
title = ''

distance = 0
spam score = 60
title = ''

distance = 0
spam score = 60
title = ''

distance = 0
spam score = 59
title = ''

distance = 0
spam score = 60
title = ''

distance = 0
spam score = 61
title = ''

distance = 0
spam score = 61
title = ''

distance = 0
spam score = 59
title = ''

distance = 0
spam score = 61
title = ''

distance = 0
spam score = 60
title = ''

distance = 0
spam score = 61
title = ''

distance = 0
spam score = 60
title = ''

distance = 0
spam score = 59
title = ''

distance = 0
spam score = 60
title = ''

distance = 0
spam score = 59
title = ''

distance = 0
spam score = 59
title = ''

distance = 317
spam score = 56
title = ''

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 52
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 87
spam score = 53
title = 'free'

distance = 87
spam score = 52
title = 'free'

distance = 1894
spam score = 48
title = 'pysideqtcore mdash pyside 110 documentation'

distance = 42
spam score = 13
title = ''

distance = 52
spam score = 15
title = ''

distance = 115
spam score = 14
title = ''

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 54
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 54
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 54
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 54
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 27
spam score = 53
title = 'free'

distance = 55
spam score = 54
title = 'free'

distance = 55
spam score = 54
title = 'free'

distance = 55
spam score = 55
title = 'free'

distance = 55
spam score = 54
title = 'free'

distance = 55
spam score = 54
title = 'free'

distance = 55
spam score = 54
title = 'free'

distance = 55
spam score = 54
title = 'free'

distance = 55
spam score = 54
title = 'free'

distance = 55
spam score = 54
title = 'free'

distance = 55
spam score = 54
title = 'free'

distance = 57
spam score = 53
title = 'free'

distance = 57
spam score = 54
title = 'free'

distance = 57
spam score = 54
title = 'free'

distance = 57
spam score = 53
title = 'free'

distance = 57
spam score = 53
title = 'free'

distance = 57
spam score = 53
title = 'free'

distance = 57
spam score = 54
title = 'free'

distance = 57
spam score = 53
title = 'free'

distance = 57
spam score = 54
title = 'free'

distance = 57
spam score = 53
title = 'free'

distance = 58
spam score = 52
title = 'free'

distance = 58
spam score = 51
title = 'free'

distance = 58
spam score = 52
title = 'free'

distance = 58
spam score = 51
title = 'free'

distance = 58
spam score = 52
title = 'free'

distance = 58
spam score = 52
title = 'free'

distance = 58
spam score = 52
title = 'free'

distance = 58
spam score = 52
title = 'free'

distance = 58
spam score = 52
title = 'free'

distance = 58
spam score = 52
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 52
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 63
spam score = 53
title = 'free'

distance = 80
spam score = 54
title = 'free'

distance = 80
spam score = 53
title = 'free'

distance = 80
spam score = 53
title = 'free'

distance = 80
spam score = 54
title = 'free'

distance = 80
spam score = 53
title = 'free'

distance = 80
spam score = 54
title = 'free'

distance = 80
spam score = 54
title = 'free'

distance = 80
spam score = 53
title = 'free'

distance = 80
spam score = 53
title = 'free'

distance = 80
spam score = 54
title = 'free'

distance = 107
spam score = 53
title = 'free'

distance = 107
spam score = 53
title = 'free'

distance = 107
spam score = 53
title = 'free'

distance = 107
spam score = 53
title = 'free'

distance = 107
spam score = 53
title = 'free'

distance = 107
spam score = 53
title = 'free'

distance = 107
spam score = 53
title = 'free'

distance = 107
spam score = 53
title = 'free'

distance = 107
spam score = 53
title = 'free'

distance = 107
spam score = 52
title = 'free'

distance = 133
spam score = 51
title = 'free'

distance = 133
spam score = 52
title = 'free'

distance = 133
spam score = 52
title = 'free'

distance = 133
spam score = 52
title = 'free'

distance = 133
spam score = 52
title = 'free'

distance = 133
spam score = 52
title = 'free'

distance = 133
spam score = 52
title = 'free'

distance = 133
spam score = 52
title = 'free'

distance = 133
spam score = 52
title = 'free'

distance = 133
spam score = 52
title = 'free'

distance = 1726
spam score = 45
title = ''

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 53
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 0
spam score = 54
title = 'free'

distance = 0
spam score = 55
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 54
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 54
title = 'free'

distance = 90
spam score = 54
title = 'free'

distance = 90
spam score = 54
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 54
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 90
spam score = 53
title = 'free'

distance = 1788
spam score = 41
title = 'oplog'

distance = 1861
spam score = 58
title = 'violin vaccine investigation and online information network'

distance = 18
spam score = 63
title = 'pictures of mia umali 290 mia getting up'

distance = 33
spam score = 63
title = 'pictures of mia umali 437 mia saying i did it'

distance = 34
spam score = 60
title = 'pictures of mia umali 409 mia and her look'

distance = 35
spam score = 63
title = 'pictures of mia umali 379 mia by lake'

distance = 35
spam score = 64
title = 'pictures of mia umali 463 mia at the lake'

distance = 36
spam score = 62
title = 'pictures of mia umali 73 mia being still'

distance = 37
spam score = 64
title = 'pictures of mia umali 318 mia and the umali family'

distance = 40
spam score = 62
title = 'pictures of mia umali 90 mia talking'

distance = 42
spam score = 63
title = 'pictures of mia umali 1 mia at one week'

distance = 43
spam score = 63
title = 'pictures of mia umali 481 mia with larry'

distance = 45
spam score = 58
title = 'pictures of mia umali 196 mia from behind her gate'

distance = 45
spam score = 63
title = 'pictures of mia umali 273 mia standing'

distance = 45
spam score = 63
title = 'pictures of mia umali 242 mia standing'

distance = 45
spam score = 63
title = 'pictures of mia umali 263 mia standing up'

distance = 47
spam score = 63
title = 'pictures of mia umali 241 mia with blocks'

distance = 47
spam score = 63
title = 'pictures of mia umali 218 mia with bob'

distance = 48
spam score = 61
title = 'pictures of mia umali 496 mia and her new guitar'

distance = 49
spam score = 61
title = 'pictures of mia umali 82 mia waking up'

distance = 50
spam score = 62
title = 'pictures of mia umali 78 mia at six months'

distance = 50
spam score = 62
title = 'pictures of mia umali 77 mia at six months'

distance = 90
spam score = 63
title = 'pictures of mia umali 49 mia with shoes and grandma'

distance = 91
spam score = 65
title = 'pictures of mia umali 323 mia with the new television'

distance = 91
spam score = 61
title = 'pictures of mia umali 97 mia and mom have a good morning'

distance = 91
spam score = 62
title = 'pictures of mia umali 64 mia and mom in the morning'

distance = 91
spam score = 62
title = 'pictures of mia umali 281 mia being held by dad'

distance = 91
spam score = 64
title = 'pictures of mia umali 11 mia with ricks parents'

distance = 91
spam score = 65
title = 'pictures of mia umali 356 mia trying to talk to murray'

distance = 92
spam score = 63
title = 'pictures of mia umali 518 mia in a bouncing castle'

distance = 92
spam score = 63
title = 'pictures of mia umali 255 mia with moms slipper'

distance = 93
spam score = 64
title = 'pictures of mia umali 333 mia near a snow bank'

distance = 101
spam score = 62
title = 'pictures of mia umali 269 mia up close'

distance = 101
spam score = 63
title = 'pictures of mia umali 362 mia eating a banana'

distance = 101
spam score = 64
title = 'pictures of mia umali 181 mia examining a flash light'

distance = 101
spam score = 60
title = 'pictures of mia umali 401 mia right after her hair cut'

distance = 101
spam score = 63
title = 'pictures of mia umali 213 mia and isabella playing at party'

distance = 101
spam score = 64
title = 'pictures of mia umali 300 mia and mom'

distance = 101
spam score = 64
title = 'pictures of mia umali 403 mia up close'

distance = 102
spam score = 63
title = 'pictures of mia umali 65 mia standing with moms help'

distance = 102
spam score = 63
title = 'pictures of mia umali 287 mia in a cute outfit'

distance = 103
spam score = 66
title = 'pictures of mia umali 200 mia on the stairs'

distance = 109
spam score = 62
title = 'pictures of mia umali 45 mia getting fed cereal'

distance = 109
spam score = 62
title = 'pictures of mia umali 92 mia with jenn'

distance = 109
spam score = 63
title = 'pictures of mia umali 308 mia and grand pop on christmas day 2002'

distance = 109
spam score = 63
title = 'pictures of mia umali 18 mia with paternal grandparents'

distance = 109
spam score = 62
title = 'pictures of mia umali 175 mia getting ready for daycare'

distance = 109
spam score = 62
title = 'pictures of mia umali 289 mia yapping'

distance = 109
spam score = 62
title = 'pictures of mia umali 44 mia getting fed cereal'

distance = 109
spam score = 61
title = 'pictures of mia umali 123 mia about to get my toe'

distance = 110
spam score = 61
title = 'pictures of mia umali 112 mia getting fed'

distance = 110
spam score = 61
title = 'pictures of mia umali 207 mia at home by rocking chair'

distance = 119
spam score = 63
title = 'pictures of mia umali 173 mia trying to walk'

distance = 120
spam score = 62
title = 'pictures of mia umali 381 mia wearing biker shorts'

distance = 120
spam score = 64
title = 'pictures of mia umali 275 mia in the tub'

distance = 120
spam score = 64
title = 'pictures of mia umali 85 mia closeup'

distance = 120
spam score = 63
title = 'pictures of mia umali 462 mia with grand pop'

distance = 120
spam score = 63
title = 'pictures of mia umali 236 mia in the tub'

distance = 120
spam score = 60
title = 'pictures of mia umali 419 mia and her drawing of a face'

distance = 121
spam score = 62
title = 'pictures of mia umali 359 mia wearing moms slippers'

distance = 121
spam score = 64
title = 'pictures of mia umali 347 mia with grand parents'

distance = 121
spam score = 62
title = 'pictures of mia umali 324 mia going fast on the sitnspin'

distance = 134
spam score = 60
title = 'pictures of mia umali 210 mia after breakfast on her birthday'

distance = 135
spam score = 62
title = 'pictures of mia umali 9 rick with mia first bath'

distance = 135
spam score = 62
title = 'pictures of mia umali 16 mia with parents at baptism'

distance = 135
spam score = 62
title = 'pictures of mia umali 17 mom and mia at baptism'

distance = 136
spam score = 63
title = 'pictures of mia umali 321 mia hears no evil'

distance = 136
spam score = 62
title = 'pictures of mia umali 151 mia with grand dad'

distance = 137
spam score = 64
title = 'pictures of mia umali 387 mia with uncle ron'

distance = 137
spam score = 62
title = 'pictures of mia umali 138 mia standing with subwoofer'

distance = 137
spam score = 63
title = 'pictures of mia umali 513 mia waiting for cake at victors party'

distance = 137
spam score = 60
title = 'pictures of mia umali 527 mia at her desk smiling'

distance = 147
spam score = 62
title = 'pictures of mia umali 490 mia showing renato how to trace letters'

distance = 147
spam score = 62
title = 'pictures of mia umali 221 mia by the fridge smiling'

distance = 147
spam score = 63
title = 'pictures of mia umali 93 mia with jenn and grandma'

distance = 148
spam score = 60
title = 'pictures of mia umali 198 mia wants to see whos on the phone with mom'

distance = 149
spam score = 62
title = 'pictures of mia umali 212 mia and mom with gram at party'

distance = 149
spam score = 62
title = 'pictures of mia umali 472 mia and mom and dad'

distance = 149
spam score = 63
title = 'pictures of mia umali 208 mia enjoying a minipancake'

distance = 149
spam score = 60
title = 'pictures of mia umali 491 mia fixing the table with her saw'

distance = 149
spam score = 63
title = 'pictures of mia umali 37 my mom dad and mia'

distance = 150
spam score = 62
title = 'pictures of mia umali 418 mia with baby karl and roy and jenn'

distance = 165
spam score = 60
title = 'pictures of mia umali 420 mia in halloween hat helping with raking'

distance = 165
spam score = 60
title = 'pictures of mia umali 169 mia watching tv with mommy'

distance = 166
spam score = 63
title = 'pictures of mia umali 223 my brother ron and gram with mia'

distance = 166
spam score = 63
title = 'pictures of mia umali 389 mia on july 4 with grand mom and mom'

distance = 167
spam score = 63
title = 'pictures of mia umali 515 mia in the water mchenry il'

distance = 167
spam score = 59
title = 'pictures of mia umali 433 mia with grandmom before thanksgiving dinner'

distance = 168
spam score = 64
title = 'pictures of mia umali 206 mia in r us in front of diaper display'

distance = 168
spam score = 63
title = 'pictures of mia umali 397 mia washing dishes with uncle ron'

distance = 168
spam score = 61
title = 'pictures of mia umali 425 mia held by tita vicky with extended family'

distance = 169
spam score = 64
title = 'pictures of mia umali 235 mom combing mias hair'

distance = 191
spam score = 60
title = 'pictures of mia umali 432 mia snacking before thanksgiving dinner'

distance = 192
spam score = 60
title = 'pictures of mia umali 371 mia and mom with lisa and her new baby karl'

distance = 193
spam score = 63
title = 'pictures of mia umali 246 mia outside on our small porch with mom'

distance = 193
spam score = 62
title = 'pictures of mia umali 199 mia rocking bob on the rocking chair'

distance = 193
spam score = 62
title = 'pictures of mia umali 495 mia with grandpop and lincoln logs'

distance = 193
spam score = 63
title = 'pictures of mia umali 2 mia at one week in grandpa rons lap'

distance = 195
spam score = 63
title = 'pictures of mia umali 445 mia and mom with cousin lisa and karl'

distance = 196
spam score = 63
title = 'pictures of mia umali 130 mia playing with lindsay and toni thanksgiving 2001'

distance = 196
spam score = 60
title = 'pictures of mia umali 276 mia in the tub with her hair scooped up'

distance = 197
spam score = 63
title = 'pictures of mia umali 29 i think this one is a lightning bug'

distance = 60
spam score = 29
title = ''

distance = 73
spam score = 29
title = ''

distance = 76
spam score = 30
title = ''

distance = 76
spam score = 31
title = ''

distance = 77
spam score = 30
title = ''

distance = 83
spam score = 30
title = ''

distance = 83
spam score = 29
title = ''

distance = 91
spam score = 29
title = ''

distance = 92
spam score = 28
title = ''

distance = 93
spam score = 30
title = ''

distance = 93
spam score = 29
title = ''

distance = 93
spam score = 31
title = ''

distance = 93
spam score = 30
title = ''

distance = 93
spam score = 31
title = ''

distance = 94
spam score = 30
title = ''

distance = 100
spam score = 32
title = ''

distance = 100
spam score = 32
title = ''

distance = 100
spam score = 31
title = ''

distance = 100
spam score = 31
title = ''

distance = 101
spam score = 30
title = ''

distance = 104
spam score = 29
title = ''

distance = 106
spam score = 28
title = ''

distance = 106
spam score = 29
title = ''

distance = 106
spam score = 29
title = ''

distance = 107
spam score = 30
title = ''

distance = 108
spam score = 31
title = ''

distance = 108
spam score = 28
title = ''

distance = 108
spam score = 31
title = ''

distance = 109
spam score = 30
title = ''

distance = 110
spam score = 30
title = ''

distance = 110
spam score = 30
title = ''

distance = 115
spam score = 33
title = ''

distance = 115
spam score = 27
title = ''

distance = 115
spam score = 32
title = ''

distance = 116
spam score = 31
title = ''

distance = 116
spam score = 32
title = ''

distance = 124
spam score = 30
title = ''

distance = 124
spam score = 31
title = ''

distance = 124
spam score = 30
title = ''

distance = 125
spam score = 30
title = ''

distance = 125
spam score = 30
title = ''

distance = 125
spam score = 30
title = ''

distance = 125
spam score = 31
title = ''

distance = 125
spam score = 30
title = ''

distance = 125
spam score = 31
title = ''

distance = 132
spam score = 29
title = ''

distance = 132
spam score = 29
title = ''

distance = 136
spam score = 31
title = ''

distance = 137
spam score = 31
title = ''

distance = 138
spam score = 30
title = ''

distance = 139
spam score = 31
title = ''

distance = 141
spam score = 31
title = ''

distance = 142
spam score = 27
title = ''

distance = 142
spam score = 28
title = ''

distance = 143
spam score = 30
title = ''

distance = 143
spam score = 30
title = ''

distance = 143
spam score = 30
title = ''

distance = 148
spam score = 29
title = ''

distance = 148
spam score = 29
title = ''

distance = 151
spam score = 29
title = ''

distance = 151
spam score = 29
title = ''

distance = 154
spam score = 28
title = ''

distance = 155
spam score = 28
title = ''

distance = 159
spam score = 30
title = ''

distance = 159
spam score = 30
title = ''

distance = 159
spam score = 30
title = ''

distance = 165
spam score = 29
title = ''

distance = 165
spam score = 28
title = ''

distance = 173
spam score = 31
title = ''

distance = 179
spam score = 31
title = ''

distance = 181
spam score = 30
title = ''

distance = 201
spam score = 31
title = ''

distance = 201
spam score = 30
title = ''

distance = 203
spam score = 28
title = ''

distance = 205
spam score = 32
title = ''

distance = 205
spam score = 32
title = ''

distance = 206
spam score = 29
title = ''

distance = 206
spam score = 28
title = ''

distance = 206
spam score = 29
title = ''

distance = 210
spam score = 31
title = ''

distance = 212
spam score = 29
title = ''

distance = 212
spam score = 29
title = ''

distance = 221
spam score = 28
title = ''

distance = 221
spam score = 28
title = ''

distance = 224
spam score = 28
title = ''

distance = 239
spam score = 28
title = ''

distance = 243
spam score = 28
title = ''

distance = 276
spam score = 29
title = ''

distance = 276
spam score = 29
title = ''

distance = 294
spam score = 28
title = ''

distance = 21
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 21
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 21
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 40
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 45
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 47
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 47
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 47
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 47
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 47
spam score = 89
title = 'darley moor solos 29 aug 05'

distance = 47
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 49
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 53
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 56
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 56
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 56
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 56
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 56
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 56
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 56
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 81
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 81
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 81
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 81
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 81
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 81
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 83
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 83
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 83
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 84
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 90
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 90
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 90
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 90
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 91
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 91
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 92
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 93
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 93
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 94
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 102
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 103
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 103
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 103
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 103
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 103
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 104
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 105
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 105
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 105
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 114
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 116
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 116
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 117
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 117
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 118
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 118
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 118
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 120
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 120
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 132
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 132
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 133
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 133
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 135
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 136
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 136
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 136
spam score = 89
title = 'darley moor solos 29 aug 05'

distance = 137
spam score = 89
title = 'darley moor solos 29 aug 05'

distance = 137
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 154
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 154
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 154
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 154
spam score = 89
title = 'darley moor solos 29 aug 05'

distance = 154
spam score = 89
title = 'darley moor solos 29 aug 05'

distance = 154
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 155
spam score = 88
title = 'darley moor solos 29 aug 05'

distance = 155
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 155
spam score = 89
title = 'darley moor solos 29 aug 05'

distance = 156
spam score = 87
title = 'darley moor solos 29 aug 05'

distance = 247
spam score = 88
title = 'darley moor 29 aug carts'

distance = 247
spam score = 88
title = 'darley moor 29 aug carts'

distance = 247
spam score = 87
title = 'darley moor 29 aug carts'

distance = 247
spam score = 88
title = 'darley moor 29 aug carts'

distance = 247
spam score = 88
title = 'darley moor 29 aug carts'

distance = 247
spam score = 87
title = 'darley moor 29 aug carts'

distance = 247
spam score = 88
title = 'darley moor 29 aug carts'

distance = 247
spam score = 88
title = 'darley moor 29 aug carts'

distance = 247
spam score = 88
title = 'darley moor 29 aug carts'

distance = 247
spam score = 88
title = 'darley moor 29 aug carts'

distance = 252
spam score = 88
title = 'darley moor 29 aug carts'

distance = 252
spam score = 88
title = 'darley moor 29 aug carts'

distance = 252
spam score = 88
title = 'darley moor 29 aug carts'

distance = 252
spam score = 89
title = 'darley moor 29 aug carts'

distance = 252
spam score = 87
title = 'darley moor 29 aug carts'

distance = 254
spam score = 87
title = 'darley moor 29 aug carts'

distance = 254
spam score = 88
title = 'darley moor 29 aug carts'

distance = 254
spam score = 88
title = 'darley moor 29 aug carts'

distance = 254
spam score = 87
title = 'darley moor 29 aug carts'

distance = 254
spam score = 88
title = 'darley moor 29 aug carts'

distance = 296
spam score = 88
title = 'darley moor 29 aug carts'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 77
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 77
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 77
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 77
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 0
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 77
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 79
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 106
spam score = 78
title = 'oceanweather inc metocean studies grow'

distance = 379
spam score = 73
title = 'oceanweather inc metocean studies grow'

distance = 1518
spam score = 60
title = 'organ archive sitemap'

distance = 1590
spam score = 38
title = 'tradedoubler targeting'

distance = 1622
spam score = 22
title = 'lying quotes page 3'

distance = 64
spam score = 50
title = ''

distance = 67
spam score = 54
title = ''

distance = 75
spam score = 51
title = ''

distance = 80
spam score = 49
title = ''

distance = 80
spam score = 49
title = ''

distance = 80
spam score = 50
title = ''

distance = 80
spam score = 50
title = ''

distance = 82
spam score = 52
title = ''

distance = 84
spam score = 52
title = ''

distance = 89
spam score = 51
title = ''

distance = 90
spam score = 53
title = ''

distance = 92
spam score = 50
title = ''

distance = 92
spam score = 50
title = ''

distance = 92
spam score = 51
title = ''

distance = 92
spam score = 52
title = ''

distance = 92
spam score = 51
title = ''

distance = 93
spam score = 52
title = ''

distance = 99
spam score = 51
title = ''

distance = 99
spam score = 50
title = ''

distance = 101
spam score = 52
title = ''

distance = 101
spam score = 49
title = ''

distance = 103
spam score = 51
title = ''

distance = 103
spam score = 51
title = ''

distance = 106
spam score = 52
title = ''

distance = 107
spam score = 51
title = ''

distance = 107
spam score = 52
title = ''

distance = 110
spam score = 52
title = ''

distance = 110
spam score = 51
title = ''

distance = 110
spam score = 52
title = ''

distance = 126
spam score = 50
title = ''

distance = 128
spam score = 52
title = ''

distance = 132
spam score = 50
title = ''

distance = 134
spam score = 50
title = ''

distance = 142
spam score = 50
title = ''

distance = 142
spam score = 49
title = ''

distance = 142
spam score = 49
title = ''

distance = 143
spam score = 50
title = ''

distance = 143
spam score = 50
title = ''

distance = 144
spam score = 51
title = ''

distance = 151
spam score = 49
title = ''

distance = 154
spam score = 52
title = ''

distance = 159
spam score = 49
title = ''

distance = 159
spam score = 49
title = ''

distance = 159
spam score = 51
title = ''

distance = 160
spam score = 51
title = ''

distance = 165
spam score = 54
title = ''

distance = 172
spam score = 46
title = ''

distance = 178
spam score = 49
title = ''

distance = 180
spam score = 51
title = ''

distance = 180
spam score = 49
title = ''

distance = 185
spam score = 51
title = ''

distance = 186
spam score = 49
title = ''

distance = 190
spam score = 49
title = ''

distance = 194
spam score = 47
title = ''

distance = 204
spam score = 47
title = ''

distance = 204
spam score = 47
title = ''

distance = 205
spam score = 51
title = ''

distance = 205
spam score = 51
title = ''

distance = 221
spam score = 52
title = ''

distance = 256
spam score = 48
title = ''

distance = 277
spam score = 47
title = ''

distance = 331
spam score = 46
title = ''

distance = 382
spam score = 47
title = ''

distance = 401
spam score = 48
title = ''

distance = 493
spam score = 50
title = ''

distance = 502
spam score = 49
title = ''

distance = 146
spam score = 21
title = ''

distance = 146
spam score = 21
title = ''

distance = 204
spam score = 18
title = ''

distance = 218
spam score = 20
title = ''

distance = 38
spam score = 30
title = 'igp2000jpg'

distance = 38
spam score = 30
title = 'igp2003jpg'

distance = 38
spam score = 30
title = 'igp2001jpg'

distance = 38
spam score = 29
title = 'igp1994jpg'

distance = 38
spam score = 29
title = 'igp1992jpg'

distance = 38
spam score = 30
title = 'igp1955jpg'

distance = 38
spam score = 29
title = 'igp1960jpg'

distance = 38
spam score = 28
title = 'igp1963jpg'

distance = 38
spam score = 29
title = 'igp1964jpg'

distance = 38
spam score = 31
title = 'igp1946jpg'

distance = 38
spam score = 30
title = 'igp1975jpg'

distance = 38
spam score = 29
title = 'igp1978jpg'

distance = 38
spam score = 29
title = 'igp1983jpg'

distance = 38
spam score = 30
title = 'igp1988jpg'

distance = 38
spam score = 29
title = 'igp1993jpg'

distance = 38
spam score = 29
title = 'igp2013jpg'

distance = 38
spam score = 29
title = 'igp2009jpg'

distance = 38
spam score = 28
title = 'igp2011jpg'

distance = 38
spam score = 30
title = 'igp1950jpg'

distance = 38
spam score = 30
title = 'igp1954jpg'

distance = 52
spam score = 28
title = 'igp1920jpg'

distance = 52
spam score = 27
title = 'igp1929jpg'

distance = 52
spam score = 27
title = 'igp1936jpg'

distance = 52
spam score = 27
title = 'igp1939jpg'

distance = 52
spam score = 28
title = 'igp1940jpg'

distance = 52
spam score = 27
title = 'igp1928jpg'

distance = 52
spam score = 28
title = 'igp1893jpg'

distance = 52
spam score = 28
title = 'igp1922jpg'

distance = 52
spam score = 28
title = 'igp1923jpg'

distance = 52
spam score = 27
title = 'igp1894jpg'

distance = 57
spam score = 27
title = 'igp1646jpg'

distance = 57
spam score = 27
title = 'igp1642jpg'

distance = 57
spam score = 29
title = 'igp1650jpg'

distance = 57
spam score = 27
title = 'igp1654jpg'

distance = 57
spam score = 28
title = 'igp1619jpg'

distance = 57
spam score = 27
title = 'igp1617jpg'

distance = 57
spam score = 28
title = 'igp1613jpg'

distance = 57
spam score = 28
title = 'igp1670jpg'

distance = 57
spam score = 28
title = 'igp1667jpg'

distance = 57
spam score = 27
title = 'igp1623jpg'

distance = 57
spam score = 28
title = 'igp1626jpg'

distance = 57
spam score = 29
title = 'igp1604jpg'

distance = 57
spam score = 29
title = 'igp1616jpg'

distance = 57
spam score = 28
title = 'igp1672jpg'

distance = 57
spam score = 28
title = 'igp1666jpg'

distance = 57
spam score = 27
title = 'igp1671jpg'

distance = 57
spam score = 27
title = 'igp1658jpg'

distance = 57
spam score = 28
title = 'igp1656jpg'

distance = 74
spam score = 28
title = 'igp1789jpg'

distance = 74
spam score = 28
title = 'igp1857jpg'

distance = 74
spam score = 29
title = 'igp1859jpg'

distance = 74
spam score = 29
title = 'igp1793jpg'

distance = 74
spam score = 28
title = 'igp1821jpg'

distance = 74
spam score = 28
title = 'igp1829jpg'

distance = 74
spam score = 27
title = 'igp1837jpg'

distance = 74
spam score = 28
title = 'igp1855jpg'

distance = 74
spam score = 28
title = 'igp1874jpg'

distance = 74
spam score = 28
title = 'igp1695jpg'

distance = 74
spam score = 28
title = 'igp1710jpg'

distance = 74
spam score = 28
title = 'igp1698jpg'

distance = 74
spam score = 28
title = 'igp1836jpg'

distance = 74
spam score = 28
title = 'igp1833jpg'

distance = 74
spam score = 28
title = 'igp1819jpg'

distance = 74
spam score = 28
title = 'igp1816jpg'

distance = 74
spam score = 27
title = 'igp1815jpg'

distance = 74
spam score = 27
title = 'igp1802jpg'

distance = 74
spam score = 29
title = 'igp1791jpg'

distance = 74
spam score = 29
title = 'igp1775jpg'

distance = 74
spam score = 29
title = 'igp1696jpg'

distance = 74
spam score = 28
title = 'igp1776jpg'

distance = 74
spam score = 27
title = 'igp1840jpg'

distance = 74
spam score = 27
title = 'igp1825jpg'

distance = 74
spam score = 27
title = 'igp1822jpg'

distance = 74
spam score = 27
title = 'igp1817jpg'

distance = 74
spam score = 28
title = 'igp1688jpg'

distance = 74
spam score = 27
title = 'igp1737jpg'

distance = 74
spam score = 27
title = 'igp1764jpg'

distance = 74
spam score = 28
title = 'igp1736jpg'

distance = 74
spam score = 28
title = 'igp1709jpg'

distance = 74
spam score = 27
title = 'igp1813jpg'

distance = 80
spam score = 28
title = 'igp1528jpg'

distance = 80
spam score = 29
title = 'igp1422jpg'

distance = 80
spam score = 28
title = 'igp1424jpg'

distance = 80
spam score = 28
title = 'igp1429jpg'

distance = 80
spam score = 27
title = 'igp1430jpg'

distance = 80
spam score = 28
title = 'igp1433jpg'

distance = 80
spam score = 28
title = 'igp1431jpg'

distance = 80
spam score = 29
title = 'igp1413jpg'

distance = 80
spam score = 30
title = 'igp1463jpg'

distance = 80
spam score = 29
title = 'igp1412jpg'

distance = 80
spam score = 28
title = 'igp1425jpg'

distance = 80
spam score = 28
title = 'igp1449jpg'

distance = 80
spam score = 29
title = 'igp1485jpg'

distance = 80
spam score = 28
title = 'igp1417jpg'

distance = 80
spam score = 28
title = 'igp1501jpg'

distance = 80
spam score = 27
title = 'igp1420jpg'

distance = 80
spam score = 29
title = 'igp1466jpg'

distance = 80
spam score = 28
title = 'igp1438jpg'

distance = 80
spam score = 28
title = 'igp1440jpg'

distance = 80
spam score = 28
title = 'igp1460jpg'

distance = 151
spam score = 27
title = 'igp1835jpg'

distance = 151
spam score = 27
title = 'igp1814jpg'

distance = 151
spam score = 26
title = 'igp1797jpg'

distance = 1367
spam score = 51
title = 'preregional meet 2009'

distance = 1531
spam score = 54
title = '2008 convention roost 4 staffing the dunk tank'

distance = 1670
spam score = 44
title = 'pictures by derek ward'

distance = 1835
spam score = 62
title = ''

distance = 1840
spam score = 30
title = 'results for aqha 9340'

distance = 53
spam score = 0
title = 'california board pharmacies free prescription drugs'

distance = 55
spam score = 0
title = 'miami pharmacies 1st time customers get 40 off'

distance = 57
spam score = 0
title = 'wall drugstores free prescription drugs'

distance = 60
spam score = 1
title = 'does make much pharmacies tech free prescription drugs'

distance = 61
spam score = 1
title = 'high pharmacies school free prescription drugs'

distance = 62
spam score = 1
title = 'pharmacies cincinnati 1st time customers get 40 off'

distance = 63
spam score = 0
title = 'universal drugstore free prescription drugs'

distance = 65
spam score = 0
title = 'internet pharmacies business free prescription drugs'

distance = 65
spam score = 0
title = 'medicine canada pharmacies free prescription drugs'

distance = 66
spam score = 0
title = 'pharmacies schools colorado free prescription drugs'

distance = 68
spam score = 0
title = 'drug mexican stores looking for drugstore'

distance = 68
spam score = 0
title = 'college pharmacies illinois free prescription drugs'

distance = 68
spam score = 0
title = 'drug mexican stores looking for drugstore'

distance = 68
spam score = 0
title = 'super d drugstores free prescription drugs'

distance = 69
spam score = 1
title = 'pharmacies free prescription drugs'

distance = 70
spam score = 0
title = 'canadian online drugstores free prescription drugs'

distance = 71
spam score = 1
title = 'pharmacies schools new york free prescription drugs'

distance = 71
spam score = 0
title = 'drug stores chain super offer for all pharmacy products'

distance = 72
spam score = 1
title = 'pharmacies seattle free prescription drugs'

distance = 75
spam score = 0
title = 'mercury drugstores free prescription drugs'

distance = 106
spam score = 1
title = 'pharmacies monmouth new jersey very cheap generic prescriptions'

distance = 106
spam score = 0
title = 'lil drugstores free hp pavillion laptop'

distance = 106
spam score = 0
title = 'bartell drugstore free prescription drugs'

distance = 107
spam score = 1
title = 'anderson compounding pharmacies free prescription drugs'

distance = 107
spam score = 0
title = 'medicine non prescriptions order from reliable foreign pharmacies'

distance = 108
spam score = 0
title = 'coverage free prescriptions buy medication online cheap'

distance = 108
spam score = 0
title = 'frys food drug stores order from reliable foreign drugstores'

distance = 108
spam score = 0
title = 'online drug stores without prescription obtain all meds az no rx required'

distance = 110
spam score = 0
title = 'pharmacies technician staffing agency free prescription drugs'

distance = 110
spam score = 0
title = 'snyder drugstore buy prescription meds here for cost'

distance = 121
spam score = 0
title = 'angeles los pharmacies very cheap generic prescriptions'

distance = 121
spam score = 0
title = 'drug stores list stop paying outrageous prices for drugs'

distance = 121
spam score = 0
title = 'drug stores coupon code obtain all meds az no rx required'

distance = 123
spam score = 0
title = 'phoenix drugstores pharmacy drugstores'

distance = 123
spam score = 0
title = 'peoples drugstores order prescription meds directly from here'

distance = 123
spam score = 0
title = 'ida drugstores order prescription meds directly from here'

distance = 124
spam score = 0
title = 'buy drug pharmacy stores order prescription meds directly from here'

distance = 124
spam score = 0
title = 'buy drug pharmacy stores order prescription meds directly from here'

distance = 124
spam score = 1
title = 'job pharmacies walgreens very cheap generic prescriptions'

distance = 124
spam score = 0
title = 'wal mart drug stores buy low cost medication rx free'

distance = 133
spam score = 0
title = 'ce pharmacies tech topic very cheap generic prescriptions'

distance = 133
spam score = 0
title = 'prescription canada drugstores looking for drugstore'

distance = 133
spam score = 1
title = 'pharmacies technician test question very cheap generic prescriptions'

distance = 133
spam score = 1
title = 'exam pharmacies tech very cheap generic prescriptions'

distance = 133
spam score = 0
title = 'wal mart drugstores funtasias internet coupons'

distance = 134
spam score = 0
title = 'drug location longs stores buy health products at drugstorecom and save'

distance = 134
spam score = 0
title = 'job pharmacies technician texas free prescription drugs'

distance = 134
spam score = 0
title = 'drug location longs stores buy health products at drugstorecom and save'

distance = 134
spam score = 0
title = 'no prescription pill free prescription drugs'

distance = 135
spam score = 0
title = 'drug hawaii longs stores free prescription drugs'

distance = 141
spam score = 0
title = 'longs drug stores corp order from reliable foreign drugstores'

distance = 142
spam score = 0
title = 'drugstores chain free hp pavillion laptop'

distance = 142
spam score = 0
title = 'longs drugstores robbery looking for drugstore'

distance = 143
spam score = 0
title = 'drug mart stores target wal free hp pavillion laptop'

distance = 143
spam score = 0
title = 'order discount prescriptions online free prescription drugs'

distance = 143
spam score = 0
title = 'drug mart stores target wal free hp pavillion laptop'

distance = 143
spam score = 1
title = 'card medicare prescriptions prescription drugs at cost'

distance = 143
spam score = 0
title = 'jerry jones drugstores list free prescription drugs'

distance = 143
spam score = 0
title = 'longs drugstores hawaii free hp pavillion laptop'

distance = 144
spam score = 0
title = 'california pharmacies tech jobs free prescription drugs'

distance = 154
spam score = 0
title = 'glasses motorcycle prescriptions sun prescription drugs buy now for less'

distance = 155
spam score = 0
title = 'ray ban prescriptions sun glasses big discounts on all quality brand medic'

distance = 155
spam score = 0
title = 'map mexico new pharmacies ruidoso very cheap generic prescriptions'

distance = 155
spam score = 0
title = 'drug link stores suggest drugstorecom online drugstore'

distance = 155
spam score = 1
title = 'locate cvs pharmacies super offer for all pharmacy products'

distance = 155
spam score = 0
title = 'wallgreens drugstores drugstores'

distance = 155
spam score = 0
title = 'canadian pharmacies store online super offer for all pharmacy products'

distance = 155
spam score = 0
title = 'online drugstores ultram order prescription meds directly from here'

distance = 155
spam score = 0
title = 'drug link stores suggest drugstorecom online drugstore'

distance = 156
spam score = 0
title = 'lawtons drug stores stop paying outrageous prices for drugs'

distance = 173
spam score = 0
title = 'pet health pharmacies super offer for all pharmacy products'

distance = 174
spam score = 0
title = 'hydrocodone overnight no prescriptions buy medication online cheap'

distance = 174
spam score = 0
title = 'corner drug net store telusplanet free prescription drugs'

distance = 174
spam score = 0
title = 'diet pill prescriptions strength prescription drugs at cost'

distance = 174
spam score = 1
title = 'howard pharmacies probation school university super offer for all pharmacy products'

distance = 174
spam score = 0
title = 'deadline medicare prescriptions prescription drugs buy now for less'

distance = 174
spam score = 0
title = 'get xanax prescriptions free prescription drugs'

distance = 174
spam score = 0
title = 'look up prescriptions pill free prescription drugs'

distance = 174
spam score = 0
title = 'thyroid cancer surgery free prescription drugs'

distance = 175
spam score = 0
title = 'frys food drugstores drugstores'

distance = 197
spam score = 1
title = 'drug generic prescriptions prescription drugs sold at cost'

distance = 199
spam score = 0
title = 'discount drugstores buy health products at drugstorecom and save'

distance = 200
spam score = 0
title = 'santa barbara drugstore pharmacy buy health products at drugstorecom and save'

distance = 201
spam score = 0
title = 'prescriptions drug price comparison prescription drugs at cost'

distance = 202
spam score = 0
title = 'birth control no pill prescription brand medications from offshore pharmcy'

distance = 202
spam score = 0
title = 'buy diet ephedra pill ephedra for fast weight loss'

distance = 205
spam score = 0
title = 'pharmacies school college alprazolam alprazohlam tablets'

distance = 205
spam score = 0
title = 'jamestown new pharmacies york super offer for all pharmacy products'

distance = 205
spam score = 0
title = 'definition drug prescriptions prescription drugs sold at cost'

distance = 206
spam score = 0
title = 'drug prescription store transferring free prescription drugs'

distance = 234
spam score = 0
title = 'diet line phentermine pill birth control pill'

distance = 236
spam score = 1
title = 'wal mart pharmacies mail service alprazolam alprazohlam tablets'

distance = 237
spam score = 0
title = 'school pharmacies south carolina alprazolam alprazohlam tablets'

distance = 238
spam score = 0
title = 'pharmacies fort worth alprazolam alprazohlam tablets'

distance = 238
spam score = 0
title = 'mail mexican order pharmacies phenterminexanaxvaliumno prescription'

distance = 241
spam score = 0
title = 'cincinnati pharmacies school university cheap tramadol ultram and more'

distance = 242
spam score = 0
title = 'albany pharmacies school phenterminexanaxvaliumno prescription'

distance = 243
spam score = 1
title = 'online pharmacies business opportunity phenterminexanaxvaliumno prescription'

distance = 243
spam score = 0
title = 'pharmacies newburgh new york phenterminexanaxvaliumno prescription'

distance = 244
spam score = 0
title = 'canadian online discount pharmacies phenterminexanaxvaliumno prescription'

distance = 489
spam score = 0
title = 'danger birth control pill pill town discount drugs online'

distance = 512
spam score = 0
title = 'natural cure thyroid disease increase thyroid and lose weight'

distance = 513
spam score = 0
title = 'thyroid health food proven natural remedy for thyroid'

distance = 520
spam score = 0
title = 'para thyroid disease thyroid problems alvidar'

distance = 571
spam score = 1
title = 'ephedra pills pill reminder products'

distance = 574
spam score = 0
title = 'thyroid blood test unique e 180 softgels free shipping'

distance = 645
spam score = 0
title = 'normal thyroid test result medicine direct from mexico pharmacy'

distance = 675
spam score = 0
title = 'gordonii diet pills hoodia cactus free prescription drugs'

distance = 1719
spam score = 37
title = 'drugstore allergy allergy relief allergies'

distance = 44
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 44
spam score = 23
title = 'unique wedding invitations by moore creative'

distance = 58
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 95
spam score = 25
title = 'unique wedding invitations by moore creative'

distance = 99
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 106
spam score = 24
title = 'unique wedding invitations by moore creative'

distance = 109
spam score = 25
title = 'unique wedding invitations by moore creative'

distance = 112
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 112
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 113
spam score = 25
title = 'unique wedding invitations by moore creative'

distance = 117
spam score = 24
title = 'unique wedding invitations by moore creative'

distance = 118
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 119
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 119
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 120
spam score = 24
title = 'unique wedding invitations by moore creative'

distance = 121
spam score = 31
title = 'unique wedding invitations by moore creative'

distance = 123
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 123
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 125
spam score = 23
title = 'unique wedding invitations by moore creative'

distance = 126
spam score = 23
title = 'unique wedding invitations by moore creative'

distance = 155
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 157
spam score = 25
title = 'unique wedding invitations by moore creative'

distance = 157
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 158
spam score = 23
title = 'unique wedding invitations by moore creative'

distance = 158
spam score = 22
title = 'unique wedding invitations by moore creative'

distance = 159
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 159
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 162
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 163
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 167
spam score = 32
title = 'unique wedding invitations by moore creative'

distance = 172
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 172
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 172
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 172
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 173
spam score = 32
title = 'unique wedding invitations by moore creative'

distance = 173
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 173
spam score = 23
title = 'unique wedding invitations by moore creative'

distance = 173
spam score = 30
title = 'unique wedding invitations by moore creative'

distance = 173
spam score = 25
title = 'unique wedding invitations by moore creative'

distance = 173
spam score = 30
title = 'unique wedding invitations by moore creative'

distance = 178
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 178
spam score = 23
title = 'unique wedding invitations by moore creative'

distance = 178
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 178
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 178
spam score = 23
title = 'unique wedding invitations by moore creative'

distance = 179
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 179
spam score = 30
title = 'unique wedding invitations by moore creative'

distance = 181
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 181
spam score = 30
title = 'unique wedding invitations by moore creative'

distance = 182
spam score = 31
title = 'unique wedding invitations by moore creative'

distance = 185
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 185
spam score = 32
title = 'unique wedding invitations by moore creative'

distance = 185
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 186
spam score = 33
title = 'unique wedding invitations by moore creative'

distance = 186
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 186
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 186
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 186
spam score = 30
title = 'unique wedding invitations by moore creative'

distance = 187
spam score = 30
title = 'unique wedding invitations by moore creative'

distance = 187
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 189
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 189
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 189
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 189
spam score = 24
title = 'unique wedding invitations by moore creative'

distance = 189
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 189
spam score = 30
title = 'unique wedding invitations by moore creative'

distance = 190
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 190
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 191
spam score = 30
title = 'unique wedding invitations by moore creative'

distance = 191
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 193
spam score = 33
title = 'unique wedding invitations by moore creative'

distance = 194
spam score = 30
title = 'unique wedding invitations by moore creative'

distance = 194
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 195
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 196
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 197
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 197
spam score = 33
title = 'unique wedding invitations by moore creative'

distance = 197
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 198
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 198
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 205
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 206
spam score = 33
title = 'unique wedding invitations by moore creative'

distance = 209
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 210
spam score = 23
title = 'unique wedding invitations by moore creative'

distance = 215
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 215
spam score = 31
title = 'unique wedding invitations by moore creative'

distance = 216
spam score = 32
title = 'unique wedding invitations by moore creative'

distance = 217
spam score = 22
title = 'unique wedding invitations by moore creative'

distance = 228
spam score = 18
title = 'unique wedding invitations by moore creative'

distance = 229
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 249
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 251
spam score = 32
title = 'unique wedding invitations by moore creative'

distance = 251
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 253
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 254
spam score = 20
title = 'unique wedding invitations by moore creative'

distance = 254
spam score = 29
title = 'unique wedding invitations by moore creative'

distance = 260
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 261
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 263
spam score = 33
title = 'unique wedding invitations by moore creative'

distance = 264
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 291
spam score = 28
title = 'unique wedding invitations by moore creative'

distance = 296
spam score = 26
title = 'unique wedding invitations by moore creative'

distance = 413
spam score = 19
title = 'unique wedding invitations by moore creative'

distance = 438
spam score = 21
title = 'unique wedding invitations by moore creative'

distance = 611
spam score = 27
title = 'unique wedding invitations by moore creative'

distance = 29
spam score = 89
title = 'chosen the'

distance = 34
spam score = 85
title = 'which would you rather be'

distance = 41
spam score = 86
title = '1 2 3 to the zoo'

distance = 44
spam score = 88
title = 'on the way home'

distance = 47
spam score = 88
title = 'on the other side of the hill'

distance = 53
spam score = 85
title = 'on the line'

distance = 56
spam score = 93
title = 'henry reed inc'

distance = 56
spam score = 85
title = 'words by heart'

distance = 59
spam score = 90
title = 'deerslayer the'

distance = 60
spam score = 88
title = 'one morning in maine'

distance = 60
spam score = 83
title = 'blue fairy book'

distance = 60
spam score = 89
title = 'archaeology book the'

distance = 62
spam score = 87
title = 'reluctant dragon the'

distance = 66
spam score = 79
title = 'strawberry girl'

distance = 66
spam score = 85
title = 'two and two are four'

distance = 66
spam score = 88
title = 'school days with the millers'

distance = 66
spam score = 86
title = 'choice the'

distance = 66
spam score = 85
title = 'don quixote'

distance = 68
spam score = 85
title = 'magic of the bear the'

distance = 69
spam score = 84
title = 'west from home'

distance = 114
spam score = 86
title = 'ides of april'

distance = 115
spam score = 87
title = 'little engine that could the original'

distance = 116
spam score = 86
title = 'adventures of robin hood'

distance = 116
spam score = 85
title = 'studying christian literature'

distance = 116
spam score = 84
title = 'blue willow'

distance = 116
spam score = 86
title = 'robin hood dover thrift'

distance = 116
spam score = 87
title = 'in the land of the big red apple'

distance = 116
spam score = 86
title = 'tale of mrs tittlemouse'

distance = 117
spam score = 86
title = 'little white horse'

distance = 117
spam score = 89
title = 'screwtape letters the'

distance = 127
spam score = 88
title = 'robinson crusoe'

distance = 128
spam score = 84
title = 'blaze and the forest fire'

distance = 128
spam score = 89
title = 'captains courageous'

distance = 128
spam score = 86
title = 'prince etcheon and the secret of the ancient'

distance = 128
spam score = 79
title = 'shadow of a bull'

distance = 129
spam score = 88
title = 'men of iron'

distance = 129
spam score = 84
title = 'boxcar children 4 mystery ranch'

distance = 129
spam score = 88
title = 'amelia bedelia goes camping'

distance = 130
spam score = 85
title = 'animal farm'

distance = 130
spam score = 85
title = 'song and dance man'

distance = 139
spam score = 85
title = 'mouse tales'

distance = 139
spam score = 85
title = 'secret garden the classic starts'

distance = 139
spam score = 92
title = 'treasure island classic starts'

distance = 139
spam score = 85
title = 'yonie wondernose'

distance = 140
spam score = 85
title = 'little bear'

distance = 140
spam score = 85
title = 'moonstone'

distance = 140
spam score = 86
title = 'theres a nightmare in my closet'

distance = 141
spam score = 86
title = 'ladd family 2 legend of fire the'

distance = 141
spam score = 89
title = 'black stallion'

distance = 141
spam score = 88
title = 'big dog little dog'

distance = 154
spam score = 86
title = 'comeback of the home run kid'

distance = 154
spam score = 85
title = 'boys king arthur the'

distance = 154
spam score = 86
title = 'blaze and the mountain lion'

distance = 155
spam score = 88
title = 'gullivers travels'

distance = 155
spam score = 84
title = 'dinosaur dream'

distance = 155
spam score = 88
title = 'tarzan dover thrift'

distance = 155
spam score = 87
title = 'voyages of dr dolittle classic starts'

distance = 155
spam score = 86
title = 'adventures of sammy jay'

distance = 155
spam score = 85
title = 'amazing bone'

distance = 155
spam score = 82
title = 'emma dover thrift'

distance = 165
spam score = 81
title = 'little lord fauntleroy classic starts'

distance = 165
spam score = 85
title = 'backup goalie'

distance = 165
spam score = 84
title = 'boxcar children 79 mystery of the crooked house'

distance = 165
spam score = 83
title = 'billy and blaze a boy and his pony'

distance = 165
spam score = 86
title = 'les miserables stepping stones reader'

distance = 165
spam score = 85
title = 'amazing dolphins'

distance = 166
spam score = 85
title = 'full court dreams'

distance = 166
spam score = 85
title = 'boxcar children 6 blue bay mystery'

distance = 166
spam score = 85
title = 'eyelike numbers'

distance = 166
spam score = 88
title = 'chronicles of narnia horse and his boy'

distance = 176
spam score = 86
title = 'suddenly alligator an adverbial tale'

distance = 176
spam score = 84
title = 'quiltmakers journey'

distance = 176
spam score = 86
title = 'story of doctor dolittle the'

distance = 176
spam score = 91
title = 'best nest'

distance = 177
spam score = 85
title = 'story of ferdinand'

distance = 177
spam score = 86
title = 'trixie belden 1 secret of the mansion'

distance = 177
spam score = 85
title = 'hardy boys 16 figure in hiding'

distance = 177
spam score = 85
title = 'nancy drew 25 ghost of blackwood hall'

distance = 177
spam score = 85
title = 'skateboard renegade'

distance = 177
spam score = 86
title = 'ladd family 1 secret of the shark pit'

distance = 192
spam score = 92
title = 'canterbury tales the hardcover trans cohen for children'

distance = 193
spam score = 84
title = 'ladd family 6 mystery of the wild surfer'

distance = 193
spam score = 82
title = 'blaze and the greyspotted pony'

distance = 193
spam score = 87
title = 'frog and toad together'

distance = 193
spam score = 86
title = 'awful ogres awful day'

distance = 194
spam score = 84
title = 'hardy boys 60 mystery of the samurai sword'

distance = 194
spam score = 85
title = 'boxcar children 108 creature in ogopogo lake'

distance = 194
spam score = 89
title = 'magic tree house 18 buffalo before breakfast'

distance = 195
spam score = 90
title = 'romeo juliet'

distance = 195
spam score = 84
title = 'northanger abbey dover thrift'

distance = 218
spam score = 85
title = 'all things wise wonderful book 3'

distance = 219
spam score = 85
title = 'pig pigger piggest'

distance = 221
spam score = 85
title = 'scarlet pimpernel the dover thrift'

distance = 221
spam score = 83
title = 'trixie belden 5 mystery off glen road'

distance = 221
spam score = 85
title = 'boxcar children 12 houseboat mystery'

distance = 224
spam score = 85
title = 'nancy drew 13 mystery of the ivory charm'

distance = 225
spam score = 85
title = 'little house 1 little house in the big woods'

distance = 227
spam score = 85
title = 'golly sisters go west'

distance = 228
spam score = 88
title = 'happy prince and other fairy tales the'

distance = 230
spam score = 86
title = 'little flowers of saint francis the dover thrift'

distance = 1766
spam score = 40
title = 'connolly books'

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 49
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 49
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 51
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 0
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 51
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 51
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 51
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 51
title = ''

distance = 71
spam score = 51
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 51
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 71
spam score = 50
title = ''

distance = 1521
spam score = 45
title = ''

distance = 1534
spam score = 43
title = ''

distance = 33
spam score = 38
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 42
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 43
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 42
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 38
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 38
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 38
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 34
title = 'cleveland ohio portrait photographersportrait photography'

distance = 33
spam score = 34
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 31
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 30
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 31
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 31
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 36
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 33
title = 'cleveland ohio portrait photographersportrait photography'

distance = 47
spam score = 33
title = 'cleveland ohio portrait photographersportrait photography'

distance = 78
spam score = 38
title = 'cleveland ohio portrait photographersportrait photography'

distance = 78
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 78
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 78
spam score = 26
title = 'cleveland ohio portrait photographersportrait photography'

distance = 78
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 78
spam score = 27
title = 'cleveland ohio portrait photographersportrait photography'

distance = 79
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 79
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 79
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 79
spam score = 30
title = 'cleveland ohio portrait photographersportrait photography'

distance = 87
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 87
spam score = 31
title = 'cleveland ohio portrait photographersportrait photography'

distance = 87
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 87
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 88
spam score = 31
title = 'cleveland ohio portrait photographersportrait photography'

distance = 88
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 88
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 89
spam score = 36
title = 'cleveland ohio portrait photographersportrait photography'

distance = 89
spam score = 45
title = 'cleveland ohio portrait photographersportrait photography'

distance = 89
spam score = 28
title = 'cleveland ohio portrait photographersportrait photography'

distance = 114
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 117
spam score = 35
title = 'cleveland ohio portrait photographersportrait photography'

distance = 117
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 117
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 117
spam score = 35
title = 'cleveland ohio portrait photographersportrait photography'

distance = 119
spam score = 40
title = 'cleveland ohio portrait photographersportrait photography'

distance = 119
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 119
spam score = 43
title = 'cleveland ohio portrait photographersportrait photography'

distance = 120
spam score = 47
title = 'cleveland ohio portrait photographersportrait photography'

distance = 121
spam score = 44
title = 'cleveland ohio portrait photographersportrait photography'

distance = 132
spam score = 38
title = 'cleveland ohio portrait photographersportrait photography'

distance = 132
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 132
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 132
spam score = 38
title = 'cleveland ohio portrait photographersportrait photography'

distance = 132
spam score = 38
title = 'cleveland ohio portrait photographersportrait photography'

distance = 133
spam score = 35
title = 'cleveland ohio portrait photographersportrait photography'

distance = 134
spam score = 36
title = 'cleveland ohio portrait photographersportrait photography'

distance = 135
spam score = 43
title = 'cleveland ohio portrait photographersportrait photography'

distance = 136
spam score = 44
title = 'cleveland ohio portrait photographersportrait photography'

distance = 136
spam score = 36
title = 'cleveland ohio portrait photographersportrait photography'

distance = 198
spam score = 32
title = 'cleveland ohio portrait photographersportrait photography'

distance = 198
spam score = 39
title = 'cleveland ohio portrait photographersportrait photography'

distance = 198
spam score = 32
title = 'cleveland ohio portrait photographersportrait photography'

distance = 198
spam score = 32
title = 'cleveland ohio portrait photographersportrait photography'

distance = 202
spam score = 42
title = 'cleveland ohio portrait photographersportrait photography'

distance = 205
spam score = 43
title = 'cleveland ohio portrait photographersportrait photography'

distance = 213
spam score = 33
title = 'cleveland ohio portrait photographersportrait photography'

distance = 223
spam score = 32
title = 'cleveland ohio portrait photographersportrait photography'

distance = 223
spam score = 32
title = 'cleveland ohio portrait photographersportrait photography'

distance = 225
spam score = 32
title = 'cleveland ohio portrait photographersportrait photography'

distance = 266
spam score = 30
title = 'cleveland ohio portrait photographersportrait photography'

distance = 275
spam score = 25
title = 'cleveland ohio portrait photographersportrait photography'

distance = 275
spam score = 24
title = 'cleveland ohio portrait photographersportrait photography'

distance = 282
spam score = 31
title = 'cleveland ohio portrait photographersportrait photography'

distance = 285
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 288
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 288
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 290
spam score = 29
title = 'cleveland ohio portrait photographersportrait photography'

distance = 292
spam score = 30
title = 'cleveland ohio portrait photographersportrait photography'

distance = 293
spam score = 28
title = 'cleveland ohio portrait photographersportrait photography'

distance = 360
spam score = 41
title = 'high school theate annie'

distance = 361
spam score = 41
title = 'high school theate annie'

distance = 361
spam score = 41
title = 'high school theate annie'

distance = 362
spam score = 41
title = 'high school theate annie'

distance = 362
spam score = 41
title = 'high school theate annie'

distance = 370
spam score = 43
title = 'othello'

distance = 370
spam score = 44
title = 'othello'

distance = 370
spam score = 44
title = 'othello'

distance = 370
spam score = 44
title = 'othello'

distance = 370
spam score = 44
title = 'othello'

distance = 426
spam score = 39
title = 'cookies for mrs c'

distance = 429
spam score = 44
title = 'othello'

distance = 440
spam score = 46
title = 'burial at thebes'

distance = 1691
spam score = 33
title = 'burlesque of north america'

distance = 1859
spam score = 30
title = ''

distance = 6
spam score = 31
title = ''

distance = 6
spam score = 31
title = ''

distance = 24
spam score = 30
title = ''

distance = 26
spam score = 32
title = ''

distance = 28
spam score = 32
title = ''

distance = 29
spam score = 30
title = ''

distance = 31
spam score = 30
title = ''

distance = 31
spam score = 31
title = ''

distance = 33
spam score = 28
title = ''

distance = 33
spam score = 33
title = ''

distance = 37
spam score = 32
title = ''

distance = 37
spam score = 28
title = ''

distance = 39
spam score = 30
title = ''

distance = 39
spam score = 26
title = ''

distance = 39
spam score = 34
title = ''

distance = 40
spam score = 31
title = ''

distance = 43
spam score = 32
title = ''

distance = 43
spam score = 36
title = ''

distance = 44
spam score = 29
title = ''

distance = 45
spam score = 28
title = ''

distance = 46
spam score = 30
title = ''

distance = 48
spam score = 32
title = ''

distance = 50
spam score = 32
title = ''

distance = 53
spam score = 31
title = ''

distance = 53
spam score = 33
title = ''

distance = 53
spam score = 27
title = ''

distance = 56
spam score = 30
title = ''

distance = 58
spam score = 28
title = ''

distance = 58
spam score = 32
title = ''

distance = 60
spam score = 20
title = ''

distance = 61
spam score = 32
title = ''

distance = 61
spam score = 31
title = ''

distance = 61
spam score = 18
title = ''

distance = 61
spam score = 33
title = ''

distance = 63
spam score = 20
title = ''

distance = 63
spam score = 32
title = ''

distance = 64
spam score = 30
title = ''

distance = 64
spam score = 29
title = ''

distance = 64
spam score = 19
title = ''

distance = 65
spam score = 28
title = ''

distance = 65
spam score = 32
title = ''

distance = 66
spam score = 30
title = ''

distance = 69
spam score = 33
title = ''

distance = 70
spam score = 28
title = ''

distance = 75
spam score = 30
title = ''

distance = 76
spam score = 30
title = ''

distance = 77
spam score = 30
title = ''

distance = 78
spam score = 34
title = ''

distance = 81
spam score = 34
title = ''

distance = 84
spam score = 32
title = ''

distance = 84
spam score = 31
title = ''

distance = 87
spam score = 34
title = ''

distance = 87
spam score = 31
title = ''

distance = 88
spam score = 34
title = ''

distance = 88
spam score = 30
title = ''

distance = 89
spam score = 31
title = ''

distance = 91
spam score = 32
title = ''

distance = 92
spam score = 30
title = ''

distance = 94
spam score = 33
title = ''

distance = 95
spam score = 29
title = ''

distance = 96
spam score = 28
title = ''

distance = 97
spam score = 33
title = ''

distance = 97
spam score = 34
title = ''

distance = 98
spam score = 31
title = ''

distance = 100
spam score = 34
title = ''

distance = 101
spam score = 33
title = ''

distance = 103
spam score = 27
title = ''

distance = 103
spam score = 31
title = ''

distance = 103
spam score = 32
title = ''

distance = 105
spam score = 30
title = ''

distance = 105
spam score = 32
title = ''

distance = 111
spam score = 32
title = ''

distance = 114
spam score = 34
title = ''

distance = 117
spam score = 30
title = ''

distance = 123
spam score = 32
title = ''

distance = 135
spam score = 33
title = ''

distance = 145
spam score = 30
title = ''

distance = 147
spam score = 33
title = ''

distance = 322
spam score = 19
title = ''

distance = 322
spam score = 26
title = ''

distance = 327
spam score = 19
title = ''

distance = 388
spam score = 17
title = ''

distance = 476
spam score = 39
title = ''

distance = 477
spam score = 17
title = ''

distance = 484
spam score = 35
title = ''

distance = 491
spam score = 37
title = ''

distance = 492
spam score = 35
title = ''

distance = 496
spam score = 19
title = ''

distance = 498
spam score = 40
title = ''

distance = 507
spam score = 35
title = ''

distance = 507
spam score = 34
title = ''

distance = 507
spam score = 30
title = ''

distance = 522
spam score = 30
title = ''

distance = 526
spam score = 32
title = ''

distance = 526
spam score = 35
title = ''

distance = 533
spam score = 35
title = ''

distance = 534
spam score = 35
title = ''

distance = 539
spam score = 35
title = ''

distance = 544
spam score = 34
title = ''

distance = 156
spam score = 25
title = ''

distance = 156
spam score = 25
title = ''

distance = 162
spam score = 26
title = ''

distance = 173
spam score = 25
title = ''

distance = 176
spam score = 26
title = ''

distance = 193
spam score = 26
title = ''

distance = 193
spam score = 25
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 26
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 28
title = ''

distance = 199
spam score = 26
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 199
spam score = 27
title = ''

distance = 204
spam score = 26
title = ''

distance = 212
spam score = 27
title = ''

distance = 283
spam score = 31
title = ''

distance = 345
spam score = 27
title = ''

distance = 347
spam score = 28
title = ''

distance = 445
spam score = 29
title = ''

distance = 454
spam score = 24
title = ''

distance = 455
spam score = 28
title = ''

distance = 3
spam score = 52
title = ''

distance = 3
spam score = 52
title = ''

distance = 3
spam score = 51
title = ''

distance = 3
spam score = 51
title = ''

distance = 3
spam score = 52
title = ''

distance = 3
spam score = 51
title = ''

distance = 3
spam score = 51
title = ''

distance = 3
spam score = 51
title = ''

distance = 3
spam score = 51
title = ''

distance = 10
spam score = 54
title = ''

distance = 11
spam score = 52
title = ''

distance = 21
spam score = 51
title = ''

distance = 26
spam score = 49
title = ''

distance = 26
spam score = 50
title = ''

distance = 31
spam score = 52
title = ''

distance = 33
spam score = 50
title = ''

distance = 34
spam score = 51
title = ''

distance = 35
spam score = 50
title = ''

distance = 39
spam score = 50
title = ''

distance = 40
spam score = 51
title = ''

distance = 73
spam score = 52
title = ''

distance = 76
spam score = 53
title = ''

distance = 78
spam score = 51
title = ''

distance = 79
spam score = 53
title = ''

distance = 79
spam score = 52
title = ''

distance = 79
spam score = 51
title = ''

distance = 84
spam score = 54
title = ''

distance = 87
spam score = 51
title = ''

distance = 89
spam score = 52
title = ''

distance = 89
spam score = 52
title = ''

distance = 93
spam score = 62
title = ''

distance = 95
spam score = 53
title = ''

distance = 98
spam score = 54
title = ''

distance = 106
spam score = 50
title = ''

distance = 106
spam score = 55
title = ''

distance = 107
spam score = 61
title = ''

distance = 107
spam score = 61
title = ''

distance = 109
spam score = 51
title = ''

distance = 115
spam score = 54
title = ''

distance = 124
spam score = 60
title = ''

distance = 126
spam score = 52
title = ''

distance = 130
spam score = 52
title = ''

distance = 130
spam score = 52
title = ''

distance = 130
spam score = 51
title = ''

distance = 130
spam score = 52
title = ''

distance = 130
spam score = 53
title = ''

distance = 130
spam score = 52
title = ''

distance = 136
spam score = 53
title = ''

distance = 138
spam score = 52
title = ''

distance = 148
spam score = 51
title = ''

distance = 148
spam score = 52
title = ''

distance = 148
spam score = 60
title = ''

distance = 156
spam score = 54
title = ''

distance = 156
spam score = 51
title = ''

distance = 159
spam score = 55
title = ''

distance = 160
spam score = 51
title = ''

distance = 162
spam score = 55
title = ''

distance = 164
spam score = 53
title = ''

distance = 167
spam score = 51
title = ''

distance = 178
spam score = 54
title = ''

distance = 181
spam score = 51
title = ''

distance = 223
spam score = 51
title = ''

distance = 228
spam score = 52
title = ''

distance = 236
spam score = 50
title = ''

distance = 297
spam score = 53
title = ''

distance = 311
spam score = 53
title = ''

distance = 379
spam score = 39
title = ''

distance = 457
spam score = 52
title = ''

distance = 521
spam score = 45
title = ''

distance = 585
spam score = 42
title = ''

distance = 1497
spam score = 70
title = ''

distance = 0
spam score = 38
title = ''

distance = 0
spam score = 35
title = ''

distance = 0
spam score = 36
title = ''

distance = 0
spam score = 36
title = ''

distance = 0
spam score = 38
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 36
title = ''

distance = 0
spam score = 38
title = ''

distance = 0
spam score = 38
title = ''

distance = 0
spam score = 35
title = ''

distance = 16
spam score = 36
title = ''

distance = 16
spam score = 37
title = ''

distance = 16
spam score = 36
title = ''

distance = 16
spam score = 36
title = ''

distance = 20
spam score = 36
title = ''

distance = 25
spam score = 40
title = ''

distance = 25
spam score = 38
title = ''

distance = 25
spam score = 40
title = ''

distance = 25
spam score = 39
title = ''

distance = 25
spam score = 39
title = ''

distance = 25
spam score = 37
title = ''

distance = 27
spam score = 39
title = ''

distance = 27
spam score = 38
title = ''

distance = 27
spam score = 39
title = ''

distance = 30
spam score = 36
title = ''

distance = 32
spam score = 39
title = ''

distance = 33
spam score = 37
title = ''

distance = 33
spam score = 37
title = ''

distance = 35
spam score = 37
title = ''

distance = 36
spam score = 36
title = ''

distance = 37
spam score = 38
title = ''

distance = 37
spam score = 39
title = ''

distance = 37
spam score = 38
title = ''

distance = 37
spam score = 37
title = ''

distance = 37
spam score = 36
title = ''

distance = 38
spam score = 38
title = ''

distance = 39
spam score = 37
title = ''

distance = 39
spam score = 34
title = ''

distance = 39
spam score = 36
title = ''

distance = 40
spam score = 36
title = ''

distance = 41
spam score = 39
title = ''

distance = 41
spam score = 39
title = ''

distance = 42
spam score = 38
title = ''

distance = 42
spam score = 39
title = ''

distance = 45
spam score = 37
title = ''

distance = 45
spam score = 37
title = ''

distance = 48
spam score = 36
title = ''

distance = 49
spam score = 38
title = ''

distance = 52
spam score = 37
title = ''

distance = 56
spam score = 39
title = ''

distance = 58
spam score = 38
title = ''

distance = 59
spam score = 36
title = ''

distance = 62
spam score = 42
title = ''

distance = 62
spam score = 40
title = ''

distance = 65
spam score = 40
title = ''

distance = 65
spam score = 36
title = ''

distance = 67
spam score = 41
title = ''

distance = 67
spam score = 39
title = ''

distance = 69
spam score = 42
title = ''

distance = 70
spam score = 37
title = ''

distance = 71
spam score = 41
title = ''

distance = 74
spam score = 37
title = ''

distance = 77
spam score = 41
title = ''

distance = 77
spam score = 40
title = ''

distance = 77
spam score = 42
title = ''

distance = 81
spam score = 41
title = ''

distance = 82
spam score = 38
title = ''

distance = 83
spam score = 42
title = ''

distance = 84
spam score = 41
title = ''

distance = 84
spam score = 40
title = ''

distance = 88
spam score = 41
title = ''

distance = 90
spam score = 40
title = ''

distance = 92
spam score = 38
title = ''

distance = 104
spam score = 38
title = ''

distance = 107
spam score = 40
title = ''

distance = 117
spam score = 35
title = ''

distance = 121
spam score = 42
title = ''

distance = 627
spam score = 39
title = ''

distance = 630
spam score = 39
title = ''

distance = 630
spam score = 36
title = ''

distance = 630
spam score = 38
title = ''

distance = 630
spam score = 37
title = ''

distance = 630
spam score = 37
title = ''

distance = 630
spam score = 39
title = ''

distance = 644
spam score = 37
title = ''

distance = 646
spam score = 37
title = ''

distance = 647
spam score = 37
title = ''

distance = 653
spam score = 39
title = ''

distance = 654
spam score = 38
title = ''

distance = 658
spam score = 38
title = ''

distance = 88
spam score = 38
title = ''

distance = 90
spam score = 39
title = ''

distance = 91
spam score = 39
title = ''

distance = 103
spam score = 39
title = ''

distance = 108
spam score = 42
title = ''

distance = 142
spam score = 40
title = ''

distance = 167
spam score = 39
title = ''

distance = 464
spam score = 55
title = ''

distance = 497
spam score = 46
title = ''

distance = 16
spam score = 40
title = 'dscf7166'

distance = 16
spam score = 39
title = 'dscf7391'

distance = 16
spam score = 39
title = 'dscf7350'

distance = 16
spam score = 38
title = 'dscf7332'

distance = 16
spam score = 38
title = 'dscf7184'

distance = 16
spam score = 38
title = 'dscf7401'

distance = 16
spam score = 39
title = 'dscf7256'

distance = 16
spam score = 39
title = 'dscf7251'

distance = 16
spam score = 38
title = 'dscf7234'

distance = 16
spam score = 37
title = 'dscf7225'

distance = 16
spam score = 38
title = 'dscf7326'

distance = 16
spam score = 38
title = 'dscf7232'

distance = 16
spam score = 39
title = 'dscf7199'

distance = 16
spam score = 39
title = 'dscf7404'

distance = 16
spam score = 38
title = 'dscf7271'

distance = 16
spam score = 39
title = 'dscf7315'

distance = 16
spam score = 36
title = 'dscf7308'

distance = 16
spam score = 37
title = 'dscf7338'

distance = 16
spam score = 39
title = 'dscf7285'

distance = 16
spam score = 39
title = 'dscf7161'

distance = 16
spam score = 38
title = 'dscf7372'

distance = 16
spam score = 37
title = 'dscf7347'

distance = 16
spam score = 39
title = 'dscf7173'

distance = 16
spam score = 38
title = 'dscf7164'

distance = 16
spam score = 38
title = 'dscf7158'

distance = 16
spam score = 38
title = 'dscf7132'

distance = 16
spam score = 40
title = 'dscf7283'

distance = 16
spam score = 39
title = 'dscf7274'

distance = 16
spam score = 40
title = 'dscf7313'

distance = 16
spam score = 39
title = 'dscf7191'

distance = 16
spam score = 39
title = 'dscf7305'

distance = 16
spam score = 37
title = 'dscf7227'

distance = 16
spam score = 39
title = 'dscf7201'

distance = 16
spam score = 39
title = 'dscf7174'

distance = 16
spam score = 38
title = 'dscf7137'

distance = 16
spam score = 38
title = 'dscf7284'

distance = 16
spam score = 40
title = 'dscf7395'

distance = 16
spam score = 38
title = 'dscf7262'

distance = 16
spam score = 39
title = 'dscf7254'

distance = 16
spam score = 40
title = 'dscf7400'

distance = 16
spam score = 38
title = 'dscf7245'

distance = 16
spam score = 38
title = 'dscf7143'

distance = 16
spam score = 38
title = 'dscf7213'

distance = 16
spam score = 39
title = 'dscf7208'

distance = 16
spam score = 38
title = 'dscf7118'

distance = 16
spam score = 39
title = 'dscf7276'

distance = 16
spam score = 38
title = 'dscf7182'

distance = 16
spam score = 39
title = 'dscf7242'

distance = 16
spam score = 38
title = 'dscf7210'

distance = 16
spam score = 40
title = 'dscf7235'

distance = 16
spam score = 40
title = 'dscf7290'

distance = 16
spam score = 38
title = 'dscf7298'

distance = 16
spam score = 37
title = 'dscf7162'

distance = 93
spam score = 40
title = 'dscf7241'

distance = 93
spam score = 40
title = 'dscf7179'

distance = 93
spam score = 40
title = 'dscf7259'

distance = 93
spam score = 38
title = 'dscf7126'

distance = 93
spam score = 39
title = 'dscf7144'

distance = 93
spam score = 39
title = 'dscf7147'

distance = 93
spam score = 40
title = 'dscf7186'

distance = 93
spam score = 39
title = 'dscf7140'

distance = 93
spam score = 39
title = 'dscf7293'

distance = 93
spam score = 39
title = 'dscf7248'

distance = 93
spam score = 39
title = 'dscf7408'

distance = 93
spam score = 40
title = 'dscf7193'

distance = 93
spam score = 38
title = 'dscf7246'

distance = 93
spam score = 39
title = 'dscf7265'

distance = 93
spam score = 38
title = 'dscf7217'

distance = 93
spam score = 39
title = 'dscf7177'

distance = 93
spam score = 40
title = 'dscf7127'

distance = 93
spam score = 40
title = 'dscf7287'

distance = 93
spam score = 40
title = 'dscf7181'

distance = 93
spam score = 39
title = 'dscf7367'

distance = 93
spam score = 39
title = 'dscf7270'

distance = 93
spam score = 41
title = 'dscf7176'

distance = 93
spam score = 40
title = 'dscf7363'

distance = 94
spam score = 38
title = 'dscf7359'

distance = 94
spam score = 41
title = 'dscf7190'

distance = 94
spam score = 40
title = 'dscf7365'

distance = 94
spam score = 40
title = 'dscf7302'

distance = 94
spam score = 41
title = 'dscf7163'

distance = 94
spam score = 41
title = 'dscf7146'

distance = 94
spam score = 40
title = 'dscf7383'

distance = 94
spam score = 38
title = 'dscf7220'

distance = 94
spam score = 39
title = 'dscf7278'

distance = 94
spam score = 39
title = 'dscf7194'

distance = 94
spam score = 40
title = 'dscf7261'

distance = 94
spam score = 41
title = 'dscf7109'

distance = 94
spam score = 41
title = 'dscf7252'

distance = 94
spam score = 40
title = 'dscf7211'

distance = 94
spam score = 40
title = 'dscf7387'

distance = 94
spam score = 38
title = 'dscf7348'

distance = 94
spam score = 40
title = 'dscf7296'

distance = 94
spam score = 39
title = 'dscf7188'

distance = 94
spam score = 40
title = 'dscf7366'

distance = 94
spam score = 41
title = 'dscf7386'

distance = 94
spam score = 38
title = 'dscf7328'

distance = 94
spam score = 40
title = 'dscf7250'

distance = 94
spam score = 40
title = 'dscf7133'

distance = 94
spam score = 39
title = 'dscf7117'

distance = 94
spam score = 39
title = 'dscf7212'

distance = 94
spam score = 40
title = 'dscf7355'

distance = 94
spam score = 38
title = 'dscf7349'

distance = 212
spam score = 41
title = 'pride05'

distance = 1435
spam score = 46
title = 'great lakes romp day 1'

distance = 1438
spam score = 19
title = 'great lakes romp day 2'

distance = 1852
spam score = 45
title = 'junior mens epee pan am championships'

distance = 0
spam score = 42
title = ''

distance = 0
spam score = 42
title = ''

distance = 0
spam score = 25
title = ''

distance = 0
spam score = 16
title = ''

distance = 0
spam score = 19
title = ''

distance = 0
spam score = 20
title = ''

distance = 0
spam score = 26
title = ''

distance = 0
spam score = 13
title = ''

distance = 0
spam score = 36
title = ''

distance = 0
spam score = 15
title = ''

distance = 0
spam score = 45
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 21
title = ''

distance = 0
spam score = 17
title = ''

distance = 0
spam score = 30
title = ''

distance = 0
spam score = 11
title = ''

distance = 0
spam score = 39
title = ''

distance = 0
spam score = 44
title = ''

distance = 0
spam score = 44
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 29
title = ''

distance = 0
spam score = 75
title = ''

distance = 0
spam score = 38
title = ''

distance = 0
spam score = 39
title = ''

distance = 0
spam score = 31
title = ''

distance = 309
spam score = 62
title = ''

distance = 348
spam score = 59
title = ''

distance = 352
spam score = 59
title = ''

distance = 365
spam score = 62
title = ''

distance = 413
spam score = 41
title = ''

distance = 457
spam score = 64
title = ''

distance = 501
spam score = 59
title = ''

distance = 510
spam score = 50
title = ''

distance = 531
spam score = 59
title = ''

distance = 594
spam score = 45
title = ''

distance = 628
spam score = 58
title = ''

distance = 75
spam score = 60
title = ''

distance = 75
spam score = 60
title = ''

distance = 75
spam score = 60
title = ''

distance = 117
spam score = 59
title = ''

distance = 117
spam score = 58
title = ''

distance = 166
spam score = 58
title = ''

distance = 173
spam score = 59
title = ''

distance = 209
spam score = 55
title = ''

distance = 209
spam score = 65
title = ''

distance = 212
spam score = 59
title = ''

distance = 243
spam score = 62
title = ''

distance = 332
spam score = 56
title = ''

distance = 388
spam score = 58
title = ''

distance = 395
spam score = 56
title = ''

distance = 602
spam score = 61
title = ''

distance = 8
spam score = 18
title = 'statistics for day 120503 generated by scripfm064'

distance = 8
spam score = 18
title = 'statistics for day 011003 generated by scripfm064'

distance = 8
spam score = 19
title = 'statistics for day 191003 generated by scripfm064'

distance = 8
spam score = 17
title = 'statistics for day 200903 generated by scripfm064'

distance = 8
spam score = 18
title = 'statistics for day 161003 generated by scripfm064'

distance = 8
spam score = 19
title = 'statistics for day 191003 generated by scripfm064'

distance = 8
spam score = 18
title = 'statistics for day 161003 generated by scripfm064'

distance = 8
spam score = 19
title = 'statistics for day 221003 generated by scripfm064'

distance = 8
spam score = 18
title = 'statistics for day 011003 generated by scripfm064'

distance = 8
spam score = 18
title = 'statistics for day 150903 generated by scripfm064'

distance = 8
spam score = 18
title = 'statistics for day 161003 generated by scripfm064'

distance = 8
spam score = 20
title = 'statistics for day 191003 generated by scripfm064'

distance = 8
spam score = 18
title = 'statistics for day 081003 generated by scripfm064'

distance = 8
spam score = 19
title = 'statistics for day 161003 generated by scripfm064'

distance = 8
spam score = 19
title = 'statistics for day 221003 generated by scripfm064'

distance = 8
spam score = 18
title = 'statistics for day 161003 generated by scripfm064'

distance = 8
spam score = 20
title = 'statistics for day 191003 generated by scripfm064'

distance = 8
spam score = 20
title = 'statistics for day 191003 generated by scripfm064'

distance = 8
spam score = 18
title = 'statistics for day 081003 generated by scripfm064'

distance = 8
spam score = 19
title = 'statistics for day 221003 generated by scripfm064'

distance = 32
spam score = 17
title = 'statistics for day 170603 generated by scripfm064'

distance = 33
spam score = 17
title = 'statistics for day 060603 generated by scripfm064'

distance = 33
spam score = 17
title = 'statistics for day 030403 generated by scripfm064'

distance = 33
spam score = 17
title = 'statistics for day 060503 generated by scripfm064'

distance = 35
spam score = 19
title = 'statistics for day 150403 generated by scripfm064'

distance = 36
spam score = 17
title = 'statistics for day 300903 generated by scripfm064'

distance = 36
spam score = 17
title = 'statistics for day 300903 generated by scripfm064'

distance = 36
spam score = 17
title = 'statistics for day 300903 generated by scripfm064'

distance = 36
spam score = 18
title = 'statistics for day 061003 generated by scripfm064'

distance = 36
spam score = 17
title = 'statistics for day 300903 generated by scripfm064'

distance = 48
spam score = 18
title = 'statistics for day 270403 generated by scripfm064'

distance = 48
spam score = 19
title = 'statistics for day 140603 generated by scripfm064'

distance = 49
spam score = 18
title = 'statistics for day 100703 generated by scripfm064'

distance = 49
spam score = 18
title = 'statistics for day 140703 generated by scripfm064'

distance = 49
spam score = 17
title = 'statistics for day 150503 generated by scripfm064'

distance = 49
spam score = 17
title = 'statistics for day 100503 generated by scripfm064'

distance = 49
spam score = 17
title = 'statistics for day 080503 generated by scripfm064'

distance = 49
spam score = 18
title = 'statistics for day 030503 generated by scripfm064'

distance = 49
spam score = 18
title = 'statistics for day 190803 generated by scripfm064'

distance = 49
spam score = 18
title = 'statistics for day 220403 generated by scripfm064'

distance = 67
spam score = 17
title = 'statistics for day 050903 generated by scripfm064'

distance = 67
spam score = 18
title = 'statistics for day 300603 generated by scripfm064'

distance = 67
spam score = 19
title = 'statistics for day 300603 generated by scripfm064'

distance = 67
spam score = 19
title = 'statistics for day 300603 generated by scripfm064'

distance = 67
spam score = 18
title = 'statistics for day 070603 generated by scripfm064'

distance = 67
spam score = 19
title = 'statistics for day 070903 generated by scripfm064'

distance = 67
spam score = 17
title = 'statistics for day 230803 generated by scripfm064'

distance = 67
spam score = 19
title = 'statistics for day 300603 generated by scripfm064'

distance = 67
spam score = 18
title = 'statistics for day 120703 generated by scripfm064'

distance = 67
spam score = 19
title = 'statistics for day 130703 generated by scripfm064'

distance = 79
spam score = 20
title = 'statistics for day 300703 generated by scripfm064'

distance = 79
spam score = 18
title = 'statistics for day 110403 generated by scripfm064'

distance = 80
spam score = 16
title = 'statistics for day 220803 generated by scripfm064'

distance = 81
spam score = 19
title = 'statistics for day 210603 generated by scripfm064'

distance = 83
spam score = 18
title = 'statistics for day 260803 generated by scripfm064'

distance = 84
spam score = 18
title = 'statistics for day 180803 generated by scripfm064'

distance = 86
spam score = 18
title = 'statistics for day 290603 generated by scripfm064'

distance = 88
spam score = 18
title = 'statistics for day 310503 generated by scripfm064'

distance = 88
spam score = 18
title = 'statistics for day 240703 generated by scripfm064'

distance = 88
spam score = 17
title = 'statistics for day 310503 generated by scripfm064'

distance = 116
spam score = 18
title = 'statistics for day 201003 generated by scripfm064'

distance = 116
spam score = 18
title = 'statistics for day 201003 generated by scripfm064'

distance = 116
spam score = 19
title = 'statistics for day 201003 generated by scripfm064'

distance = 118
spam score = 17
title = 'statistics for day 020403 generated by scripfm064'

distance = 121
spam score = 19
title = 'statistics for day 100803 generated by scripfm064'

distance = 121
spam score = 18
title = 'statistics for day 080803 generated by scripfm064'

distance = 122
spam score = 18
title = 'statistics for day 230403 generated by scripfm064'

distance = 125
spam score = 20
title = 'statistics for day 260703 generated by scripfm064'

distance = 125
spam score = 18
title = 'statistics for day 240803 generated by scripfm064'

distance = 127
spam score = 19
title = 'statistics for day 140803 generated by scripfm064'

distance = 205
spam score = 25
title = 'graphical statistics for day 191003 generated by scripfm064'

distance = 208
spam score = 27
title = 'graphical statistics for day 251003 generated by scripfm064'

distance = 208
spam score = 24
title = 'graphical statistics for day 241003 generated by scripfm064'

distance = 209
spam score = 18
title = 'statistics for day 190703 generated by scripfm064'

distance = 211
spam score = 26
title = 'graphical statistics for day 161003 generated by scripfm064'

distance = 214
spam score = 24
title = 'graphical statistics for day 101003 generated by scripfm064'

distance = 214
spam score = 26
title = 'graphical statistics for day 021003 generated by scripfm064'

distance = 216
spam score = 22
title = 'statistics for month 0603 generated by scripfm064'

distance = 225
spam score = 23
title = 'graphical statistics for day 231003 generated by scripfm064'

distance = 226
spam score = 25
title = 'graphical statistics for day 300403 generated by scripfm064'

distance = 271
spam score = 24
title = 'statistics for day 261003 generated by scripfm064'

distance = 271
spam score = 24
title = 'statistics for day 261003 generated by scripfm064'

distance = 271
spam score = 24
title = 'statistics for day 261003 generated by scripfm064'

distance = 271
spam score = 25
title = 'statistics for day 261003 generated by scripfm064'

distance = 271
spam score = 24
title = 'statistics for day 261003 generated by scripfm064'

distance = 271
spam score = 24
title = 'statistics for day 261003 generated by scripfm064'

distance = 271
spam score = 24
title = 'statistics for day 261003 generated by scripfm064'

distance = 271
spam score = 25
title = 'statistics for day 261003 generated by scripfm064'

distance = 271
spam score = 24
title = 'statistics for day 261003 generated by scripfm064'

distance = 271
spam score = 24
title = 'statistics for day 261003 generated by scripfm064'

distance = 318
spam score = 20
title = 'statistics for day 130403 generated by scripfm064'

distance = 327
spam score = 23
title = 'graphical statistics for day 310803 generated by scripfm064'

distance = 328
spam score = 25
title = 'graphical statistics for day 300603 generated by scripfm064'

distance = 328
spam score = 25
title = 'graphical statistics for day 300603 generated by scripfm064'

distance = 328
spam score = 25
title = 'graphical statistics for day 300603 generated by scripfm064'

distance = 328
spam score = 24
title = 'graphical statistics for day 300603 generated by scripfm064'

distance = 329
spam score = 25
title = 'graphical statistics for day 201003 generated by scripfm064'

distance = 335
spam score = 24
title = 'graphical statistics for day 310503 generated by scripfm064'

distance = 335
spam score = 24
title = 'graphical statistics for day 310503 generated by scripfm064'

distance = 335
spam score = 23
title = 'graphical statistics for day 310503 generated by scripfm064'

distance = 819
spam score = 33
title = 'statistics for monthinyear 03 generated by scripfm064'

distance = 819
spam score = 28
title = 'statistics for monthinyear 03 generated by scripfm064'

distance = 827
spam score = 38
title = 'statistics for dell in 1003 generated by scripfm064'

distance = 1851
spam score = 25
title = ''

distance = 1875
spam score = 28
title = ''

distance = 1913
spam score = 28
title = ''

distance = 91
spam score = 60
title = 'are'

distance = 102
spam score = 60
title = 'are'

distance = 104
spam score = 61
title = 'land'

distance = 106
spam score = 61
title = 'arab'

distance = 113
spam score = 62
title = 'ece'

distance = 114
spam score = 61
title = 'afri'

distance = 115
spam score = 61
title = 'ce'

distance = 116
spam score = 62
title = 'ece'

distance = 117
spam score = 61
title = 'clcs'

distance = 118
spam score = 62
title = 'clcs'

distance = 119
spam score = 61
title = 'land'

distance = 119
spam score = 61
title = 'arab'

distance = 120
spam score = 61
title = 'diet'

distance = 120
spam score = 61
title = 'hort'

distance = 120
spam score = 60
title = 'bme'

distance = 120
spam score = 61
title = 'are'

distance = 121
spam score = 62
title = 'es'

distance = 121
spam score = 60
title = 'dent'

distance = 121
spam score = 61
title = 'chin'

distance = 121
spam score = 59
title = 'chin'

distance = 147
spam score = 61
title = 'jour'

distance = 147
spam score = 62
title = 'basc'

distance = 147
spam score = 64
title = 'clcs'

distance = 147
spam score = 61
title = 'fed'

distance = 147
spam score = 62
title = 'rsch'

distance = 147
spam score = 62
title = 'amst'

distance = 148
spam score = 61
title = 'cdis'

distance = 148
spam score = 61
title = 'arth'

distance = 148
spam score = 62
title = 'ssw'

distance = 149
spam score = 63
title = 'diet'

distance = 158
spam score = 62
title = 'cheg'

distance = 158
spam score = 62
title = 'basc'

distance = 158
spam score = 63
title = 'turf'

distance = 159
spam score = 61
title = 'port'

distance = 159
spam score = 62
title = 'iskm'

distance = 159
spam score = 61
title = 'saas'

distance = 159
spam score = 61
title = 'corg'

distance = 159
spam score = 61
title = 'mgrk'

distance = 159
spam score = 62
title = 'plsh'

distance = 160
spam score = 63
title = 'phrx'

distance = 170
spam score = 63
title = 'roml'

distance = 170
spam score = 61
title = 'popr'

distance = 170
spam score = 62
title = 'fina'

distance = 170
spam score = 63
title = 'amst'

distance = 171
spam score = 63
title = 'sci'

distance = 171
spam score = 62
title = 'fnce'

distance = 171
spam score = 60
title = 'sapl'

distance = 172
spam score = 63
title = 'cswk'

distance = 172
spam score = 64
title = 'rsch'

distance = 172
spam score = 61
title = 'hsl'

distance = 184
spam score = 63
title = 'afam'

distance = 184
spam score = 63
title = 'plsc'

distance = 185
spam score = 62
title = 'dsel'

distance = 185
spam score = 64
title = 'prls'

distance = 185
spam score = 62
title = 'saas'

distance = 185
spam score = 63
title = 'aasi'

distance = 186
spam score = 64
title = 'eeb'

distance = 186
spam score = 63
title = 'plsh'

distance = 187
spam score = 63
title = 'port'

distance = 187
spam score = 63
title = 'sci'

distance = 200
spam score = 64
title = 'agnr'

distance = 201
spam score = 64
title = 'wgss'

distance = 201
spam score = 63
title = 'saas'

distance = 201
spam score = 62
title = 'biob'

distance = 202
spam score = 65
title = 'aasi'

distance = 202
spam score = 62
title = 'sapl'

distance = 203
spam score = 65
title = 'pvs'

distance = 204
spam score = 62
title = 'airf'

distance = 205
spam score = 65
title = 'aasi'

distance = 206
spam score = 64
title = 'sare'

distance = 257
spam score = 62
title = 'law'

distance = 259
spam score = 62
title = 'mem'

distance = 260
spam score = 64
title = 'osh'

distance = 261
spam score = 61
title = 'gsci'

distance = 261
spam score = 63
title = 'ints'

distance = 261
spam score = 62
title = 'me'

distance = 261
spam score = 61
title = 'ling'

distance = 262
spam score = 63
title = 'law'

distance = 262
spam score = 62
title = 'gpah'

distance = 263
spam score = 61
title = 'gps'

distance = 281
spam score = 63
title = 'intd'

distance = 281
spam score = 63
title = 'grad'

distance = 281
spam score = 63
title = 'gpah'

distance = 282
spam score = 62
title = 'hind'

distance = 282
spam score = 62
title = 'offc'

distance = 283
spam score = 64
title = 'hsmg'

distance = 283
spam score = 62
title = 'hsmg'

distance = 284
spam score = 61
title = 'mlsc'

distance = 284
spam score = 63
title = 'nse'

distance = 285
spam score = 64
title = 'mse'

distance = 301
spam score = 62
title = 'marn'

distance = 301
spam score = 63
title = 'ilcs'

distance = 302
spam score = 63
title = 'grwk'

distance = 303
spam score = 63
title = 'mcb'

distance = 304
spam score = 62
title = 'hind'

distance = 304
spam score = 62
title = 'nusc'

distance = 305
spam score = 63
title = 'cltr'

distance = 307
spam score = 64
title = 'kore'

distance = 312
spam score = 63
title = 'mcb'

distance = 316
spam score = 64
title = 'nusc'

distance = 952
spam score = 71
title = 'schedule'

distance = 968
spam score = 71
title = 'schedule'

distance = 976
spam score = 65
title = 'econ'

distance = 1102
spam score = 58
title = 'fed'

distance = 68
spam score = 16
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 16
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 16
title = 'education shinycatalogcom'

distance = 68
spam score = 18
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 18
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 16
title = 'education shinycatalogcom'

distance = 68
spam score = 16
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 16
title = 'education shinycatalogcom'

distance = 68
spam score = 16
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 68
spam score = 17
title = 'education shinycatalogcom'

distance = 116
spam score = 16
title = 'weather shinycatalogcom'

distance = 116
spam score = 14
title = 'government shinycatalogcom'

distance = 116
spam score = 16
title = 'transportation shinycatalogcom'

distance = 116
spam score = 15
title = 'weather shinycatalogcom'

distance = 116
spam score = 16
title = 'government shinycatalogcom'

distance = 116
spam score = 16
title = 'government shinycatalogcom'

distance = 116
spam score = 15
title = 'transportation shinycatalogcom'

distance = 117
spam score = 17
title = 'weather shinycatalogcom'

distance = 117
spam score = 18
title = 'education shinycatalogcom'

distance = 117
spam score = 17
title = 'education shinycatalogcom'

distance = 126
spam score = 18
title = 'science and environment shinycatalogcom'

distance = 126
spam score = 18
title = 'science and environment shinycatalogcom'

distance = 126
spam score = 17
title = 'science and environment shinycatalogcom'

distance = 126
spam score = 17
title = 'science and environment shinycatalogcom'

distance = 126
spam score = 17
title = 'science and environment shinycatalogcom'

distance = 126
spam score = 17
title = 'science and environment shinycatalogcom'

distance = 126
spam score = 17
title = 'science and environment shinycatalogcom'

distance = 126
spam score = 18
title = 'science and environment shinycatalogcom'

distance = 126
spam score = 17
title = 'science and environment shinycatalogcom'

distance = 126
spam score = 18
title = 'science and environment shinycatalogcom'

distance = 131
spam score = 17
title = 'employment shinycatalogcom'

distance = 131
spam score = 15
title = 'weather shinycatalogcom'

distance = 131
spam score = 16
title = 'employment shinycatalogcom'

distance = 133
spam score = 15
title = 'shopping shinycatalogcom'

distance = 133
spam score = 14
title = 'transportation shinycatalogcom'

distance = 133
spam score = 16
title = 'employment shinycatalogcom'

distance = 134
spam score = 16
title = 'education shinycatalogcom'

distance = 134
spam score = 15
title = 'shopping shinycatalogcom'

distance = 135
spam score = 16
title = 'guides and directories shinycatalogcom'

distance = 135
spam score = 17
title = 'guides and directories shinycatalogcom'

distance = 150
spam score = 17
title = 'recreation and sports shinycatalogcom'

distance = 150
spam score = 16
title = 'recreation and sports shinycatalogcom'

distance = 150
spam score = 16
title = 'education shinycatalogcom'

distance = 150
spam score = 15
title = 'transportation shinycatalogcom'

distance = 151
spam score = 16
title = 'arts and entertainment shinycatalogcom'

distance = 151
spam score = 14
title = 'arts and entertainment shinycatalogcom'

distance = 151
spam score = 17
title = 'transportation shinycatalogcom'

distance = 151
spam score = 17
title = 'transportation shinycatalogcom'

distance = 151
spam score = 16
title = 'transportation shinycatalogcom'

distance = 152
spam score = 16
title = 'transportation shinycatalogcom'

distance = 164
spam score = 18
title = 'society and culture shinycatalogcom'

distance = 164
spam score = 18
title = 'recreation and sports shinycatalogcom'

distance = 164
spam score = 17
title = 'recreation and sports shinycatalogcom'

distance = 164
spam score = 17
title = 'recreation and sports shinycatalogcom'

distance = 164
spam score = 17
title = 'recreation and sports shinycatalogcom'

distance = 165
spam score = 17
title = 'society and culture shinycatalogcom'

distance = 165
spam score = 18
title = 'news and media shinycatalogcom'

distance = 165
spam score = 18
title = 'news and media shinycatalogcom'

distance = 165
spam score = 19
title = 'society and culture shinycatalogcom'

distance = 165
spam score = 18
title = 'news and media shinycatalogcom'

distance = 172
spam score = 19
title = 'science and environment shinycatalogcom'

distance = 172
spam score = 16
title = 'travel and tourism shinycatalogcom'

distance = 172
spam score = 19
title = 'science and environment shinycatalogcom'

distance = 172
spam score = 15
title = 'transportation shinycatalogcom'

distance = 172
spam score = 18
title = 'science and environment shinycatalogcom'

distance = 172
spam score = 19
title = 'science and environment shinycatalogcom'

distance = 172
spam score = 18
title = 'science and environment shinycatalogcom'

distance = 172
spam score = 19
title = 'science and environment shinycatalogcom'

distance = 172
spam score = 19
title = 'science and environment shinycatalogcom'

distance = 173
spam score = 14
title = 'business and economy shinycatalogcom'

distance = 192
spam score = 16
title = 'recreation and sports shinycatalogcom'

distance = 192
spam score = 17
title = 'transportation shinycatalogcom'

distance = 192
spam score = 15
title = 'transportation shinycatalogcom'

distance = 192
spam score = 15
title = 'transportation shinycatalogcom'

distance = 193
spam score = 18
title = 'society and culture shinycatalogcom'

distance = 193
spam score = 16
title = 'education shinycatalogcom'

distance = 195
spam score = 17
title = 'weather shinycatalogcom'

distance = 195
spam score = 16
title = 'weather shinycatalogcom'

distance = 195
spam score = 14
title = 'travel and tourism shinycatalogcom'

distance = 195
spam score = 16
title = 'maps and views shinycatalogcom'

distance = 218
spam score = 16
title = 'recreation and sports shinycatalogcom'

distance = 219
spam score = 19
title = 'science and environment shinycatalogcom'

distance = 219
spam score = 19
title = 'science and environment shinycatalogcom'

distance = 219
spam score = 17
title = 'health shinycatalogcom'

distance = 220
spam score = 16
title = 'arts and entertainment shinycatalogcom'

distance = 220
spam score = 16
title = 'employment shinycatalogcom'

distance = 220
spam score = 18
title = 'society and culture shinycatalogcom'

distance = 220
spam score = 18
title = 'travel and tourism shinycatalogcom'

distance = 221
spam score = 19
title = 'guides and directories shinycatalogcom'

distance = 221
spam score = 16
title = 'arts and entertainment shinycatalogcom'

distance = 1834
spam score = 37
title = ''

distance = 75
spam score = 17
title = 'companies chooseindexcom'

distance = 75
spam score = 19
title = 'journals chooseindexcom'

distance = 75
spam score = 14
title = 'k 12 topazcatalogcom'

distance = 75
spam score = 10
title = 'companies chooseindexcom'

distance = 75
spam score = 16
title = 'companies chooseindexcom'

distance = 75
spam score = 18
title = 'journals chooseindexcom'

distance = 75
spam score = 12
title = 'companies topazcatalogcom'

distance = 75
spam score = 17
title = 'journals chooseindexcom'

distance = 75
spam score = 13
title = 'by company topazcatalogcom'

distance = 75
spam score = 13
title = 'journals topazcatalogcom'

distance = 75
spam score = 14
title = 'journals topazcatalogcom'

distance = 75
spam score = 18
title = 'year 2000 chooseindexcom'

distance = 75
spam score = 16
title = 'companies chooseindexcom'

distance = 75
spam score = 17
title = 'companies chooseindexcom'

distance = 75
spam score = 14
title = 'companies founddircom'

distance = 75
spam score = 16
title = 'companies chooseindexcom'

distance = 75
spam score = 17
title = 'companies chooseindexcom'

distance = 75
spam score = 17
title = 'journals chooseindexcom'

distance = 75
spam score = 15
title = 'k 12 founddircom'

distance = 75
spam score = 16
title = 'k 12 founddircom'

distance = 167
spam score = 15
title = 'employment topazcatalogcom'

distance = 167
spam score = 15
title = 'arts and entertainment faircatalogcom'

distance = 167
spam score = 15
title = 'wind power starrydirectorycom'

distance = 167
spam score = 15
title = 'arts and entertainment faircatalogcom'

distance = 167
spam score = 15
title = 'employment topazcatalogcom'

distance = 167
spam score = 13
title = 'employment topazcatalogcom'

distance = 167
spam score = 15
title = 'finance and investment founddircom'

distance = 167
spam score = 15
title = 'arts and entertainment faircatalogcom'

distance = 167
spam score = 19
title = 'types of food topazcatalogcom'

distance = 167
spam score = 15
title = 'arts and entertainment faircatalogcom'

distance = 183
spam score = 16
title = 'transportation faircatalogcom'

distance = 183
spam score = 16
title = 'poland urlspagecom'

distance = 183
spam score = 16
title = 'news and media founddircom'

distance = 183
spam score = 19
title = 'nevada directorybravocom'

distance = 183
spam score = 9
title = 'financing topazcatalogcom'

distance = 183
spam score = 17
title = 'arthropods starrydirectorycom'

distance = 183
spam score = 15
title = 'health founddircom'

distance = 183
spam score = 13
title = 'books topazcatalogcom'

distance = 183
spam score = 17
title = 'health directorybravocom'

distance = 183
spam score = 17
title = 'magazines chooseindexcom'

distance = 196
spam score = 15
title = 'budget urlspagecom'

distance = 196
spam score = 17
title = 'iceland azuritecatalogcom'

distance = 196
spam score = 17
title = 'education faircatalogcom'

distance = 196
spam score = 14
title = 'weather topazcatalogcom'

distance = 196
spam score = 15
title = 'energy begindirectorycom'

distance = 196
spam score = 17
title = 'semiconductors directorybravocom'

distance = 196
spam score = 14
title = 'etiquette topazcatalogcom'

distance = 196
spam score = 17
title = 'screen savers chooseindexcom'

distance = 196
spam score = 16
title = 'magazines chooseindexcom'

distance = 196
spam score = 14
title = 'museums and fine art topazcatalogcom'

distance = 212
spam score = 16
title = 'needlecrafts bloomcatalogcom'

distance = 212
spam score = 15
title = 'health faircatalogcom'

distance = 212
spam score = 17
title = 'psychology bloomcatalogcom'

distance = 212
spam score = 15
title = 'playstation dinamitdirectorycom'

distance = 212
spam score = 16
title = 'qui tam dinamitdirectorycom'

distance = 212
spam score = 18
title = 'rfcs chooseindexcom'

distance = 212
spam score = 17
title = 'consumer electronics chooseindexcom'

distance = 212
spam score = 13
title = 'directories choosedirectorycom'

distance = 212
spam score = 18
title = 'maps and views faircatalogcom'

distance = 212
spam score = 17
title = 'operations research starrydirectorycom'

distance = 229
spam score = 8
title = 'travel and tourism founddircom'

distance = 229
spam score = 16
title = 'internet broadcasts begindirectorycom'

distance = 229
spam score = 15
title = 'computer science begindirectorycom'

distance = 229
spam score = 17
title = 'inclusion urlspagecom'

distance = 229
spam score = 18
title = 'science and environment founddircom'

distance = 229
spam score = 15
title = 'computer science begindirectorycom'

distance = 229
spam score = 16
title = 'electrochemistry begindirectorycom'

distance = 229
spam score = 15
title = 'travel and tourism founddircom'

distance = 229
spam score = 11
title = 'women choosedirectorycom'

distance = 229
spam score = 19
title = 'browsers chooseindexcom'

distance = 245
spam score = 18
title = 'email addresses urlspagecom'

distance = 245
spam score = 15
title = 'desktop customization choosedirectorycom'

distance = 245
spam score = 15
title = 'real estate founddircom'

distance = 245
spam score = 13
title = 'archaeology begindirectorycom'

distance = 245
spam score = 16
title = 'quotations urlspagecom'

distance = 245
spam score = 12
title = 'ballroom bloomcatalogcom'

distance = 245
spam score = 15
title = 'real estate faircatalogcom'

distance = 245
spam score = 14
title = 'haunted lodging choosedirectorycom'

distance = 245
spam score = 16
title = 'employment faircatalogcom'

distance = 245
spam score = 13
title = 'manuscript showcases choosedirectorycom'

distance = 266
spam score = 12
title = 'showtimes bloomlistcom'

distance = 266
spam score = 15
title = 'armenia dinamitdirectorycom'

distance = 266
spam score = 14
title = 'employment topazcatalogcom'

distance = 266
spam score = 15
title = 'paintball clevercatalogcom'

distance = 266
spam score = 16
title = 'travel and tourism urlspagecom'

distance = 266
spam score = 16
title = 'guides and directories founddircom'

distance = 266
spam score = 15
title = 'eritrea urlspagecom'

distance = 266
spam score = 16
title = 'dodgeball bloomcatalogcom'

distance = 266
spam score = 15
title = 'health founddircom'

distance = 266
spam score = 18
title = 'clubs and organizations bloomlistcom'

distance = 303
spam score = 19
title = 'hydrology chooseindexcom'

distance = 303
spam score = 15
title = 'dominican republic urlspagecom'

distance = 303
spam score = 19
title = 'animals excellentpagecom'

distance = 303
spam score = 17
title = 'logic starrydirectorycom'

distance = 303
spam score = 16
title = 'british virgin islands dinamitdirectorycom'

distance = 303
spam score = 14
title = 'athletic recruiting urlspagecom'

distance = 303
spam score = 17
title = 'chat urlspagecom'

distance = 303
spam score = 17
title = 'treaties pacts and agreements urlspagecom'

distance = 303
spam score = 10
title = 'foreign employment choosedirectorycom'

distance = 303
spam score = 17
title = 'health groupurlscom'

distance = 22
spam score = 17
title = 'k 12 sapphiredirectorycom'

distance = 22
spam score = 15
title = 'companies sapphiredirectorycom'

distance = 55
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 16
title = 'transportation sapphiredirectorycom'

distance = 55
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 16
title = 'transportation sapphiredirectorycom'

distance = 55
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 17
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 16
title = 'transportation sapphiredirectorycom'

distance = 55
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 17
title = 'transportation sapphiredirectorycom'

distance = 55
spam score = 18
title = 'organizations sapphiredirectorycom'

distance = 55
spam score = 15
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 16
title = 'transportation sapphiredirectorycom'

distance = 55
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 55
spam score = 16
title = 'transportation sapphiredirectorycom'

distance = 116
spam score = 18
title = 'instructional technology sapphiredirectorycom'

distance = 116
spam score = 18
title = 'christian sapphiredirectorycom'

distance = 116
spam score = 18
title = 'languages sapphiredirectorycom'

distance = 117
spam score = 16
title = 'issues sapphiredirectorycom'

distance = 117
spam score = 15
title = 'learning centers sapphiredirectorycom'

distance = 118
spam score = 17
title = 'guides and directories sapphiredirectorycom'

distance = 118
spam score = 18
title = 'guides and directories sapphiredirectorycom'

distance = 118
spam score = 17
title = 'schools sapphiredirectorycom'

distance = 118
spam score = 15
title = 'dancing sapphiredirectorycom'

distance = 118
spam score = 19
title = 'institutes sapphiredirectorycom'

distance = 142
spam score = 16
title = 'arts and entertainment sapphiredirectorycom'

distance = 142
spam score = 15
title = 'shopping sapphiredirectorycom'

distance = 142
spam score = 16
title = 'transportation sapphiredirectorycom'

distance = 143
spam score = 17
title = 'group exhibits sapphiredirectorycom'

distance = 143
spam score = 17
title = 'employment sapphiredirectorycom'

distance = 143
spam score = 18
title = 'news and media sapphiredirectorycom'

distance = 145
spam score = 19
title = 'science and environment sapphiredirectorycom'

distance = 145
spam score = 16
title = 'recruiting and placement sapphiredirectorycom'

distance = 145
spam score = 18
title = 'student life sapphiredirectorycom'

distance = 145
spam score = 18
title = 'theorists sapphiredirectorycom'

distance = 158
spam score = 17
title = 'science and environment sapphiredirectorycom'

distance = 158
spam score = 17
title = 'transportation sapphiredirectorycom'

distance = 158
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 158
spam score = 17
title = 'science and environment sapphiredirectorycom'

distance = 158
spam score = 16
title = 'distorted people sapphiredirectorycom'

distance = 158
spam score = 18
title = 'news and media sapphiredirectorycom'

distance = 158
spam score = 18
title = 'science and environment sapphiredirectorycom'

distance = 158
spam score = 17
title = 'education sapphiredirectorycom'

distance = 159
spam score = 16
title = 'business and economy sapphiredirectorycom'

distance = 159
spam score = 15
title = 'real estate sapphiredirectorycom'

distance = 173
spam score = 16
title = 'transportation sapphiredirectorycom'

distance = 173
spam score = 16
title = 'education sapphiredirectorycom'

distance = 173
spam score = 17
title = 'education sapphiredirectorycom'

distance = 174
spam score = 17
title = 'travel and tourism sapphiredirectorycom'

distance = 174
spam score = 17
title = 'travel and tourism sapphiredirectorycom'

distance = 174
spam score = 17
title = 'government sapphiredirectorycom'

distance = 174
spam score = 16
title = 'employment sapphiredirectorycom'

distance = 174
spam score = 18
title = 'critical thinking sapphiredirectorycom'

distance = 174
spam score = 18
title = 'employment sapphiredirectorycom'

distance = 174
spam score = 15
title = 'weather sapphiredirectorycom'

distance = 192
spam score = 18
title = 'character education sapphiredirectorycom'

distance = 192
spam score = 17
title = 'industrial supplies sapphiredirectorycom'

distance = 192
spam score = 19
title = 'society and culture sapphiredirectorycom'

distance = 192
spam score = 16
title = 'transportation sapphiredirectorycom'

distance = 192
spam score = 16
title = 'arts and entertainment sapphiredirectorycom'

distance = 192
spam score = 18
title = 'maps and views sapphiredirectorycom'

distance = 193
spam score = 16
title = 'teaching resources sapphiredirectorycom'

distance = 193
spam score = 17
title = 'maps and views sapphiredirectorycom'

distance = 193
spam score = 16
title = 'recreation and sports sapphiredirectorycom'

distance = 193
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 212
spam score = 17
title = 'academic competitions sapphiredirectorycom'

distance = 212
spam score = 18
title = 'education sapphiredirectorycom'

distance = 212
spam score = 16
title = 'maps and views sapphiredirectorycom'

distance = 212
spam score = 15
title = 'business and economy sapphiredirectorycom'

distance = 213
spam score = 16
title = 'weather sapphiredirectorycom'

distance = 213
spam score = 17
title = 'science and environment sapphiredirectorycom'

distance = 213
spam score = 15
title = 'humor sapphiredirectorycom'

distance = 214
spam score = 20
title = 'society and culture sapphiredirectorycom'

distance = 214
spam score = 19
title = 'science and environment sapphiredirectorycom'

distance = 214
spam score = 16
title = 'recreation and sports sapphiredirectorycom'

distance = 234
spam score = 14
title = 'shopping sapphiredirectorycom'

distance = 234
spam score = 15
title = 'travel and tourism sapphiredirectorycom'

distance = 234
spam score = 15
title = 'government sapphiredirectorycom'

distance = 234
spam score = 16
title = 'travel and tourism sapphiredirectorycom'

distance = 234
spam score = 16
title = 'arts and entertainment sapphiredirectorycom'

distance = 235
spam score = 16
title = 'health sapphiredirectorycom'

distance = 235
spam score = 16
title = 'travel and tourism sapphiredirectorycom'

distance = 235
spam score = 15
title = 'health sapphiredirectorycom'

distance = 235
spam score = 16
title = 'real estate sapphiredirectorycom'

distance = 235
spam score = 18
title = 'science and environment sapphiredirectorycom'

distance = 272
spam score = 17
title = 'guides and directories sapphiredirectorycom'

distance = 273
spam score = 16
title = 'arts and entertainment sapphiredirectorycom'

distance = 273
spam score = 18
title = 'society and culture sapphiredirectorycom'

distance = 274
spam score = 18
title = 'science and environment sapphiredirectorycom'

distance = 274
spam score = 15
title = 'business and economy sapphiredirectorycom'

distance = 276
spam score = 17
title = 'maps and views sapphiredirectorycom'

distance = 276
spam score = 14
title = 'business and economy sapphiredirectorycom'

distance = 276
spam score = 14
title = 'shopping sapphiredirectorycom'

distance = 276
spam score = 15
title = 'business and economy sapphiredirectorycom'

distance = 276
spam score = 14
title = 'boardwalks sapphiredirectorycom'

distance = 1574
spam score = 67
title = 'tetropium fuscum'

distance = 1685
spam score = 52
title = ''

distance = 1711
spam score = 0
title = 'available uk domains made available by august 2008'

distance = 1721
spam score = 27
title = 'independent components corp'

distance = 1741
spam score = 21
title = 'trident ho military vehicles'

distance = 1750
spam score = 59
title = 'hair loss causes and treatments'

distance = 1761
spam score = 34
title = 'perfume originals essence oils'

distance = 1770
spam score = 46
title = ''

distance = 1817
spam score = 19
title = ''

distance = 110
spam score = 21
title = 'western north carolina woman magazine january 2010 vol 9 no 1'

distance = 110
spam score = 20
title = 'western north carolina woman magazine january 2010 vol 9 no 1'

distance = 110
spam score = 25
title = 'western north carolina woman magazine january 2010 vol 9 no 1'

distance = 114
spam score = 19
title = 'western north carolina woman magazine june 2010 vol 9 no 6'

distance = 114
spam score = 18
title = 'western north carolina woman magazine june 2010 vol 9 no 6'

distance = 114
spam score = 18
title = 'western north carolina woman magazine june 2010 vol 9 no 6'

distance = 121
spam score = 14
title = 'western north carolina woman magazine july 2009 vol 8 no 7'

distance = 124
spam score = 15
title = 'western north carolina woman magazine october 2010 vol 9 no 10'

distance = 129
spam score = 23
title = 'western north carolina woman magazine january 2010 vol 9 no 1'

distance = 129
spam score = 18
title = 'western north carolina woman magazine june 2010 vol 9 no 6'

distance = 129
spam score = 26
title = 'western north carolina woman magazine january 2010 vol 9 no 1'

distance = 129
spam score = 25
title = 'western north carolina woman magazine january 2010 vol 9 no 1'

distance = 129
spam score = 20
title = 'western north carolina woman magazine june 2010 vol 9 no 6'

distance = 129
spam score = 19
title = 'western north carolina woman magazine june 2010 vol 9 no 6'

distance = 130
spam score = 15
title = 'western north carolina woman magazine october 2010 vol 9 no 10'

distance = 132
spam score = 15
title = 'western north carolina woman magazine may 2009 vol 8 no 5'

distance = 132
spam score = 13
title = 'western north carolina woman magazine may 2009 vol 8 no 5'

distance = 136
spam score = 18
title = 'western north carolina woman magazine july 2009 vol 8 no 7'

distance = 138
spam score = 25
title = 'western north carolina woman january 2010 vol 9 no 1'

distance = 138
spam score = 26
title = 'western north carolina woman january 2010 vol 9 no 1'

distance = 177
spam score = 16
title = 'western north carolina woman november 2010 vol 9 no 11'

distance = 177
spam score = 17
title = 'western north carolina woman november 2010 vol 9 no 11'

distance = 179
spam score = 14
title = 'western north carolina woman july 2009 vol 8 no 7'

distance = 179
spam score = 21
title = 'western north carolina woman magazine november 2009 vol 8 no 11'

distance = 179
spam score = 22
title = 'western north carolina woman magazine november 2009 vol 8 no 11'

distance = 179
spam score = 23
title = 'western north carolina woman magazine november 2009 vol 8 no 11'

distance = 179
spam score = 19
title = 'western north carolina woman magazine november 2009 vol 8 no 11'

distance = 179
spam score = 16
title = 'western north carolina woman magazine november 2010 vol 9 no 11'

distance = 180
spam score = 12
title = 'western north carolina woman may 2009 vol 8 no 5'

distance = 180
spam score = 16
title = 'western north carolina woman may 2009 vol 8 no 5'

distance = 190
spam score = 17
title = 'western north carolina woman magazine august 2006 vol 5 no 8'

distance = 190
spam score = 16
title = 'western north carolina woman magazine january 2008 vol 7 no 1'

distance = 190
spam score = 18
title = 'western north carolina woman magazine january 2008 vol 7 no 1'

distance = 191
spam score = 13
title = 'western north carolina woman magazine may 2009 vol 8 no 5'

distance = 191
spam score = 14
title = 'western north carolina woman may 2009 vol 8 no 5'

distance = 192
spam score = 16
title = 'western north carolina woman august 2007 vol 6 no 8'

distance = 192
spam score = 16
title = 'western north carolina woman magazine may 2011 vol 10 no 5'

distance = 192
spam score = 12
title = 'western north carolina woman magazine may 2011 vol 10 no 5'

distance = 192
spam score = 16
title = 'western north carolina woman august 2007 vol 6 no 8'

distance = 192
spam score = 17
title = 'western north carolina woman august 2007 vol 6 no 8'

distance = 205
spam score = 17
title = 'western north carolina woman magazine september 2007 vol 6 no 9'

distance = 206
spam score = 15
title = 'western north carolina woman magazine may 2011 vol 10 no 5'

distance = 206
spam score = 14
title = 'western north carolina woman magazine may 2011 vol 10 no 5'

distance = 206
spam score = 15
title = 'western north carolina woman magazine may 2011 vol 10 no 5'

distance = 207
spam score = 33
title = 'western north carolina woman magazine january 2009 vol 8 no 1'

distance = 207
spam score = 17
title = 'western north carolina woman magazine september 2007 vol 6 no 9'

distance = 209
spam score = 17
title = 'western north carolina woman magazine september 2007 vol 6 no 9'

distance = 209
spam score = 16
title = 'western north carolina woman november 2010 vol 9 no 11'

distance = 209
spam score = 15
title = 'western north carolina woman magazine april 2011 vol 10 no 4'

distance = 210
spam score = 20
title = 'western north carolina woman february 2010 vol 9 no 2'

distance = 222
spam score = 14
title = 'western north carolina woman magazine october 2010 vol 9 no 10'

distance = 222
spam score = 18
title = 'western north carolina woman magazine february 2011 vol 10 no 2'

distance = 222
spam score = 17
title = 'western north carolina woman magazine august 2006 vol 5 no 8'

distance = 222
spam score = 13
title = 'western north carolina woman magazine november 2010 vol 9 no 11'

distance = 222
spam score = 16
title = 'western north carolina woman november 2010 vol 9 no 11'

distance = 223
spam score = 20
title = 'western north carolina woman magazine february 2010 vol 9 no 2'

distance = 223
spam score = 15
title = 'western north carolina woman october 2010 vol 9 no 10'

distance = 223
spam score = 18
title = 'western north carolina woman magazine july 2007 vol 6 no 7'

distance = 223
spam score = 21
title = 'western north carolina woman magazine january 2007 vol 6 no 1'

distance = 224
spam score = 17
title = 'western north carolina woman may 2007 vol 6 no 5'

distance = 240
spam score = 19
title = 'western north carolina woman february 2011 vol 10 no 2'

distance = 240
spam score = 17
title = 'western north carolina woman magazine august 2006 vol 5 no 8'

distance = 241
spam score = 16
title = 'western north carolina woman may 2011 vol 10 no 5'

distance = 241
spam score = 16
title = 'western north carolina woman magazine september 2006 vol 5 no 9'

distance = 241
spam score = 18
title = 'western north carolina woman magazine september 2006 vol 5 no 9'

distance = 241
spam score = 18
title = 'western north carolina woman may 2009 vol 8 no 5'

distance = 241
spam score = 16
title = 'western north carolina woman magazine september 2006 vol 5 no 9'

distance = 241
spam score = 18
title = 'western north carolina woman magazine may 2011 vol 10 no 5'

distance = 242
spam score = 18
title = 'western north carolina woman november 2010 vol 9 no 11'

distance = 242
spam score = 18
title = 'western north carolina woman magazine july 2007 vol 6 no 7'

distance = 256
spam score = 17
title = 'western north carolina woman magazine august 2006 vol 5 no 8'

distance = 256
spam score = 19
title = 'western north carolina woman magazine september 2006 vol 5 no 9'

distance = 256
spam score = 15
title = 'western north carolina woman september 2007 vol 6 no 9'

distance = 256
spam score = 21
title = 'western north carolina woman magazine january 2007 vol 6 no 1'

distance = 257
spam score = 18
title = 'western north carolina woman july 2007 vol 6 no 7'

distance = 257
spam score = 20
title = 'western north carolina woman january 2008 vol 7 no 1'

distance = 257
spam score = 14
title = 'western north carolina woman magazine june 2008 vol 7 no 5'

distance = 257
spam score = 15
title = 'western north carolina woman may 2008 vol 7 no 5'

distance = 258
spam score = 20
title = 'western north carolina woman april 2010 vol 9 no 4'

distance = 259
spam score = 19
title = 'western north carolina woman july 2007 vol 6 no 7'

distance = 275
spam score = 19
title = 'western north carolina woman magazine february 2007 vol 6 no 2'

distance = 275
spam score = 15
title = 'western north carolina woman magazine december 2010 vol 9 no 12'

distance = 275
spam score = 15
title = 'western north carolina woman magazine december 2010 vol 9 no 12'

distance = 275
spam score = 15
title = 'western north carolina woman magazine september 2007 vol 6 no 9'

distance = 275
spam score = 18
title = 'western north carolina woman magazine february 2009 vol 8 no 2'

distance = 275
spam score = 20
title = 'western north carolina woman february 2007 vol 6 no 2'

distance = 275
spam score = 14
title = 'western north carolina woman magazine october 2009 vol 8 no 10'

distance = 276
spam score = 17
title = 'western north carolina woman january 2007 vol 6 no 1'

distance = 278
spam score = 19
title = 'western north carolina woman magazine february 2007 vol 6 no 2'

distance = 278
spam score = 17
title = 'western north carolina woman magazine may 2007 vol 6 no 4'

distance = 310
spam score = 21
title = 'western north carolina woman magazine april 2010 vol 9 no 4'

distance = 310
spam score = 15
title = 'western north carolina woman may 2008 vol 7 no 5'

distance = 310
spam score = 20
title = 'western north carolina woman february 2009 vol 8 no 2'

distance = 310
spam score = 17
title = 'western north carolina woman december 2010 vol 9 no 12'

distance = 310
spam score = 19
title = 'western north carolina woman magazine november 2006 vol 5 no 10'

distance = 310
spam score = 17
title = 'western north carolina woman september 2007 vol 6 no 9'

distance = 310
spam score = 16
title = 'western north carolina woman magazine april 2010 vol 9 no 4'

distance = 311
spam score = 21
title = 'western north carolina woman february 2009 vol 8 no 2'

distance = 312
spam score = 19
title = 'western north carolina woman february 2009 vol 8 no 2'

distance = 313
spam score = 21
title = 'western north carolina woman april 2010 vol 9 no 4'

distance = 1512
spam score = 87
title = 'the montreal mirror news arts film music'

distance = 1561
spam score = 69
title = 'welcome to the fender amp field guide'

distance = 1692
spam score = 28
title = 'tshirt gallery'

distance = 1713
spam score = 71
title = ''

distance = 1836
spam score = 3
title = 'playboy magazine 1974 watergate nixon hank aaron salvador dali art'

distance = 305
spam score = 31
title = ''

distance = 313
spam score = 48
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 22
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 24
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 2
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 24
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 149
spam score = 23
title = ''

distance = 154
spam score = 24
title = ''

distance = 154
spam score = 23
title = ''

distance = 154
spam score = 23
title = ''

distance = 154
spam score = 23
title = ''

distance = 154
spam score = 23
title = ''

distance = 154
spam score = 23
title = ''

distance = 154
spam score = 23
title = ''

distance = 154
spam score = 23
title = ''

distance = 154
spam score = 23
title = ''

distance = 154
spam score = 24
title = ''

distance = 154
spam score = 23
title = ''

distance = 154
spam score = 23
title = ''

distance = 1650
spam score = 12
title = 'essay depot philosophy bit philosophistry'

distance = 1652
spam score = 88
title = 'filters for families the solution page 6'

distance = 1718
spam score = 22
title = 'sample sentences for the gre study word annex'

distance = 1804
spam score = 62
title = '2010 nwchem workshop'

distance = 1821
spam score = 66
title = ''

distance = 1869
spam score = 36
title = 'brain atlas of human embryology chronolab'

distance = 117
spam score = 22
title = 'buy a pendant episcopalian buy religious gifts online'

distance = 118
spam score = 21
title = 'buy a pendant innkeeper buy religious gifts online'

distance = 124
spam score = 23
title = 'buy a pendant fish buy religious gifts online'

distance = 124
spam score = 23
title = 'buy a pendant chai buy religious gifts online'

distance = 125
spam score = 22
title = 'buy a crusifix pendant buy religious gifts online'

distance = 125
spam score = 22
title = 'buy a pendant presbyterian buy religious gifts online'

distance = 125
spam score = 23
title = 'buy a pendant angel buy religious gifts online'

distance = 126
spam score = 22
title = 'buy a pendant mary buy religious gifts online'

distance = 127
spam score = 24
title = 'buy a pendant baptist buy religious gifts online'

distance = 128
spam score = 23
title = 'buy a ten commandments pendant buy religious gifts online'

distance = 130
spam score = 24
title = 'buy a pendant crucifix buy religious gifts online'

distance = 130
spam score = 24
title = 'buy a pendant gasparound buy religious gifts online'

distance = 131
spam score = 23
title = 'buy a pendant ox buy religious gifts online'

distance = 132
spam score = 22
title = 'buy a pendant cross buy religious gifts online'

distance = 132
spam score = 23
title = 'buy a cross pendant buy religious gifts online'

distance = 132
spam score = 23
title = 'buy a pendant cross buy religious gifts online'

distance = 132
spam score = 24
title = 'buy a pendant methodist buy religious gifts online'

distance = 132
spam score = 24
title = 'buy a cross pendant 28x19 buy religious gifts online'

distance = 132
spam score = 24
title = 'buy a cross pendant 145x11 buy religious gifts online'

distance = 132
spam score = 24
title = 'buy a cross pendant 23x16 buy religious gifts online'

distance = 227
spam score = 22
title = 'buy a rosary garnet buy religious gifts online'

distance = 228
spam score = 22
title = 'buy a snake chain buy religious gifts online'

distance = 228
spam score = 25
title = 'buy a cross design buy religious gifts online'

distance = 228
spam score = 25
title = 'buy a foxtail chain buy religious gifts online'

distance = 228
spam score = 23
title = 'buy a squirrel brooch buy religious gifts online'

distance = 228
spam score = 24
title = 'buy a figaround chain buy religious gifts online'

distance = 229
spam score = 22
title = 'buy a fig innkeeper buy religious gifts online'

distance = 229
spam score = 23
title = 'buy a rosary onyx buy religious gifts online'

distance = 229
spam score = 23
title = 'buy a pendant baby jesus buy religious gifts online'

distance = 230
spam score = 24
title = 'buy a lp crucifix buy religious gifts online'

distance = 249
spam score = 23
title = 'buy a fig balthazar buy religious gifts online'

distance = 249
spam score = 24
title = 'buy a fig shepheround buy religious gifts online'

distance = 251
spam score = 23
title = 'buy a fig star buy religious gifts online'

distance = 255
spam score = 23
title = 'buy a ladybug brooch buy religious gifts online'

distance = 257
spam score = 25
title = 'buy a pendant medal ov miraculous buy religious gifts online'

distance = 257
spam score = 24
title = 'buy a fig camel buy religious gifts online'

distance = 262
spam score = 23
title = 'buy a pendant medal cross 4way buy religious gifts online'

distance = 271
spam score = 23
title = 'buy a oval miraculous pendant locket buy religious gifts online'

distance = 272
spam score = 25
title = 'buy a st christopher pendant medal buy religious gifts online'

distance = 272
spam score = 22
title = 'buy a pendant with me always angel heart buy religious gifts online'

distance = 295
spam score = 23
title = 'buy a diamond cross pendant with heart buy religious gifts online'

distance = 296
spam score = 24
title = 'buy a rosary red cloisonne buy religious gifts online'

distance = 296
spam score = 21
title = 'buy a immaculate heart of mary with o j buy religious gifts online'

distance = 296
spam score = 21
title = 'buy a pendant crucifix twotone hollow buy religious gifts online'

distance = 297
spam score = 24
title = 'buy a pendant cross celtic fancy buy religious gifts online'

distance = 297
spam score = 23
title = 'buy a pendant star of david twotone buy religious gifts online'

distance = 297
spam score = 22
title = 'buy a pendant locket book with cross buy religious gifts online'

distance = 298
spam score = 25
title = 'buy a pendant cross our father buy religious gifts online'

distance = 298
spam score = 24
title = 'buy a pendant round holy communion buy religious gifts online'

distance = 298
spam score = 25
title = 'buy a medal st lazarus buy religious gifts online'

distance = 309
spam score = 22
title = 'buy a pendant cross rugged with box buy religious gifts online'

distance = 309
spam score = 22
title = 'buy a god bless america buy religious gifts online'

distance = 310
spam score = 21
title = 'buy a rosary bracelet garnet buy religious gifts online'

distance = 310
spam score = 23
title = 'buy a oval snake chain buy religious gifts online'

distance = 310
spam score = 24
title = 'buy a solid foxtail chain buy religious gifts online'

distance = 310
spam score = 25
title = 'buy a pendant childs cross with star buy religious gifts online'

distance = 311
spam score = 23
title = 'buy a pendant cross greek plain buy religious gifts online'

distance = 311
spam score = 23
title = 'buy a pendant head of jesus with crown buy religious gifts online'

distance = 311
spam score = 23
title = 'buy a lp fish with cross buy religious gifts online'

distance = 311
spam score = 25
title = 'buy a pin baptismal miraculous buy religious gifts online'

distance = 323
spam score = 24
title = 'buy a guadalupejesus medal buy religious gifts online'

distance = 323
spam score = 23
title = 'buy a eagle lapel pin buy religious gifts online'

distance = 323
spam score = 23
title = 'buy a lapel pin menorah buy religious gifts online'

distance = 323
spam score = 24
title = 'buy a san damiano cross buy religious gifts online'

distance = 323
spam score = 24
title = 'buy a us army lapel pin buy religious gifts online'

distance = 324
spam score = 23
title = 'buy a spanish shipwreckgertrude buy religious gifts online'

distance = 324
spam score = 23
title = 'buy a rosary bracelet amethest buy religious gifts online'

distance = 324
spam score = 25
title = 'buy a lp fish with jesus buy religious gifts online'

distance = 324
spam score = 23
title = 'buy a flat wheat chain buy religious gifts online'

distance = 324
spam score = 23
title = 'buy a jesus lapel pin buy religious gifts online'

distance = 369
spam score = 22
title = 'buy a pendant locket heart with cross tt buy religious gifts online'

distance = 370
spam score = 24
title = 'buy a pendant medal round st thomas buy religious gifts online'

distance = 370
spam score = 25
title = 'buy a pendant medal round holy trinity buy religious gifts online'

distance = 370
spam score = 24
title = 'buy a key chain ov miraculous buy religious gifts online'

distance = 370
spam score = 21
title = 'buy a hollow satin puzzle chain buy religious gifts online'

distance = 370
spam score = 24
title = 'buy a pendant medal round holy communion buy religious gifts online'

distance = 371
spam score = 23
title = 'buy a pendant cross with mary coin amp frame buy religious gifts online'

distance = 371
spam score = 25
title = 'buy a pendant medal round infant jesus buy religious gifts online'

distance = 371
spam score = 24
title = 'buy a pendant medal round st mark buy religious gifts online'

distance = 371
spam score = 22
title = 'buy a pendant cross with wedding bands tt buy religious gifts online'

distance = 386
spam score = 24
title = 'buy a lapel pin st michael buy religious gifts online'

distance = 387
spam score = 23
title = 'buy a pendant cross with jesus coinframe buy religious gifts online'

distance = 387
spam score = 24
title = 'buy a white pearlampquad bead buy religious gifts online'

distance = 387
spam score = 24
title = 'buy a st jude round medal buy religious gifts online'

distance = 388
spam score = 22
title = 'buy a solid box chain with 3 hearts buy religious gifts online'

distance = 388
spam score = 22
title = 'buy a etched heart locket with cross buy religious gifts online'

distance = 388
spam score = 25
title = 'buy a st joseph round medal buy religious gifts online'

distance = 389
spam score = 24
title = 'buy a solid pearl amp gem chain buy religious gifts online'

distance = 389
spam score = 25
title = 'buy a white pearl tin cup buy religious gifts online'

distance = 390
spam score = 22
title = 'buy a with me alwyas angel lapel pin buy religious gifts online'

distance = 405
spam score = 24
title = 'buy a solid domed omega chain buy religious gifts online'

distance = 405
spam score = 22
title = 'buy a blessed virgin rosary center buy religious gifts online'

distance = 407
spam score = 24
title = 'buy a key chain holy spirit buy religious gifts online'

distance = 408
spam score = 24
title = 'buy a lapel pin footprints in sand buy religious gifts online'

distance = 412
spam score = 22
title = 'buy a us army aviator lapel pin buy religious gifts online'

distance = 414
spam score = 23
title = 'buy a cara vaca crucifix buy religious gifts online'

distance = 414
spam score = 25
title = 'buy a pendant medal st martin de porres buy religious gifts online'

distance = 415
spam score = 23
title = 'buy a pendant medal round st john neumann buy religious gifts online'

distance = 416
spam score = 23
title = 'buy a key chain blessed sacrament buy religious gifts online'

distance = 417
spam score = 24
title = 'buy a stainless mesh with 14ky clasp buy religious gifts online'

distance = 559
spam score = 23
title = 'buy a cocoon chain stainless18ky tt 18 inchmm buy religious gifts online'

distance = 1654
spam score = 3
title = 'buying diovan legally buy online no prescription needed'

distance = 82
spam score = 28
title = ''

distance = 82
spam score = 28
title = ''

distance = 82
spam score = 28
title = ''

distance = 82
spam score = 29
title = ''

distance = 82
spam score = 29
title = ''

distance = 82
spam score = 28
title = ''

distance = 166
spam score = 24
title = ''

distance = 239
spam score = 27
title = ''

distance = 430
spam score = 23
title = ''

distance = 463
spam score = 17
title = ''

distance = 488
spam score = 22
title = ''

distance = 587
spam score = 19
title = ''

distance = 590
spam score = 18
title = ''

distance = 126
spam score = 17
title = 'journals growdirectorycom'

distance = 126
spam score = 15
title = 'companies growdirectorycom'

distance = 131
spam score = 14
title = 'companies starrydirectorycom'

distance = 131
spam score = 15
title = 'companies starrydirectorycom'

distance = 134
spam score = 13
title = 'journals onyxlistcom'

distance = 134
spam score = 12
title = 'companies onyxlistcom'

distance = 135
spam score = 15
title = 'companies groupurlscom'

distance = 135
spam score = 18
title = 'journals groupurlscom'

distance = 135
spam score = 16
title = 'journals groupurlscom'

distance = 135
spam score = 18
title = 'journals groupurlscom'

distance = 136
spam score = 16
title = 'journals dinamitdirectorycom'

distance = 136
spam score = 14
title = 'companies dinamitdirectorycom'

distance = 138
spam score = 13
title = 'companies topazdirectorycom'

distance = 138
spam score = 15
title = 'journals topazdirectorycom'

distance = 139
spam score = 17
title = 'journals azuritecatalogcom'

distance = 139
spam score = 16
title = 'companies azuritecatalogcom'

distance = 139
spam score = 16
title = 'companies azuritecatalogcom'

distance = 139
spam score = 17
title = 'journals azuritecatalogcom'

distance = 139
spam score = 16
title = 'companies azuritecatalogcom'

distance = 139
spam score = 16
title = 'journals azuritecatalogcom'

distance = 214
spam score = 17
title = 'families groupurlscom'

distance = 214
spam score = 14
title = 'institutes urlslistcom'

distance = 214
spam score = 16
title = 'history azuritecatalogcom'

distance = 214
spam score = 19
title = 'people of color growdirectorycom'

distance = 214
spam score = 17
title = 'legal information growdirectorycom'

distance = 214
spam score = 17
title = 'opera growdirectorycom'

distance = 214
spam score = 14
title = 'child abuse topazcatalogcom'

distance = 214
spam score = 16
title = 'political issues growdirectorycom'

distance = 214
spam score = 16
title = 'weather topazdirectorycom'

distance = 214
spam score = 17
title = 'research labs azuritecatalogcom'

distance = 231
spam score = 17
title = 'guides and directories topazdirectorycom'

distance = 231
spam score = 18
title = 'cultural anthropology azuritecatalogcom'

distance = 231
spam score = 24
title = 'organizations groupurlscom'

distance = 231
spam score = 17
title = 'russia azuritecatalogcom'

distance = 231
spam score = 19
title = 'news and media azuritecatalogcom'

distance = 231
spam score = 17
title = 'sweden azuritecatalogcom'

distance = 231
spam score = 20
title = 'coriolis force azuritecatalogcom'

distance = 231
spam score = 16
title = 'java begindirectorycom'

distance = 231
spam score = 20
title = 'news and media azuritecatalogcom'

distance = 231
spam score = 19
title = 'education starrylistcom'

distance = 244
spam score = 16
title = 'magazines and ezines groupurlscom'

distance = 244
spam score = 17
title = 'angola azuritecatalogcom'

distance = 244
spam score = 16
title = 'conferences begindirectorycom'

distance = 244
spam score = 13
title = 'costuming topazdirectorycom'

distance = 245
spam score = 20
title = 'consortia directorybravocom'

distance = 245
spam score = 16
title = 'fractal music azuritecatalogcom'

distance = 245
spam score = 18
title = 'government azuritecatalogcom'

distance = 245
spam score = 17
title = 'employment topazdirectorycom'

distance = 245
spam score = 19
title = 'columns and columnists azuritecatalogcom'

distance = 245
spam score = 18
title = 'journals urlslistcom'

distance = 260
spam score = 18
title = 'society and culture topazdirectorycom'

distance = 260
spam score = 16
title = 'virtual field trips growdirectorycom'

distance = 260
spam score = 16
title = 'mime begindirectorycom'

distance = 260
spam score = 17
title = 'antiques and collectibles dinamitdirectorycom'

distance = 260
spam score = 16
title = 'maps and views onyxlistcom'

distance = 260
spam score = 16
title = 'guides and directories onyxlistcom'

distance = 260
spam score = 17
title = 'organizations growdirectorycom'

distance = 260
spam score = 17
title = 'employment groupurlscom'

distance = 260
spam score = 14
title = 'web directories onyxlistcom'

distance = 260
spam score = 16
title = 'shopping groupurlscom'

distance = 275
spam score = 14
title = 'web directories begindirectorycom'

distance = 275
spam score = 17
title = 'us judiciary and supreme court growdirectorycom'

distance = 275
spam score = 19
title = 'institutes chooseindexcom'

distance = 275
spam score = 16
title = 'real estate azuritecatalogcom'

distance = 275
spam score = 17
title = 'religions begindirectorycom'

distance = 275
spam score = 20
title = 'news and media starrylistcom'

distance = 275
spam score = 17
title = 'south africa starrylistcom'

distance = 275
spam score = 18
title = 'real estate azuritecatalogcom'

distance = 275
spam score = 16
title = 'political theory growdirectorycom'

distance = 275
spam score = 19
title = 'maps and views groupurlscom'

distance = 292
spam score = 16
title = 'finance and investment starrylistcom'

distance = 292
spam score = 16
title = 'software directorybravocom'

distance = 292
spam score = 16
title = 'mongolia starrylistcom'

distance = 292
spam score = 15
title = 'robotics urlslistcom'

distance = 292
spam score = 17
title = 'government azuritecatalogcom'

distance = 292
spam score = 17
title = 'employment and workplace issues growdirectorycom'

distance = 292
spam score = 17
title = 'economists urlslistcom'

distance = 292
spam score = 14
title = 'youth violence topazcatalogcom'

distance = 292
spam score = 18
title = 'guides and directories starrylistcom'

distance = 292
spam score = 15
title = 'pets and animals onyxlistcom'

distance = 311
spam score = 17
title = 'transportation groupurlscom'

distance = 311
spam score = 16
title = 'arts and entertainment azuritecatalogcom'

distance = 312
spam score = 20
title = 'society and culture starrylistcom'

distance = 312
spam score = 16
title = 'estonia growdirectorycom'

distance = 312
spam score = 17
title = 'hungary growdirectorycom'

distance = 312
spam score = 15
title = 'geeks begindirectorycom'

distance = 312
spam score = 15
title = 'web directories starrylistcom'

distance = 312
spam score = 14
title = 'web directories starrylistcom'

distance = 312
spam score = 19
title = 'information technology policy azuritecatalogcom'

distance = 312
spam score = 17
title = 'facilities morganitecatalogcom'

distance = 341
spam score = 13
title = 'web directories starrylistcom'

distance = 341
spam score = 18
title = 'government groupurlscom'

distance = 341
spam score = 16
title = 'mathematics on postage stamps chooseindexcom'

distance = 341
spam score = 15
title = 'food and drink topazdirectorycom'

distance = 342
spam score = 18
title = 'maps and views groupurlscom'

distance = 342
spam score = 17
title = 'yugoslavia serbia and montenegro starrylistcom'

distance = 342
spam score = 17
title = 'linux begindirectorycom'

distance = 342
spam score = 17
title = 'burkina faso growdirectorycom'

distance = 342
spam score = 19
title = 'engineering growdirectorycom'

distance = 342
spam score = 15
title = 'lesbians gays and bisexuals starrylistcom'

distance = 1784
spam score = 29
title = 'echoechocom komplett javascript kurs'

distance = 1795
spam score = 47
title = 'babel'

distance = 1822
spam score = 42
title = ''

distance = 1834
spam score = 30
title = 'thiazolidines'

distance = 1836
spam score = 93
title = 'britannia index somerset history'

distance = 2
spam score = 52
title = 'indiana university course browser'

distance = 2
spam score = 49
title = 'indiana university course browser'

distance = 2
spam score = 51
title = 'indiana university course browser'

distance = 2
spam score = 50
title = 'indiana university course browser'

distance = 2
spam score = 50
title = 'indiana university course browser'

distance = 2
spam score = 55
title = 'indiana university course browser'

distance = 2
spam score = 54
title = 'indiana university course browser'

distance = 2
spam score = 51
title = 'indiana university course browser'

distance = 2
spam score = 55
title = 'indiana university course browser'

distance = 2
spam score = 48
title = 'indiana university course browser'

distance = 2
spam score = 54
title = 'indiana university course browser'

distance = 2
spam score = 44
title = 'indiana university course browser'

distance = 2
spam score = 48
title = 'indiana university course browser'

distance = 2
spam score = 53
title = 'indiana university course browser'

distance = 2
spam score = 49
title = 'indiana university course browser'

distance = 2
spam score = 52
title = 'indiana university course browser'

distance = 2
spam score = 48
title = 'indiana university course browser'

distance = 2
spam score = 50
title = 'indiana university course browser'

distance = 2
spam score = 45
title = 'indiana university course browser'

distance = 2
spam score = 34
title = 'indiana university course browser'

distance = 62
spam score = 35
title = 'indiana university course browser'

distance = 62
spam score = 51
title = 'indiana university course browser'

distance = 62
spam score = 51
title = 'indiana university course browser'

distance = 63
spam score = 46
title = 'indiana university course browser'

distance = 63
spam score = 50
title = 'indiana university course browser'

distance = 63
spam score = 52
title = 'indiana university course browser'

distance = 63
spam score = 40
title = 'indiana university course browser'

distance = 63
spam score = 49
title = 'indiana university course browser'

distance = 63
spam score = 43
title = 'indiana university course browser'

distance = 63
spam score = 53
title = 'indiana university course browser'

distance = 95
spam score = 53
title = 'indiana university course browser'

distance = 95
spam score = 52
title = 'indiana university course browser'

distance = 95
spam score = 53
title = 'indiana university course browser'

distance = 95
spam score = 52
title = 'indiana university course browser'

distance = 96
spam score = 51
title = 'indiana university course browser'

distance = 96
spam score = 53
title = 'indiana university course browser'

distance = 96
spam score = 51
title = 'indiana university course browser'

distance = 96
spam score = 50
title = 'indiana university course browser'

distance = 96
spam score = 51
title = 'indiana university course browser'

distance = 96
spam score = 58
title = 'indiana university course browser'

distance = 126
spam score = 59
title = 'indiana university course browser'

distance = 126
spam score = 47
title = 'indiana university course browser'

distance = 126
spam score = 52
title = 'indiana university course browser'

distance = 126
spam score = 57
title = 'indiana university course browser'

distance = 126
spam score = 52
title = 'indiana university course browser'

distance = 126
spam score = 54
title = 'indiana university course browser'

distance = 126
spam score = 50
title = 'indiana university course browser'

distance = 126
spam score = 50
title = 'indiana university course browser'

distance = 126
spam score = 50
title = 'indiana university course browser'

distance = 126
spam score = 51
title = 'indiana university course browser'

distance = 143
spam score = 52
title = 'indiana university course browser'

distance = 143
spam score = 48
title = 'indiana university course browser'

distance = 143
spam score = 51
title = 'indiana university course browser'

distance = 143
spam score = 51
title = 'indiana university course browser'

distance = 143
spam score = 52
title = 'indiana university course browser'

distance = 143
spam score = 55
title = 'indiana university course browser'

distance = 143
spam score = 55
title = 'indiana university course browser'

distance = 143
spam score = 51
title = 'indiana university course browser'

distance = 144
spam score = 54
title = 'indiana university course browser'

distance = 144
spam score = 53
title = 'indiana university course browser'

distance = 166
spam score = 52
title = 'indiana university course browser'

distance = 166
spam score = 52
title = 'indiana university course browser'

distance = 166
spam score = 52
title = 'indiana university course browser'

distance = 166
spam score = 51
title = 'indiana university course browser'

distance = 166
spam score = 53
title = 'indiana university course browser'

distance = 167
spam score = 52
title = 'indiana university course browser'

distance = 167
spam score = 56
title = 'indiana university course browser'

distance = 167
spam score = 45
title = 'indiana university course browser'

distance = 167
spam score = 51
title = 'indiana university course browser'

distance = 168
spam score = 58
title = 'indiana university course browser'

distance = 189
spam score = 56
title = 'indiana university course browser'

distance = 189
spam score = 51
title = 'indiana university course browser'

distance = 189
spam score = 51
title = 'indiana university course browser'

distance = 189
spam score = 51
title = 'indiana university course browser'

distance = 189
spam score = 51
title = 'indiana university course browser'

distance = 189
spam score = 54
title = 'indiana university course browser'

distance = 189
spam score = 55
title = 'indiana university course browser'

distance = 189
spam score = 51
title = 'indiana university course browser'

distance = 189
spam score = 50
title = 'indiana university course browser'

distance = 189
spam score = 52
title = 'indiana university course browser'

distance = 226
spam score = 52
title = 'indiana university course browser'

distance = 226
spam score = 52
title = 'indiana university course browser'

distance = 227
spam score = 47
title = 'indiana university course browser'

distance = 227
spam score = 56
title = 'indiana university course browser'

distance = 227
spam score = 50
title = 'indiana university course browser'

distance = 227
spam score = 54
title = 'indiana university course browser'

distance = 227
spam score = 55
title = 'indiana university course browser'

distance = 227
spam score = 54
title = 'indiana university course browser'

distance = 227
spam score = 48
title = 'indiana university course browser'

distance = 227
spam score = 58
title = 'indiana university course browser'

distance = 276
spam score = 51
title = 'indiana university course browser'

distance = 276
spam score = 52
title = 'indiana university course browser'

distance = 277
spam score = 53
title = 'indiana university course browser'

distance = 277
spam score = 50
title = 'indiana university course browser'

distance = 277
spam score = 50
title = 'indiana university course browser'

distance = 277
spam score = 51
title = 'indiana university course browser'

distance = 277
spam score = 51
title = 'indiana university course browser'

distance = 278
spam score = 55
title = 'indiana university course browser'

distance = 278
spam score = 52
title = 'indiana university course browser'

distance = 279
spam score = 51
title = 'indiana university course browser'

distance = 1919
spam score = 65
title = 'azerbaijan list of final tables'

distance = 154
spam score = 30
title = 'hastings florists florists in hastings minnesota mn'

distance = 196
spam score = 29
title = 'walls florists florists in walls mississippi ms'

distance = 216
spam score = 25
title = 'cumming florists florists in cumming georgia ga'

distance = 218
spam score = 31
title = 'frazee florists florists in frazee minnesota mn'

distance = 219
spam score = 31
title = 'rochert florists florists in rochert minnesota mn'

distance = 219
spam score = 29
title = 'hoffman florists florists in hoffman minnesota mn'

distance = 220
spam score = 30
title = 'jordan florists florists in jordan minnesota mn'

distance = 221
spam score = 30
title = 'hope florists florists in hope minnesota mn'

distance = 221
spam score = 29
title = 'hugo florists florists in hugo minnesota mn'

distance = 222
spam score = 35
title = 'welcome florists florists in welcome minnesota mn'

distance = 222
spam score = 29
title = 'ponemah florists florists in ponemah minnesota mn'

distance = 222
spam score = 28
title = 'holloway florists florists in holloway minnesota mn'

distance = 223
spam score = 30
title = 'orr florists florists in orr minnesota mn'

distance = 223
spam score = 28
title = 'kilkenny florists florists in kilkenny minnesota mn'

distance = 225
spam score = 28
title = 'kinney florists florists in kinney minnesota mn'

distance = 225
spam score = 28
title = 'marshall florists florists in marshall minnesota mn'

distance = 225
spam score = 28
title = 'kiester florists florists in kiester minnesota mn'

distance = 226
spam score = 30
title = 'nevis florists florists in nevis minnesota mn'

distance = 226
spam score = 28
title = 'kerkhoven florists florists in kerkhoven minnesota mn'

distance = 226
spam score = 29
title = 'sabin florists florists in sabin minnesota mn'

distance = 288
spam score = 34
title = 'grimes florists florists in grimes iowa ia'

distance = 288
spam score = 29
title = 'jenkins florists florists in jenkins minnesota mn'

distance = 288
spam score = 23
title = 'ocilla florists florists in ocilla georgia ga'

distance = 288
spam score = 24
title = 'oakfield florists florists in oakfield georgia ga'

distance = 288
spam score = 25
title = 'gough florists florists in gough georgia ga'

distance = 288
spam score = 33
title = 'forbes florists florists in forbes minnesota mn'

distance = 288
spam score = 30
title = 'two harbors florists florists in two harbors minnesota mn'

distance = 288
spam score = 24
title = 'evans florists florists in evans georgia ga'

distance = 288
spam score = 22
title = 'gladbrook florists florists in gladbrook iowa ia'

distance = 288
spam score = 32
title = 'baudette florists florists in baudette minnesota mn'

distance = 299
spam score = 23
title = 'lakemont florists florists in lakemont georgia ga'

distance = 299
spam score = 34
title = 'massena florists florists in massena iowa ia'

distance = 299
spam score = 24
title = 'oglethorpe florists florists in oglethorpe georgia ga'

distance = 299
spam score = 24
title = 'tallapoosa florists florists in tallapoosa georgia ga'

distance = 299
spam score = 23
title = 'lumpkin florists florists in lumpkin georgia ga'

distance = 299
spam score = 32
title = 'canyon florists florists in canyon minnesota mn'

distance = 299
spam score = 26
title = 'weston florists florists in weston georgia ga'

distance = 299
spam score = 30
title = 'sandersville florists florists in sandersville mississippi ms'

distance = 299
spam score = 38
title = 'new sharon florists florists in new sharon iowa ia'

distance = 299
spam score = 30
title = 'sherard florists florists in sherard mississippi ms'

distance = 313
spam score = 34
title = 'mediapolis florists florists in mediapolis iowa ia'

distance = 313
spam score = 26
title = 'cheshire florists florists in cheshire connecticut ct'

distance = 313
spam score = 24
title = 'litchfield florists florists in litchfield connecticut ct'

distance = 313
spam score = 31
title = 'dayton florists florists in dayton minnesota mn'

distance = 313
spam score = 25
title = 'redding florists florists in redding connecticut ct'

distance = 314
spam score = 33
title = 'fairmont florists florists in fairmont minnesota mn'

distance = 314
spam score = 33
title = 'staples florists florists in staples minnesota mn'

distance = 314
spam score = 35
title = 'harcourt florists florists in harcourt iowa ia'

distance = 314
spam score = 33
title = 'solway florists florists in solway minnesota mn'

distance = 314
spam score = 29
title = 'seminary florists florists in seminary mississippi ms'

distance = 327
spam score = 34
title = 'palo florists florists in palo iowa ia'

distance = 327
spam score = 31
title = 'saint peter florists florists in saint peter minnesota mn'

distance = 327
spam score = 25
title = 'georgetown florists florists in georgetown connecticut ct'

distance = 327
spam score = 26
title = 'ashford florists florists in ashford connecticut ct'

distance = 327
spam score = 31
title = 'butterfield florists florists in butterfield minnesota mn'

distance = 327
spam score = 32
title = 'greenville florists florists in greenville mississippi ms'

distance = 327
spam score = 24
title = 'springfield florists florists in springfield georgia ga'

distance = 327
spam score = 23
title = 'montrose florists florists in montrose georgia ga'

distance = 327
spam score = 31
title = 'rembrandt florists florists in rembrandt iowa ia'

distance = 327
spam score = 33
title = 'barnesville florists florists in barnesville minnesota mn'

distance = 338
spam score = 31
title = 'fisher florists florists in fisher minnesota mn'

distance = 338
spam score = 31
title = 'new market florists florists in new market minnesota mn'

distance = 338
spam score = 25
title = 'montevideo florists florists in montevideo minnesota mn'

distance = 338
spam score = 31
title = 'henderson florists florists in henderson minnesota mn'

distance = 339
spam score = 33
title = 'rodney florists florists in rodney iowa ia'

distance = 339
spam score = 24
title = 'smithville florists florists in smithville georgia ga'

distance = 339
spam score = 35
title = 'brooten florists florists in brooten minnesota mn'

distance = 339
spam score = 33
title = 'dennison florists florists in dennison minnesota mn'

distance = 339
spam score = 35
title = 'humeston florists florists in humeston iowa ia'

distance = 339
spam score = 25
title = 'bowdon florists florists in bowdon georgia ga'

distance = 353
spam score = 25
title = 'statham florists florists in statham georgia ga'

distance = 354
spam score = 33
title = 'lidderdale florists florists in lidderdale iowa ia'

distance = 354
spam score = 24
title = 'bryant florists florists in bryant iowa ia'

distance = 354
spam score = 31
title = 'mc grath florists florists in mc grath minnesota mn'

distance = 354
spam score = 24
title = 'box springs florists florists in box springs georgia ga'

distance = 354
spam score = 24
title = 'carbon florists florists in carbon iowa ia'

distance = 354
spam score = 31
title = 'mound florists florists in mound minnesota mn'

distance = 354
spam score = 35
title = 'schleswig florists florists in schleswig iowa ia'

distance = 354
spam score = 36
title = 'stuart florists florists in stuart iowa ia'

distance = 354
spam score = 35
title = 'fertile florists florists in fertile iowa ia'

distance = 373
spam score = 24
title = 'high shoals florists florists in high shoals georgia ga'

distance = 373
spam score = 24
title = 'thor florists florists in thor iowa ia'

distance = 373
spam score = 23
title = 'plains florists florists in plains georgia ga'

distance = 374
spam score = 34
title = 'bluffton florists florists in bluffton minnesota mn'

distance = 374
spam score = 24
title = 'newington florists florists in newington georgia ga'

distance = 374
spam score = 23
title = 'jewell florists florists in jewell iowa ia'

distance = 374
spam score = 23
title = 'shelby florists florists in shelby iowa ia'

distance = 374
spam score = 24
title = 'oyens florists florists in oyens iowa ia'

distance = 374
spam score = 26
title = 'rockledge florists florists in rockledge georgia ga'

distance = 374
spam score = 23
title = 'dumont florists florists in dumont iowa ia'

distance = 400
spam score = 25
title = 'correctionville florists florists in correctionville iowa ia'

distance = 400
spam score = 35
title = 'ida grove florists florists in ida grove iowa ia'

distance = 400
spam score = 22
title = 'yarmouth florists florists in yarmouth iowa ia'

distance = 400
spam score = 24
title = 'saint marys florists florists in saint marys georgia ga'

distance = 400
spam score = 25
title = 'allerton florists florists in allerton iowa ia'

distance = 400
spam score = 24
title = 'fairfax florists florists in fairfax iowa ia'

distance = 402
spam score = 32
title = 'side lake florists florists in side lake minnesota mn'

distance = 402
spam score = 23
title = 'marshallville florists florists in marshallville georgia ga'

distance = 402
spam score = 30
title = 'oak vale florists florists in oak vale mississippi ms'

distance = 402
spam score = 35
title = 'earling florists florists in earling iowa ia'

distance = 1578
spam score = 48
title = 'flowers to hyderabad flowers to hyderabad india send flowers to hyderabad'

distance = 1588
spam score = 3
title = 'hello my name is dana fredo and'

distance = 1649
spam score = 48
title = 'violets garden centre pots garden furniture florist sydney gift florist special occasion day gifts sydney interflora australia'

distance = 1703
spam score = 62
title = ''

distance = 73
spam score = 49
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 79
spam score = 49
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 79
spam score = 46
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 85
spam score = 38
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 85
spam score = 42
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 95
spam score = 41
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 111
spam score = 45
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 115
spam score = 43
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 116
spam score = 49
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 118
spam score = 49
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 120
spam score = 53
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 120
spam score = 49
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 121
spam score = 49
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 123
spam score = 50
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 124
spam score = 40
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 125
spam score = 39
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 127
spam score = 31
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 129
spam score = 45
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 132
spam score = 46
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 132
spam score = 45
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 190
spam score = 43
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 190
spam score = 47
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 191
spam score = 42
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 193
spam score = 45
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 193
spam score = 44
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 193
spam score = 41
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 193
spam score = 38
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 193
spam score = 48
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 194
spam score = 42
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 194
spam score = 52
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 206
spam score = 37
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 206
spam score = 41
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 207
spam score = 42
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 207
spam score = 44
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 207
spam score = 47
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 208
spam score = 55
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 209
spam score = 33
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 210
spam score = 44
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 210
spam score = 49
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 210
spam score = 30
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 225
spam score = 51
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 225
spam score = 38
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 226
spam score = 47
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 226
spam score = 40
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 226
spam score = 43
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 227
spam score = 38
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 227
spam score = 28
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 227
spam score = 39
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 228
spam score = 40
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 228
spam score = 38
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 240
spam score = 40
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 241
spam score = 41
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 241
spam score = 42
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 241
spam score = 48
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 242
spam score = 36
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 242
spam score = 37
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 242
spam score = 50
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 242
spam score = 42
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 244
spam score = 37
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 244
spam score = 48
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 259
spam score = 39
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 260
spam score = 45
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 260
spam score = 34
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 260
spam score = 49
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 261
spam score = 38
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 263
spam score = 47
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 263
spam score = 39
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 264
spam score = 42
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 265
spam score = 39
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 265
spam score = 46
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 300
spam score = 37
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 301
spam score = 42
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 304
spam score = 48
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 305
spam score = 48
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 306
spam score = 40
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 307
spam score = 50
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 307
spam score = 47
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 310
spam score = 39
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 311
spam score = 40
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 311
spam score = 44
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 380
spam score = 46
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 385
spam score = 37
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 390
spam score = 39
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 391
spam score = 35
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 392
spam score = 49
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 405
spam score = 43
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 412
spam score = 42
title = 'clogcommits cvs opensourceconformalcom clog'

distance = 426
spam score = 46
title = 'clogcommits cvs opensourceconformalcom clog'

distance = 429
spam score = 51
title = 'xxxtermcommits cvs opensourceconformalcom xxxterm'

distance = 440
spam score = 45
title = 'adsuckcommits cvs opensourceconformalcom adsuck'

distance = 534
spam score = 47
title = 'slidemlcommits cvs opensourceconformalcom slideml'

distance = 536
spam score = 42
title = 'clogcommits cvs opensourceconformalcom clog'

distance = 542
spam score = 42
title = 'clogcommits cvs opensourceconformalcom clog'

distance = 545
spam score = 46
title = 'slidemlcommits cvs opensourceconformalcom slideml'

distance = 546
spam score = 35
title = 'clogcommits cvs opensourceconformalcom clog'

distance = 548
spam score = 48
title = 'slidemlcommits cvs opensourceconformalcom slideml'

distance = 554
spam score = 48
title = 'clogcommits cvs opensourceconformalcom clog'

distance = 557
spam score = 38
title = 'backtracecommits cvs opensourceconformalcom backtrace'

distance = 558
spam score = 42
title = 'clogcommits cvs opensourceconformalcom clog'

distance = 558
spam score = 43
title = 'clogcommits cvs opensourceconformalcom clog'

distance = 1247
spam score = 22
title = ''

distance = 1559
spam score = 35
title = ''

distance = 1684
spam score = 96
title = 'risk management for med'

distance = 235
spam score = 49
title = ''

distance = 235
spam score = 49
title = ''

distance = 235
spam score = 49
title = ''

distance = 300
spam score = 51
title = ''

distance = 300
spam score = 51
title = ''

distance = 300
spam score = 51
title = ''

distance = 312
spam score = 28
title = ''

distance = 312
spam score = 47
title = ''

distance = 312
spam score = 48
title = ''

distance = 317
spam score = 51
title = ''

distance = 337
spam score = 28
title = ''

distance = 357
spam score = 46
title = ''

distance = 357
spam score = 48
title = ''

distance = 357
spam score = 45
title = ''

distance = 383
spam score = 49
title = ''

distance = 734
spam score = 53
title = ''

distance = 96
spam score = 72
title = ''

distance = 492
spam score = 59
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 0
spam score = 89
title = ''

distance = 1220
spam score = 82
title = ''

distance = 1220
spam score = 82
title = ''

distance = 1220
spam score = 82
title = ''

distance = 1220
spam score = 82
title = ''

distance = 1
spam score = 20
title = 'companies allurlsonlinecom'

distance = 1
spam score = 20
title = 'companies allurlsonlinecom'

distance = 1
spam score = 19
title = 'companies allurlsonlinecom'

distance = 28
spam score = 18
title = 'parts allurlsonlinecom'

distance = 29
spam score = 17
title = 'books allurlsonlinecom'

distance = 29
spam score = 18
title = 'books allurlsonlinecom'

distance = 30
spam score = 17
title = 'recordings allurlsonlinecom'

distance = 30
spam score = 19
title = 'racing allurlsonlinecom'

distance = 31
spam score = 17
title = 'publishing allurlsonlinecom'

distance = 31
spam score = 24
title = 'organizations allurlsonlinecom'

distance = 31
spam score = 25
title = 'organizations allurlsonlinecom'

distance = 31
spam score = 24
title = 'organizations allurlsonlinecom'

distance = 32
spam score = 21
title = 'lighting allurlsonlinecom'

distance = 32
spam score = 19
title = 'lighting allurlsonlinecom'

distance = 34
spam score = 21
title = 'transportation allurlsonlinecom'

distance = 34
spam score = 11
title = 'transport allurlsonlinecom'

distance = 34
spam score = 23
title = 'education allurlsonlinecom'

distance = 35
spam score = 19
title = 'associations allurlsonlinecom'

distance = 37
spam score = 18
title = 'music allurlsonlinecom'

distance = 37
spam score = 15
title = 'music allurlsonlinecom'

distance = 81
spam score = 23
title = 'geocaching allurlsonlinecom'

distance = 81
spam score = 21
title = 'base jumping allurlsonlinecom'

distance = 82
spam score = 22
title = 'soapmaking allurlsonlinecom'

distance = 82
spam score = 25
title = 'society and culture allurlsonlinecom'

distance = 82
spam score = 22
title = 'writing instruments allurlsonlinecom'

distance = 82
spam score = 22
title = 'land sailing allurlsonlinecom'

distance = 82
spam score = 19
title = 'driving schools allurlsonlinecom'

distance = 82
spam score = 17
title = 'weight loss allurlsonlinecom'

distance = 82
spam score = 21
title = 'martial arts allurlsonlinecom'

distance = 82
spam score = 18
title = 'school reports allurlsonlinecom'

distance = 106
spam score = 23
title = 'chats and forums allurlsonlinecom'

distance = 106
spam score = 24
title = 'chats and forums allurlsonlinecom'

distance = 106
spam score = 19
title = 'castles allurlsonlinecom'

distance = 106
spam score = 19
title = 'management allurlsonlinecom'

distance = 106
spam score = 17
title = 'games allurlsonlinecom'

distance = 106
spam score = 17
title = 'models allurlsonlinecom'

distance = 106
spam score = 21
title = 'pyrotechnics allurlsonlinecom'

distance = 106
spam score = 20
title = 'career training and development allurlsonlinecom'

distance = 106
spam score = 16
title = 'halloween allurlsonlinecom'

distance = 106
spam score = 22
title = 'booksellers allurlsonlinecom'

distance = 125
spam score = 18
title = 'divorce allurlsonlinecom'

distance = 125
spam score = 18
title = 'rendering modeling and animation allurlsonlinecom'

distance = 125
spam score = 22
title = 'minimum impact practices allurlsonlinecom'

distance = 125
spam score = 14
title = 'travelogues allurlsonlinecom'

distance = 126
spam score = 21
title = 'commercial and summer camps allurlsonlinecom'

distance = 126
spam score = 17
title = 'homestays allurlsonlinecom'

distance = 126
spam score = 21
title = 'yeast infection allurlsonlinecom'

distance = 126
spam score = 19
title = 'booksellers allurlsonlinecom'

distance = 126
spam score = 19
title = 'treehouses allurlsonlinecom'

distance = 126
spam score = 15
title = 'software allurlsonlinecom'

distance = 157
spam score = 19
title = 'traveling with pets allurlsonlinecom'

distance = 157
spam score = 24
title = 'chats and forums allurlsonlinecom'

distance = 158
spam score = 17
title = 'fantasy sports allurlsonlinecom'

distance = 158
spam score = 20
title = 'pressed allurlsonlinecom'

distance = 158
spam score = 17
title = 'stereo equipment allurlsonlinecom'

distance = 159
spam score = 23
title = 'chats and forums allurlsonlinecom'

distance = 159
spam score = 19
title = 'wound care allurlsonlinecom'

distance = 159
spam score = 18
title = 'haunted lodging allurlsonlinecom'

distance = 159
spam score = 20
title = 'hearts allurlsonlinecom'

distance = 159
spam score = 21
title = 'performing groups allurlsonlinecom'

distance = 178
spam score = 19
title = 'corporate housing allurlsonlinecom'

distance = 178
spam score = 18
title = 'aldactone allurlsonlinecom'

distance = 179
spam score = 22
title = 'kyudo allurlsonlinecom'

distance = 179
spam score = 18
title = 'resorts allurlsonlinecom'

distance = 179
spam score = 16
title = 'pregnancy and birth allurlsonlinecom'

distance = 180
spam score = 22
title = 'organizations and unions allurlsonlinecom'

distance = 180
spam score = 17
title = 'film and video allurlsonlinecom'

distance = 180
spam score = 20
title = 'spades allurlsonlinecom'

distance = 180
spam score = 19
title = 'clenbuterol allurlsonlinecom'

distance = 180
spam score = 21
title = 'whist allurlsonlinecom'

distance = 214
spam score = 20
title = 'ouija boards allurlsonlinecom'

distance = 214
spam score = 20
title = 'blood bowl allurlsonlinecom'

distance = 215
spam score = 20
title = 'animation allurlsonlinecom'

distance = 215
spam score = 13
title = 'roller skating allurlsonlinecom'

distance = 216
spam score = 20
title = 'clothes and costumes allurlsonlinecom'

distance = 216
spam score = 16
title = 'insurance allurlsonlinecom'

distance = 217
spam score = 20
title = 'coins and currency allurlsonlinecom'

distance = 217
spam score = 17
title = 'independent allurlsonlinecom'

distance = 218
spam score = 20
title = 'land speed record allurlsonlinecom'

distance = 219
spam score = 18
title = 'liv 52 allurlsonlinecom'

distance = 267
spam score = 20
title = 'teen patti flush allurlsonlinecom'

distance = 267
spam score = 17
title = 'furniture allurlsonlinecom'

distance = 268
spam score = 21
title = 'indy racing league allurlsonlinecom'

distance = 269
spam score = 17
title = 'testosterone propionate allurlsonlinecom'

distance = 270
spam score = 19
title = 'contests allurlsonlinecom'

distance = 271
spam score = 17
title = 'doll houses allurlsonlinecom'

distance = 272
spam score = 17
title = 'parlodel bromocriptine allurlsonlinecom'

distance = 272
spam score = 17
title = 'databases allurlsonlinecom'

distance = 273
spam score = 17
title = 'previews allurlsonlinecom'

distance = 275
spam score = 4
title = 'downloads allurlsonlinecom'

distance = 380
spam score = 18
title = 'humor allurlsonlinecom'

distance = 381
spam score = 19
title = 'supplies and equipment starryindexcom'

distance = 383
spam score = 18
title = 'soccer starryindexcom'

distance = 383
spam score = 18
title = 'tchoukball starryindexcom'

distance = 384
spam score = 20
title = 'antiques and collectibles starryindexcom'

distance = 384
spam score = 18
title = 'boxball starryindexcom'

distance = 384
spam score = 16
title = 'software starryindexcom'

distance = 384
spam score = 17
title = 'magazines starryindexcom'

distance = 385
spam score = 18
title = 'computers starryindexcom'

distance = 386
spam score = 15
title = 'stamps starryindexcom'

distance = 1747
spam score = 62
title = 'generic guide to new world scarab beetlesscarabaeidaeaphodiinae'

distance = 1760
spam score = 63
title = 'registrerade kullar fre 1970'

distance = 1772
spam score = 51
title = ''

distance = 1775
spam score = 23
title = ''

distance = 1791
spam score = 87
title = 'the compact darkover'

distance = 1795
spam score = 24
title = ''

distance = 1810
spam score = 32
title = ''

distance = 1826
spam score = 20
title = 'how race 13 was scored'

distance = 96
spam score = 62
title = ''

distance = 108
spam score = 64
title = ''

distance = 115
spam score = 64
title = ''

distance = 116
spam score = 63
title = ''

distance = 117
spam score = 64
title = ''

distance = 119
spam score = 64
title = ''

distance = 125
spam score = 64
title = ''

distance = 125
spam score = 64
title = ''

distance = 132
spam score = 64
title = ''

distance = 135
spam score = 64
title = ''

distance = 160
spam score = 63
title = ''

distance = 165
spam score = 63
title = ''

distance = 167
spam score = 61
title = ''

distance = 172
spam score = 62
title = ''

distance = 180
spam score = 63
title = ''

distance = 195
spam score = 64
title = ''

distance = 213
spam score = 61
title = ''

distance = 218
spam score = 64
title = ''

distance = 227
spam score = 65
title = ''

distance = 229
spam score = 64
title = ''

distance = 231
spam score = 63
title = ''

distance = 239
spam score = 62
title = ''

distance = 245
spam score = 64
title = ''

distance = 250
spam score = 63
title = ''

distance = 251
spam score = 62
title = ''

distance = 270
spam score = 61
title = ''

distance = 275
spam score = 59
title = ''

distance = 277
spam score = 78
title = ''

distance = 280
spam score = 62
title = ''

distance = 292
spam score = 65
title = ''

distance = 329
spam score = 78
title = ''

distance = 350
spam score = 78
title = ''

distance = 354
spam score = 61
title = ''

distance = 359
spam score = 78
title = ''

distance = 378
spam score = 78
title = ''

distance = 384
spam score = 79
title = ''

distance = 384
spam score = 78
title = ''

distance = 386
spam score = 79
title = ''

distance = 391
spam score = 78
title = ''

distance = 396
spam score = 61
title = ''

distance = 397
spam score = 62
title = ''

distance = 397
spam score = 79
title = ''

distance = 399
spam score = 78
title = ''

distance = 400
spam score = 78
title = ''

distance = 402
spam score = 78
title = ''

distance = 405
spam score = 77
title = ''

distance = 407
spam score = 79
title = ''

distance = 423
spam score = 78
title = ''

distance = 424
spam score = 66
title = ''

distance = 433
spam score = 65
title = ''

distance = 436
spam score = 77
title = ''

distance = 436
spam score = 77
title = ''

distance = 461
spam score = 78
title = ''

distance = 520
spam score = 77
title = ''

distance = 551
spam score = 76
title = ''

distance = 558
spam score = 78
title = ''

distance = 562
spam score = 77
title = ''

distance = 638
spam score = 77
title = ''

distance = 649
spam score = 77
title = ''

distance = 657
spam score = 75
title = ''

distance = 658
spam score = 75
title = ''

distance = 693
spam score = 77
title = ''

distance = 701
spam score = 74
title = ''

distance = 861
spam score = 75
title = ''

distance = 0
spam score = 87
title = 'the boundary marks today photograph of post 147'

distance = 0
spam score = 87
title = 'the boundary marks today photograph of post 41'

distance = 0
spam score = 87
title = 'the boundary marks today photograph of post 40'

distance = 0
spam score = 86
title = 'the boundary marks today photograph of post 33'

distance = 0
spam score = 87
title = 'the boundary marks today photograph of post 120'

distance = 0
spam score = 86
title = 'the boundary marks today photograph of post 9'

distance = 0
spam score = 87
title = 'the boundary marks today photograph of post 143'

distance = 0
spam score = 86
title = 'the boundary marks today photograph of post 106'

distance = 0
spam score = 85
title = 'the boundary marks today photograph of post 125'

distance = 0
spam score = 86
title = 'the boundary marks today photograph of post 154'

distance = 0
spam score = 86
title = 'the boundary marks today photograph of post 162'

distance = 0
spam score = 87
title = 'the boundary marks today photograph of post 192'

distance = 0
spam score = 86
title = 'the boundary marks today photograph of post 203'

distance = 0
spam score = 87
title = 'the boundary marks today photograph of post 140'

distance = 0
spam score = 87
title = 'the boundary marks today photograph of post 85'

distance = 0
spam score = 87
title = 'the boundary marks today photograph of post 134'

distance = 0
spam score = 86
title = 'the boundary marks today photograph of post 62'

distance = 0
spam score = 85
title = 'the boundary marks today photograph of post 32'

distance = 0
spam score = 85
title = 'the boundary marks today photograph of post 108'

distance = 23
spam score = 86
title = 'the boundary marks today photograph of post 157'

distance = 32
spam score = 88
title = 'the boundary marks today photograph of post 84'

distance = 34
spam score = 87
title = 'the boundary marks today photograph of post 133'

distance = 34
spam score = 86
title = 'the boundary marks today photograph of post 199'

distance = 36
spam score = 86
title = 'the boundary marks today photograph of post 66'

distance = 38
spam score = 86
title = 'the boundary marks today photograph of post 93'

distance = 38
spam score = 87
title = 'the boundary marks today photograph of post 51'

distance = 47
spam score = 85
title = 'the boundary marks today photograph of post 12'

distance = 48
spam score = 87
title = 'the boundary marks today photograph of post 186'

distance = 52
spam score = 85
title = 'the boundary marks today photograph of post 28'

distance = 53
spam score = 86
title = 'the boundary marks today photograph of post 179'

distance = 64
spam score = 86
title = 'the boundary marks today photograph of post 128'

distance = 64
spam score = 86
title = 'the boundary marks today photograph of post 167'

distance = 65
spam score = 86
title = 'the boundary marks today photograph of post 152'

distance = 67
spam score = 87
title = 'the boundary marks today photograph of post 207'

distance = 68
spam score = 87
title = 'the boundary marks today photograph of post 164'

distance = 70
spam score = 87
title = 'the boundary marks today photograph of post 214'

distance = 70
spam score = 86
title = 'the boundary marks today photograph of post 109'

distance = 71
spam score = 84
title = 'the boundary marks today photograph of post 182'

distance = 72
spam score = 87
title = 'the boundary marks today photograph of post 209'

distance = 72
spam score = 86
title = 'the boundary marks today photograph of post 110'

distance = 80
spam score = 85
title = 'the boundary marks today photograph of post 19'

distance = 82
spam score = 86
title = 'the boundary marks today photograph of post 149'

distance = 94
spam score = 85
title = 'the boundary marks today photograph of post 91'

distance = 95
spam score = 87
title = 'the boundary marks today photograph of post 43'

distance = 95
spam score = 85
title = 'the boundary marks today photograph of post 196'

distance = 101
spam score = 86
title = 'the boundary marks today photograph of post 13'

distance = 102
spam score = 87
title = 'the boundary marks today photograph of post 189'

distance = 102
spam score = 86
title = 'the boundary marks today photograph of post 113'

distance = 107
spam score = 87
title = 'the boundary marks today photograph of post 204'

distance = 109
spam score = 84
title = 'the boundary marks today photograph of post 119'

distance = 113
spam score = 86
title = 'the boundary marks today photograph of post 132'

distance = 113
spam score = 84
title = 'the boundary marks today photograph of post 112'

distance = 118
spam score = 87
title = 'the boundary marks today photograph of post 135'

distance = 119
spam score = 84
title = 'the boundary marks today photograph of post 112a'

distance = 119
spam score = 86
title = 'the boundary marks today photograph of post 200'

distance = 120
spam score = 88
title = 'the boundary marks today photograph of post 53'

distance = 121
spam score = 87
title = 'the boundary marks today photograph of post 89'

distance = 121
spam score = 86
title = 'the boundary marks today photograph of post 181'

distance = 122
spam score = 85
title = 'the boundary marks today photograph of post 103'

distance = 122
spam score = 86
title = 'the boundary marks today photograph of post 192a'

distance = 125
spam score = 86
title = 'the boundary marks today photograph of post 184'

distance = 128
spam score = 86
title = 'the boundary marks today photograph of post 77'

distance = 129
spam score = 85
title = 'the boundary marks today photograph of post 172a'

distance = 130
spam score = 87
title = 'the boundary marks today photograph of post 49'

distance = 139
spam score = 86
title = 'the boundary marks today photograph of post 160'

distance = 142
spam score = 86
title = 'the boundary marks today photograph of post 11'

distance = 142
spam score = 85
title = 'the boundary marks today photograph of post 126'

distance = 143
spam score = 87
title = 'the boundary marks today photograph of post 96'

distance = 144
spam score = 87
title = 'the boundary marks today photographs of post 131'

distance = 144
spam score = 87
title = 'the boundary marks today photograph of post 185'

distance = 154
spam score = 88
title = 'the boundary marks today photograph of post 195'

distance = 158
spam score = 86
title = 'the boundary marks today photograph of post 104'

distance = 159
spam score = 86
title = 'the boundary marks today photograph of post 99'

distance = 161
spam score = 88
title = 'the boundary marks today photographs of post 193'

distance = 166
spam score = 87
title = 'the boundary marks today photograph of post 96b'

distance = 166
spam score = 86
title = 'the boundary marks today photograph of post 103a'

distance = 168
spam score = 87
title = 'the boundary marks today photograph of post 213'

distance = 173
spam score = 86
title = 'the boundary marks today photograph of post 100b'

distance = 177
spam score = 85
title = 'the boundary marks today photograph of post 98'

distance = 178
spam score = 86
title = 'the boundary marks today photograph of post 59'

distance = 193
spam score = 87
title = 'the boundary marks today photographs of post 4'

distance = 194
spam score = 85
title = 'the boundary marks today photograph of post 76'

distance = 194
spam score = 89
title = 'the boundary marks today photographs of post 81'

distance = 205
spam score = 86
title = 'the boundary marks today photograph of post 100a'

distance = 219
spam score = 85
title = 'the boundary marks today photograph of post 101'

distance = 225
spam score = 86
title = 'the boundary marks today photograph of post 100'

distance = 247
spam score = 87
title = 'the boundary marks today photographs of post 176'

distance = 272
spam score = 86
title = 'the boundary marks today photograph of post 82a'

distance = 291
spam score = 84
title = 'the boundary marks today photographs of post 36'

distance = 296
spam score = 85
title = 'the boundary marks today photographs of post 46'

distance = 349
spam score = 87
title = 'the boundary marks today photograph of obelisk 215'

distance = 353
spam score = 87
title = 'the boundary marks today photograph of obelisk 165'

distance = 364
spam score = 84
title = 'the boundary marks today photographs of post 30'

distance = 368
spam score = 85
title = 'the boundary marks today photograph of post 166c'

distance = 381
spam score = 87
title = 'the boundary marks today photographs of obelisk 50'

distance = 410
spam score = 87
title = 'the boundary marks today photographs of post 144a'

distance = 414
spam score = 86
title = 'the boundary marks today photograph of obelisk 75a'

distance = 429
spam score = 87
title = 'the boundary marks today photograph of obelisk 71'

distance = 453
spam score = 87
title = 'the boundary marks today photographs of obelisk 173'

distance = 485
spam score = 87
title = 'the boundary marks today photograph of obelisk at gravesend'

distance = 1053
spam score = 83
title = 'the boundary marks today post 200'

distance = 1065
spam score = 83
title = 'the boundary marks today post 148'

distance = 1074
spam score = 83
title = 'the boundary marks today post 134'

distance = 1075
spam score = 84
title = 'the boundary marks today post 158'

distance = 1081
spam score = 85
title = 'the boundary marks today post 136'

distance = 1122
spam score = 83
title = 'the boundary marks today post 146'

distance = 1192
spam score = 86
title = 'the boundary marks today plate 73'

distance = 1658
spam score = 65
title = 'rumaitha adias guide'

distance = 1846
spam score = 8
title = 'relapes rekordbox license key serial crack rekordbox 141 license key free megaupload hotfile'

distance = 62
spam score = 15
title = 'u571 war movie posters'

distance = 81
spam score = 12
title = 'wall street movie posters'

distance = 122
spam score = 14
title = 'the haunting horror movie posters'

distance = 128
spam score = 16
title = 'the birds horror movie posters'

distance = 129
spam score = 10
title = 'the honeymooners movie posters'

distance = 135
spam score = 15
title = 'four feathers war movie posters'

distance = 135
spam score = 13
title = 'get over it musical movie posters'

distance = 136
spam score = 15
title = 'the waterboy movie posters'

distance = 137
spam score = 10
title = 'psycho horror movie posters'

distance = 146
spam score = 16
title = 'backdraft mystery amp detective posters'

distance = 147
spam score = 17
title = 'bent war movie posters'

distance = 149
spam score = 14
title = 'messenger war movie posters'

distance = 149
spam score = 12
title = 'gladiator movie posters'

distance = 150
spam score = 16
title = '8mm mystery amp detective posters'

distance = 151
spam score = 12
title = 'stagecoach western movie posters'

distance = 152
spam score = 13
title = 'outsiders movie posters'

distance = 154
spam score = 14
title = 'platoon war movie posters'

distance = 154
spam score = 13
title = 'out of africa movie posters'

distance = 157
spam score = 15
title = 'insomnia mystery amp detective posters'

distance = 157
spam score = 12
title = 'troy movie posters'

distance = 214
spam score = 16
title = 'international squadron war movie posters'

distance = 214
spam score = 16
title = 'the big chill movie posters'

distance = 215
spam score = 14
title = 'dumb and dumber movie posters'

distance = 215
spam score = 15
title = 'empire of the sun war movie posters'

distance = 215
spam score = 11
title = 'something about mary movie posters'

distance = 215
spam score = 15
title = 'fame musical movie posters'

distance = 216
spam score = 12
title = 'seven brides for seven brothers movie posters'

distance = 216
spam score = 13
title = 'harmonists musical movie posters'

distance = 217
spam score = 15
title = 'midnight clear war movie posters'

distance = 217
spam score = 14
title = 'apocalypse now war movie posters'

distance = 228
spam score = 14
title = 'charlotte gray war movie posters'

distance = 228
spam score = 16
title = 'yugioh posters'

distance = 229
spam score = 17
title = 'courage under fire movie posters'

distance = 229
spam score = 12
title = 'raging bull movie posters'

distance = 229
spam score = 12
title = 'schindlers list movie posters'

distance = 230
spam score = 13
title = 'elmo family movie posters'

distance = 230
spam score = 15
title = 'little women movie posters'

distance = 231
spam score = 15
title = 'guns of navarone war movie posters'

distance = 231
spam score = 16
title = 'four horsemen of the apocalypse war movie posters'

distance = 231
spam score = 14
title = 'muppets family movie posters'

distance = 273
spam score = 14
title = 'king of the underworld movie posters'

distance = 276
spam score = 14
title = 'born on the 4th of july war movie posters'

distance = 276
spam score = 11
title = 'when harry met sally movie posters'

distance = 276
spam score = 13
title = 'top hat musical movie posters'

distance = 276
spam score = 15
title = 'dead end movie posters'

distance = 278
spam score = 15
title = 'royal engagement family movie posters'

distance = 278
spam score = 15
title = 'kiss of death movie posters'

distance = 279
spam score = 14
title = 'creature from the black lagoon horror movie posters'

distance = 280
spam score = 12
title = 'pink floyd the wall musical movie posters'

distance = 280
spam score = 12
title = 'deep blue sea horror movie posters'

distance = 297
spam score = 11
title = 'wild wild west western movie posters'

distance = 297
spam score = 14
title = 'soccer dog the movie family movie posters'

distance = 297
spam score = 13
title = 'seeing double musical movie posters'

distance = 297
spam score = 14
title = 'mouse hunt family movie posters'

distance = 297
spam score = 14
title = 'spy kids family movie posters'

distance = 300
spam score = 15
title = 'stuart little family movie posters'

distance = 300
spam score = 15
title = 'billy elliot family movie posters'

distance = 300
spam score = 13
title = 'modern minstrels musical movie posters'

distance = 300
spam score = 17
title = 'count of monte cristo movie posters'

distance = 303
spam score = 17
title = 'ella enchanted family movie posters'

distance = 346
spam score = 13
title = 'beach movie posters'

distance = 347
spam score = 13
title = 'my big fat greek wedding movie posters'

distance = 351
spam score = 8
title = 'freedomland horror movie posters'

distance = 352
spam score = 15
title = 'bullitt movie posters'

distance = 352
spam score = 14
title = 'fly away home family movie posters'

distance = 355
spam score = 14
title = 'free willy 3 the rescue family movie posters'

distance = 355
spam score = 15
title = 'braveheart movie posters'

distance = 356
spam score = 12
title = 'hard days night musical movie posters'

distance = 356
spam score = 13
title = 'dr jekyll amp mr hyde horror movie posters'

distance = 357
spam score = 13
title = 'scarface movie posters'

distance = 397
spam score = 14
title = 'behind enemy lines war movie posters'

distance = 398
spam score = 14
title = 'crocodile dundee movie posters'

distance = 399
spam score = 14
title = 'master amp commander war movie posters'

distance = 399
spam score = 15
title = 'hollywoodnbsp homicide mystery amp detective posters'

distance = 401
spam score = 13
title = 'good morning vietnam war movie posters'

distance = 403
spam score = 18
title = 'aristocats posters'

distance = 409
spam score = 16
title = 'forrest gump movie posters'

distance = 409
spam score = 15
title = 'true crime movie posters'

distance = 411
spam score = 14
title = 'breakfast at tiffanys movie posters'

distance = 412
spam score = 16
title = 'benhur movie posters'

distance = 465
spam score = 27
title = 'tarzan movie collectibles amp movie merchandise'

distance = 465
spam score = 13
title = 'king creole musical movie posters'

distance = 475
spam score = 14
title = 'daddy day care movie posters'

distance = 475
spam score = 22
title = 'peter pan posters'

distance = 479
spam score = 13
title = 'enter the dragon movie posters'

distance = 481
spam score = 14
title = 'fly movie posters'

distance = 483
spam score = 17
title = 'peter pan movie posters'

distance = 484
spam score = 16
title = 'the blob movie posters'

distance = 484
spam score = 10
title = 'get shorty movie posters'

distance = 490
spam score = 13
title = 'mr smith goes to washington movie posters'

distance = 603
spam score = 13
title = 'the wicker man movie posters'

distance = 608
spam score = 13
title = 'easter parade musical movie posters'

distance = 613
spam score = 12
title = 'anchors aweigh musical movie posters'

distance = 618
spam score = 16
title = 'truman show movie posters'

distance = 622
spam score = 14
title = 'mary poppins musical movie posters'

distance = 626
spam score = 14
title = 'biker boyz posters'

distance = 627
spam score = 16
title = 'red planet movie posters'

distance = 627
spam score = 18
title = 'total recall movie posters'

distance = 628
spam score = 17
title = 'vanilla sky movie posters'

distance = 629
spam score = 17
title = 'field of dreams movie posters'

distance = 921
spam score = 9
title = 'underworld horror movie posters'

distance = 1026
spam score = 15
title = 'the prestige movie posters'

distance = 1138
spam score = 27
title = 'nightmare on elm street movie collectibles amp movie merchandise'

distance = 189
spam score = 37
title = 'elwhase1939'

distance = 190
spam score = 37
title = 'elwhanw1939'

distance = 191
spam score = 37
title = 'elwhasw1939'

distance = 197
spam score = 37
title = 'elwhane1939'

distance = 207
spam score = 32
title = 'centerse1939'

distance = 208
spam score = 38
title = 'ferndalene1955'

distance = 208
spam score = 39
title = 'ferndalene196667'

distance = 209
spam score = 39
title = 'ferndalese1955'

distance = 209
spam score = 33
title = 'centersw1939'

distance = 210
spam score = 39
title = 'ferndalesw196667'

distance = 210
spam score = 38
title = 'ferndalesw1955'

distance = 211
spam score = 39
title = 'sumasse196667'

distance = 211
spam score = 39
title = 'sumasse1955'

distance = 212
spam score = 39
title = 'ferndalenw1955'

distance = 212
spam score = 39
title = 'ferndalenw196667'

distance = 213
spam score = 40
title = 'sumasnw1955'

distance = 213
spam score = 39
title = 'sumasnw196667'

distance = 213
spam score = 39
title = 'sumassw1955'

distance = 213
spam score = 39
title = 'sumassw196667'

distance = 214
spam score = 39
title = 'lawrencese1955'

distance = 242
spam score = 39
title = 'acmenw196667'

distance = 242
spam score = 37
title = 'acmese1938'

distance = 243
spam score = 39
title = 'acmene196667'

distance = 243
spam score = 31
title = 'hoodsportsw1939'

distance = 244
spam score = 39
title = 'acmese196667'

distance = 244
spam score = 37
title = 'ferndalene1938'

distance = 247
spam score = 37
title = 'acmesw1938'

distance = 255
spam score = 37
title = 'bothellsw1936'

distance = 255
spam score = 37
title = 'ferndalese1933'

distance = 255
spam score = 39
title = 'glaciersw1955'

distance = 259
spam score = 39
title = 'ferndalenw1950'

distance = 259
spam score = 38
title = 'glacierse1955'

distance = 260
spam score = 36
title = 'ferndalenw1933'

distance = 261
spam score = 39
title = 'canyonlakenw1955'

distance = 261
spam score = 39
title = 'canyonlakenw196667'

distance = 261
spam score = 34
title = 'seabecknw1939'

distance = 262
spam score = 40
title = 'glaciersw196667'

distance = 262
spam score = 36
title = 'sumassw1933'

distance = 263
spam score = 40
title = 'lawrencene1950'

distance = 263
spam score = 41
title = 'lawrencenw1950'

distance = 268
spam score = 38
title = 'maplefallsse196667'

distance = 270
spam score = 37
title = 'ferndalenw1938'

distance = 270
spam score = 36
title = 'ferndalesw1938'

distance = 270
spam score = 31
title = 'hollynw1939'

distance = 271
spam score = 33
title = 'eldonse1939'

distance = 271
spam score = 37
title = 'lawrencenw1938'

distance = 272
spam score = 40
title = 'lyndenne1950'

distance = 272
spam score = 39
title = 'lyndensw1950'

distance = 273
spam score = 37
title = 'bertrandcreekse1955'

distance = 273
spam score = 39
title = 'bertrandcreekse196667'

distance = 282
spam score = 39
title = 'bertrandcreeksw196667'

distance = 282
spam score = 38
title = 'bertrandcreeksw1955'

distance = 284
spam score = 37
title = 'puyallupsw1940'

distance = 284
spam score = 37
title = 'puyallupse1940'

distance = 284
spam score = 36
title = 'lyndenne1938'

distance = 285
spam score = 34
title = 'angelespointse1939'

distance = 287
spam score = 35
title = 'angelespointsw1939'

distance = 287
spam score = 36
title = 'lyndensw1938'

distance = 292
spam score = 34
title = 'quilcenese1939'

distance = 292
spam score = 35
title = 'quilcenesw1939'

distance = 304
spam score = 34
title = 'uncasse1939'

distance = 304
spam score = 37
title = 'auburnse1940'

distance = 304
spam score = 38
title = 'ortingse1940'

distance = 305
spam score = 38
title = 'sumassw1938'

distance = 305
spam score = 32
title = 'brinnonnw1939'

distance = 306
spam score = 36
title = 'acmenw1933'

distance = 306
spam score = 39
title = 'lummibayne1955'

distance = 309
spam score = 35
title = 'lyndenne1933'

distance = 309
spam score = 32
title = 'belfairsw1939'

distance = 310
spam score = 35
title = 'lyndensw1933'

distance = 312
spam score = 38
title = 'buckleysw1940'

distance = 312
spam score = 36
title = 'glacierse1938'

distance = 313
spam score = 31
title = 'belfairnw1939'

distance = 314
spam score = 36
title = 'marysvillenw1938'

distance = 315
spam score = 36
title = 'maplefallsse1933'

distance = 315
spam score = 29
title = 'hoodsportnw1939'

distance = 316
spam score = 28
title = 'hoodsportse1939'

distance = 316
spam score = 36
title = 'demingnw1933'

distance = 317
spam score = 36
title = 'marysvillesw1938'

distance = 318
spam score = 35
title = 'marysvillese1938'

distance = 338
spam score = 35
title = 'vancecreekse1938'

distance = 348
spam score = 38
title = 'povertybaysw1940'

distance = 351
spam score = 40
title = 'lummibayne1950'

distance = 352
spam score = 37
title = 'povertybayse1940'

distance = 354
spam score = 38
title = 'bertrandcreekse1950'

distance = 356
spam score = 35
title = 'lummibayse1933'

distance = 357
spam score = 38
title = 'sumnersw1940'

distance = 357
spam score = 40
title = 'lummibayse1950'

distance = 358
spam score = 38
title = 'duwamishheadne1940'

distance = 359
spam score = 37
title = 'sumnerse1940'

distance = 380
spam score = 36
title = 'auburnse1936'

distance = 380
spam score = 37
title = 'buckleyse1936'

distance = 382
spam score = 37
title = 'auburnsw1936'

distance = 396
spam score = 37
title = 'seattlesouthse1940'

distance = 406
spam score = 38
title = 'rentonnw1936'

distance = 406
spam score = 37
title = 'seattlesouthsw1940'

distance = 408
spam score = 36
title = 'blackdiamondse1940'

distance = 408
spam score = 36
title = 'blackdiamondsw1940'

distance = 411
spam score = 35
title = 'bothellse1938'

distance = 411
spam score = 38
title = 'rentonne1936'

distance = 1919
spam score = 38
title = ''

distance = 1919
spam score = 35
title = ''

distance = 143
spam score = 25
title = 'steve howe genealogy family tree famous roots'

distance = 175
spam score = 23
title = 'jan hammer genealogy family tree famous roots'

distance = 175
spam score = 25
title = 'mark white genealogy family tree famous roots'

distance = 179
spam score = 23
title = 'ian hill genealogy family tree famous roots'

distance = 180
spam score = 18
title = 'jan hooks genealogy family tree famous roots'

distance = 181
spam score = 24
title = 'joseph wambaugh genealogy family tree famous roots'

distance = 183
spam score = 18
title = 'james connolly genealogy family tree famous roots'

distance = 183
spam score = 18
title = 'le corbusier genealogy family tree famous roots'

distance = 184
spam score = 24
title = 'edwin newman genealogy family tree famous roots'

distance = 185
spam score = 23
title = 'james hunt genealogy family tree famous roots'

distance = 187
spam score = 23
title = 'david wechsler genealogy family tree famous roots'

distance = 189
spam score = 24
title = 'john hampson genealogy family tree famous roots'

distance = 189
spam score = 23
title = 'david yost genealogy family tree famous roots'

distance = 191
spam score = 16
title = 'matthew a henson genealogy family tree famous roots'

distance = 191
spam score = 17
title = 'grant hill genealogy family tree famous roots'

distance = 191
spam score = 23
title = 'steve harwell genealogy family tree famous roots'

distance = 192
spam score = 23
title = 'grant young genealogy family tree famous roots'

distance = 192
spam score = 25
title = 'john waite genealogy family tree famous roots'

distance = 192
spam score = 24
title = 'joshua humphreys genealogy family tree famous roots'

distance = 195
spam score = 18
title = 'john coltrane genealogy family tree famous roots'

distance = 210
spam score = 17
title = 'john hiatt genealogy family tree famous roots'

distance = 210
spam score = 23
title = 'mickey hart genealogy family tree famous roots'

distance = 210
spam score = 18
title = 'macaulay culkin genealogy family tree famous roots'

distance = 211
spam score = 23
title = 'mary carpenter genealogy family tree famous roots'

distance = 211
spam score = 23
title = 'elwood haynes genealogy family tree famous roots'

distance = 211
spam score = 24
title = 'burt young genealogy family tree famous roots'

distance = 211
spam score = 17
title = 'adam horovitz genealogy family tree famous roots'

distance = 212
spam score = 23
title = 'cindy williams genealogy family tree famous roots'

distance = 212
spam score = 17
title = 'oliver cromwell genealogy family tree famous roots'

distance = 212
spam score = 24
title = 'kevin cadogan genealogy family tree famous roots'

distance = 217
spam score = 18
title = 'paula cole genealogy family tree famous roots'

distance = 217
spam score = 17
title = 'jesse helms genealogy family tree famous roots'

distance = 217
spam score = 17
title = 'dave hill genealogy family tree famous roots'

distance = 217
spam score = 16
title = 'michael hausman genealogy family tree famous roots'

distance = 218
spam score = 17
title = 'clint howard genealogy family tree famous roots'

distance = 218
spam score = 16
title = 'merle haggard genealogy family tree famous roots'

distance = 219
spam score = 15
title = 'alberta hunter genealogy family tree famous roots'

distance = 220
spam score = 17
title = 'john huston genealogy family tree famous roots'

distance = 220
spam score = 25
title = 'garth hudson genealogy family tree famous roots'

distance = 220
spam score = 16
title = 'russell hitchcock genealogy family tree famous roots'

distance = 229
spam score = 24
title = 'larry waddell genealogy family tree famous roots'

distance = 229
spam score = 23
title = 'nelle harpe genealogy family tree famous roots'

distance = 229
spam score = 17
title = 'lauryn hill genealogy family tree famous roots'

distance = 230
spam score = 23
title = 'miles zuniga genealogy family tree famous roots'

distance = 230
spam score = 24
title = 'peter cetera genealogy family tree famous roots'

distance = 231
spam score = 24
title = 'max weinberg genealogy family tree famous roots'

distance = 231
spam score = 19
title = 'merce cunningham genealogy family tree famous roots'

distance = 232
spam score = 24
title = 'david hidalgo genealogy family tree famous roots'

distance = 233
spam score = 25
title = 'carlos chavez genealogy family tree famous roots'

distance = 234
spam score = 25
title = 'candace cameron genealogy family tree famous roots'

distance = 242
spam score = 23
title = 'julius ullma genealogy family tree famous roots'

distance = 242
spam score = 25
title = 'butch cassidy genealogy family tree famous roots'

distance = 243
spam score = 17
title = 'timothy hutton genealogy family tree famous roots'

distance = 244
spam score = 24
title = 'vaclav havel genealogy family tree famous roots'

distance = 244
spam score = 16
title = 'glen cornick genealogy family tree famous roots'

distance = 244
spam score = 25
title = 'herb caen genealogy family tree famous roots'

distance = 245
spam score = 24
title = 'edmund cartwright genealogy family tree famous roots'

distance = 246
spam score = 25
title = 'jane wiedlin genealogy family tree famous roots'

distance = 246
spam score = 23
title = 'brad wilk genealogy family tree famous roots'

distance = 246
spam score = 24
title = 'oleg cassini genealogy family tree famous roots'

distance = 265
spam score = 25
title = 'tom clancy genealogy family tree famous roots'

distance = 267
spam score = 14
title = 'steve gustafson genealogy family tree famous roots'

distance = 267
spam score = 24
title = 'vladimir nabokov genealogy family tree famous roots'

distance = 268
spam score = 18
title = 'lennie baker genealogy family tree famous roots'

distance = 271
spam score = 24
title = 'walter winchell genealogy family tree famous roots'

distance = 274
spam score = 18
title = 'john anthony curry genealogy family tree famous roots'

distance = 274
spam score = 17
title = 'christiaan huygens genealogy family tree famous roots'

distance = 276
spam score = 17
title = 'roger corman genealogy family tree famous roots'

distance = 276
spam score = 24
title = 'cesar zuiderwijk genealogy family tree famous roots'

distance = 276
spam score = 27
title = 'anne jemima clough genealogy family tree famous roots'

distance = 304
spam score = 17
title = 'william torrey harris genealogy family tree famous roots'

distance = 304
spam score = 17
title = 'emmylou harris genealogy family tree famous roots'

distance = 305
spam score = 23
title = 'glen pop warner genealogy family tree famous roots'

distance = 306
spam score = 17
title = 'gertrud margarete zell genealogy family tree famous roots'

distance = 307
spam score = 17
title = 'melissa joan hart genealogy family tree famous roots'

distance = 309
spam score = 23
title = 'jules hardouinmansart genealogy family tree famous roots'

distance = 312
spam score = 18
title = 'william wilkie collins genealogy family tree famous roots'

distance = 314
spam score = 23
title = 'flaminia anna caterina genealogy family tree famous roots'

distance = 318
spam score = 28
title = 'wallace hume carolthers genealogy family tree famous roots'

distance = 320
spam score = 17
title = 'edwin powell hubble genealogy family tree famous roots'

distance = 394
spam score = 17
title = 'harry connick jr genealogy family tree famous roots'

distance = 409
spam score = 21
title = 'harry nillsson genealogy family tree famous roots'

distance = 452
spam score = 23
title = 'phillips holmes genealogy family tree famous roots'

distance = 460
spam score = 24
title = 'conrad nagel genealogy family tree famous roots'

distance = 465
spam score = 23
title = 'laura nyro genealogy family tree famous roots'

distance = 467
spam score = 22
title = 'fredi washington genealogy family tree famous roots'

distance = 479
spam score = 17
title = 'gary evan crosby genealogy family tree famous roots'

distance = 485
spam score = 24
title = 'earle hodgins genealogy family tree famous roots'

distance = 492
spam score = 24
title = 'helen wallenda genealogy family tree famous roots'

distance = 496
spam score = 17
title = 'marguerute henry genealogy family tree famous roots'

distance = 630
spam score = 20
title = 'donald james yarmy genealogy family tree famous roots'

distance = 633
spam score = 25
title = 'cliff arquette genealogy family tree famous roots'

distance = 638
spam score = 23
title = 'earl kenneth hines genealogy family tree famous roots'

distance = 645
spam score = 22
title = 'penelope cruz sanchez genealogy family tree famous roots'

distance = 654
spam score = 25
title = 'walter percy chrysler genealogy family tree famous roots'

distance = 659
spam score = 23
title = 'kurt weill genealogy family tree famous roots'

distance = 688
spam score = 22
title = 'leonidas frank chaney genealogy family tree famous roots'

distance = 704
spam score = 21
title = 'kevin peter hall genealogy family tree famous roots'

distance = 708
spam score = 22
title = 'hoku christian ho genealogy family tree famous roots'

distance = 726
spam score = 22
title = 'peter alexander ustinov genealogy family tree famous roots'

distance = 924
spam score = 17
title = 'donald tai loy ho genealogy family tree famous roots'

distance = 1564
spam score = 35
title = 'prieske'

distance = 1836
spam score = 4
title = 'wordnet entry index a page 97'

distance = 89
spam score = 4
title = 'penguins penguins familyfriendly information about the penguins'

distance = 89
spam score = 4
title = 'penguins penguins familyfriendly information about the penguins'

distance = 89
spam score = 4
title = 'penguins brrrrrr familyfriendly information about the penguins'

distance = 93
spam score = 5
title = 'alsatian alsatian familyfriendly information about the alsatian'

distance = 93
spam score = 5
title = 'westie westie familyfriendly information about the westie'

distance = 95
spam score = 4
title = 'swans swans familyfriendly information about the swans'

distance = 100
spam score = 5
title = 'sparrows sparrow familyfriendly information about the sparrows'

distance = 101
spam score = 4
title = 'eagles eagle familyfriendly information about the eagles'

distance = 101
spam score = 4
title = 'sheep my sheep familyfriendly information about the sheep'

distance = 101
spam score = 4
title = 'sheep sheep familyfriendly information about the sheep'

distance = 101
spam score = 4
title = 'eagles eagles familyfriendly information about the eagles'

distance = 101
spam score = 5
title = 'sheep evening sheep familyfriendly information about the sheep'

distance = 101
spam score = 4
title = 'sheep sheep familyfriendly information about the sheep'

distance = 101
spam score = 4
title = 'sheep sheep familyfriendly information about the sheep'

distance = 101
spam score = 4
title = 'sheep sheep familyfriendly information about the sheep'

distance = 101
spam score = 4
title = 'sheep sheep familyfriendly information about the sheep'

distance = 101
spam score = 4
title = 'sheep sheep familyfriendly information about the sheep'

distance = 101
spam score = 4
title = 'rottweiler rottweiler familyfriendly information about the rottweiler'

distance = 101
spam score = 4
title = 'whippet whippets 1981 familyfriendly information about the whippet'

distance = 101
spam score = 4
title = 'whippet whippets 1981 familyfriendly information about the whippet'

distance = 247
spam score = 4
title = 'polar bear polar bear familyfriendly information about the polar bear'

distance = 247
spam score = 3
title = 'polar bear polar bears familyfriendly information about the polar bear'

distance = 247
spam score = 4
title = 'polar bear polar bears familyfriendly information about the polar bear'

distance = 249
spam score = 5
title = 'sheep the pet lamb familyfriendly information about the sheep'

distance = 249
spam score = 4
title = 'panda the beauty familyfriendly information about the panda'

distance = 249
spam score = 4
title = 'pigs and friends familyfriendly information about the pigs'

distance = 249
spam score = 5
title = 'sheep the pet lamb familyfriendly information about the sheep'

distance = 252
spam score = 5
title = 'saint bernard off to school 1883 familyfriendly information about the saint bernard'

distance = 253
spam score = 3
title = 'panda pandas dance familyfriendly information about the panda'

distance = 253
spam score = 4
title = 'owls misty morning familyfriendly information about the owls'

distance = 274
spam score = 4
title = 'cows and bulls cow familyfriendly information about the cows and bulls'

distance = 275
spam score = 4
title = 'sheep yellow farmhouse familyfriendly information about the sheep'

distance = 275
spam score = 4
title = 'sheep on devons moor familyfriendly information about the sheep'

distance = 275
spam score = 5
title = 'golden retriever puppies golden retrievers familyfriendly information about the golden retriever'

distance = 275
spam score = 4
title = 'pigs bathing pig familyfriendly information about the pigs'

distance = 275
spam score = 4
title = 'golden retriever golden retriever puppies familyfriendly information about the golden retriever'

distance = 275
spam score = 4
title = 'golden retriever golden retrievers on tractor familyfriendly information about the golden retriever'

distance = 276
spam score = 4
title = 'beagle outward bound familyfriendly information about the beagle'

distance = 276
spam score = 4
title = 'pigs kohlers pig familyfriendly information about the pigs'

distance = 276
spam score = 5
title = 'iguanodon izzy the iguanodon familyfriendly information about the iguanodon'

distance = 289
spam score = 5
title = 'dalmatian spot of lunch familyfriendly information about the dalmatian'

distance = 289
spam score = 4
title = 'sheep colour graze familyfriendly information about the sheep'

distance = 289
spam score = 3
title = 'hummingbirds diphogena aurora hummingbirds familyfriendly information about the hummingbirds'

distance = 289
spam score = 3
title = 'hummingbirds coeligena typica hummingbirds familyfriendly information about the hummingbirds'

distance = 289
spam score = 4
title = 'cows and bulls milk familyfriendly information about the cows and bulls'

distance = 290
spam score = 3
title = 'hummingbirds delattria clemenciae hummingbirds familyfriendly information about the hummingbirds'

distance = 290
spam score = 4
title = 'scottish terrier scotch terriers familyfriendly information about the scottish terrier'

distance = 290
spam score = 4
title = 'airedale terrier norman familyfriendly information about the airedale terrier'

distance = 290
spam score = 4
title = 'sheep winter sheep ii familyfriendly information about the sheep'

distance = 290
spam score = 5
title = 'cairn terrier andrew familyfriendly information about the cairn terrier'

distance = 339
spam score = 4
title = 'polar bear polar love familyfriendly information about the polar bear'

distance = 340
spam score = 4
title = 'chickens feathers in bloom familyfriendly information about the chickens'

distance = 340
spam score = 4
title = 'basset hound best friends familyfriendly information about the basset hound'

distance = 340
spam score = 4
title = 'polar bear polar bear playtime familyfriendly information about the polar bear'

distance = 340
spam score = 4
title = 'pigs i swing in the shower familyfriendly information about the pigs'

distance = 340
spam score = 5
title = 'mixed breed dog fitz familyfriendly information about the mixed breed dog'

distance = 340
spam score = 4
title = 'pigs gordons sausages familyfriendly information about the pigs'

distance = 340
spam score = 4
title = 'mixed breed dog winston familyfriendly information about the mixed breed dog'

distance = 340
spam score = 4
title = 'polar bear ice bears familyfriendly information about the polar bear'

distance = 340
spam score = 4
title = 'mixed breed dog dudley the dog familyfriendly information about the mixed breed dog'

distance = 357
spam score = 4
title = 'golden retriever loyal companion familyfriendly information about the golden retriever'

distance = 358
spam score = 4
title = 'beagle just a cowboy buckaroo familyfriendly information about the beagle'

distance = 358
spam score = 4
title = 'beagle just a cowboy buckaroo familyfriendly information about the beagle'

distance = 358
spam score = 4
title = 'goats wallachian ram familyfriendly information about the goats'

distance = 358
spam score = 4
title = 'persian cat silver persian familyfriendly information about the persian cat'

distance = 358
spam score = 4
title = 'sparrows birds in bamboo tree familyfriendly information about the sparrows'

distance = 359
spam score = 3
title = 'cows and bulls moo familyfriendly information about the cows and bulls'

distance = 359
spam score = 4
title = 'persian cat two white cats familyfriendly information about the persian cat'

distance = 359
spam score = 4
title = 'cocker spaniel best friends familyfriendly information about the cocker spaniel'

distance = 359
spam score = 4
title = 'cows and bulls delta cows familyfriendly information about the cows and bulls'

distance = 388
spam score = 4
title = 'grizzly bear in the alaska range familyfriendly information about the grizzly bear'

distance = 389
spam score = 5
title = 'border collie the home team familyfriendly information about the border collie'

distance = 389
spam score = 4
title = 'polar bear manitoba morning familyfriendly information about the polar bear'

distance = 390
spam score = 4
title = 'mixed breed dog asleep with a friend familyfriendly information about the mixed breed dog'

distance = 391
spam score = 4
title = 'cows and bulls close friend familyfriendly information about the cows and bulls'

distance = 392
spam score = 5
title = 'greyhound vis a vis metallic ink familyfriendly information about the greyhound'

distance = 393
spam score = 3
title = 'cows and bulls mad animals familyfriendly information about the cows and bulls'

distance = 396
spam score = 4
title = 'mixed breed dog bow meow familyfriendly information about the mixed breed dog'

distance = 400
spam score = 4
title = 'golden retriever boys best friend familyfriendly information about the golden retriever'

distance = 401
spam score = 4
title = 'polar bear bear cub hug familyfriendly information about the polar bear'

distance = 431
spam score = 5
title = 'brown bear high adventure detail familyfriendly information about the brown bear'

distance = 431
spam score = 4
title = 'cows and bulls the return of the herd familyfriendly information about the cows and bulls'

distance = 432
spam score = 4
title = 'donkey and mule southern rider familyfriendly information about the donkey and mule'

distance = 432
spam score = 5
title = 'corgi her majestys bodyguard eyes right familyfriendly information about the corgi'

distance = 432
spam score = 4
title = 'cows and bulls the craven heifer familyfriendly information about the cows and bulls'

distance = 432
spam score = 4
title = 'persian cat romantic kitten familyfriendly information about the persian cat'

distance = 432
spam score = 4
title = 'himalayan cat erin martin familyfriendly information about the himalayan cat'

distance = 433
spam score = 4
title = 'cows and bulls farmyard fun familyfriendly information about the cows and bulls'

distance = 433
spam score = 4
title = 'cows and bulls an early fall familyfriendly information about the cows and bulls'

distance = 434
spam score = 4
title = 'beagle grand pals soaring spirits familyfriendly information about the beagle'

distance = 480
spam score = 5
title = 'cows and bulls gordons ice cream familyfriendly information about the cows and bulls'

distance = 486
spam score = 5
title = 'mixed breed dog the dugout additional color familyfriendly information about the mixed breed dog'

distance = 486
spam score = 4
title = 'polar bear walking on the icepack familyfriendly information about the polar bear'

distance = 488
spam score = 5
title = 'mixed breed dog playing nurse sick dog familyfriendly information about the mixed breed dog'

distance = 489
spam score = 4
title = 'mixed breed dog puppy charm ii familyfriendly information about the mixed breed dog'

distance = 490
spam score = 4
title = 'mixed breed dog chili dogs hot stuff familyfriendly information about the mixed breed dog'

distance = 492
spam score = 5
title = 'saint bernard rival distractions the scratch pack familyfriendly information about the saint bernard'

distance = 493
spam score = 4
title = 'cows and bulls metro cow growth chart familyfriendly information about the cows and bulls'

distance = 493
spam score = 5
title = 'mixed breed dog heaven scent ii familyfriendly information about the mixed breed dog'

distance = 495
spam score = 4
title = 'mixed breed dog high divin doggie familyfriendly information about the mixed breed dog'

distance = 1180
spam score = 2
title = 'eagles gallery'

distance = 1216
spam score = 2
title = 'egrets gallery'

distance = 1259
spam score = 2
title = 'flamingo gallery'

distance = 1324
spam score = 2
title = 'brown bear gallery'

distance = 1421
spam score = 2
title = 'finches gallery'

distance = 1442
spam score = 72
title = 'butterfly posters books prints amp gifts'

distance = 1508
spam score = 83
title = 'charity and the jamband jamband family festival 2011'

distance = 118
spam score = 83
title = 'emma e ellison'

distance = 121
spam score = 82
title = 'michael l carr'

distance = 147
spam score = 80
title = 'william ker'

distance = 157
spam score = 17
title = 'names index page'

distance = 157
spam score = 17
title = 'names index page'

distance = 157
spam score = 26
title = 'names index page'

distance = 163
spam score = 82
title = 'joseph e kerr'

distance = 163
spam score = 81
title = 'pamela jane carr'

distance = 165
spam score = 82
title = 'william r harrisunknown'

distance = 167
spam score = 80
title = 'paul c weidman'

distance = 169
spam score = 82
title = 'dennis harrod'

distance = 171
spam score = 83
title = 'mary mae coner'

distance = 172
spam score = 79
title = 'john h brookscatherin freeman'

distance = 173
spam score = 84
title = 'harriett collett'

distance = 181
spam score = 81
title = 'nathaniel kerr'

distance = 182
spam score = 79
title = 'william edward furman'

distance = 182
spam score = 81
title = 'ruth prebe'

distance = 183
spam score = 83
title = 'james h karrsarah a cook'

distance = 183
spam score = 83
title = 'kenneth trepanierunknown'

distance = 185
spam score = 83
title = 'gregg loudon'

distance = 254
spam score = 83
title = 'ira o marklandbertha m cunningham'

distance = 254
spam score = 84
title = 'edward hazenhannah grant'

distance = 254
spam score = 72
title = 'virgil edward lowary'

distance = 254
spam score = 82
title = 'levin howardmargaret j hobbs'

distance = 254
spam score = 82
title = 'alvin manringnancy ann tanner'

distance = 254
spam score = 81
title = 'thomas hazenmary howlett'

distance = 254
spam score = 84
title = 'sam raganmrs ragan'

distance = 254
spam score = 80
title = 'james murphynannie lee oliver'

distance = 254
spam score = 81
title = 'henry a justicemary a taylor'

distance = 254
spam score = 81
title = 'robert murphylorene catlett'

distance = 272
spam score = 85
title = 'mr piledessie m newman'

distance = 272
spam score = 77
title = 'william markleymahala harding'

distance = 272
spam score = 78
title = 'timothy mayhallesther hutton'

distance = 272
spam score = 83
title = 'asa h taylorcarrie wooley'

distance = 272
spam score = 84
title = 'charles slackflorence newman'

distance = 273
spam score = 82
title = 'benjamin harrisabigail brooks'

distance = 273
spam score = 83
title = 'matthias l lyonunknown'

distance = 273
spam score = 81
title = 'kenneth e justicedelores a pitford'

distance = 273
spam score = 78
title = 'charles john kowarikemma schultz'

distance = 273
spam score = 82
title = 'henry milton robertsfrances henrietta mckimmy'

distance = 286
spam score = 79
title = 'lonnie jay morrisdeana michelle harless'

distance = 286
spam score = 82
title = 'james thomas gowenmargaret ann terrell'

distance = 287
spam score = 81
title = 'kyle earl nicholsbecky'

distance = 287
spam score = 84
title = 'david allen woolleyjulia gale'

distance = 287
spam score = 84
title = 'charles newmanluella'

distance = 287
spam score = 75
title = 'daniel hildretholive margaret dietderich'

distance = 287
spam score = 81
title = 'john arthur lavindonna marie gisel'

distance = 287
spam score = 77
title = 'paul philip constanssara sweeney'

distance = 287
spam score = 82
title = 'john nelson newmanmary mc donald'

distance = 287
spam score = 82
title = 'joseph mickeymary ann vanhorn'

distance = 300
spam score = 78
title = 'lawrence raymond thorpester marie knickerbocker'

distance = 300
spam score = 82
title = 'lee fred thorpmarvis martin miller'

distance = 300
spam score = 84
title = 'john dionedna l rampley'

distance = 300
spam score = 82
title = 'stephen hall stephensonlinda danko cassidy'

distance = 300
spam score = 83
title = 'alexander c clampittmary madeline newell'

distance = 300
spam score = 82
title = 'daniel goekecathy jo thompson'

distance = 300
spam score = 82
title = 'albert t newmanamanda l elston'

distance = 300
spam score = 80
title = 'william gastonnaomi teepled'

distance = 301
spam score = 82
title = 'william edward newmanorpha jane watts'

distance = 301
spam score = 84
title = 'william e gruginrebecca hamran calvert'

distance = 313
spam score = 83
title = 'mr raberosa lowary'

distance = 313
spam score = 82
title = 'john nelson babcockmary jane hess'

distance = 313
spam score = 81
title = 'willard e newmanhullie ervin'

distance = 314
spam score = 77
title = 'frank carr newelleva blanche billinsley'

distance = 314
spam score = 72
title = 'riley rampleynancy jane newman'

distance = 314
spam score = 82
title = 'carl hansford newmanelizabeth habben'

distance = 314
spam score = 84
title = 'ronald j wilsonconnie faye wilson'

distance = 314
spam score = 82
title = 'dan noelena carr'

distance = 314
spam score = 81
title = 'william bryant peytonjulia ann murphy'

distance = 314
spam score = 85
title = 'waldo phillipsdelphine burrows'

distance = 328
spam score = 78
title = 'samuel overbymatilda wilson'

distance = 328
spam score = 82
title = 'michael james donahuebarbara buckholz'

distance = 328
spam score = 81
title = 'eldon leroy mcclintockalice faye smith'

distance = 328
spam score = 82
title = 'george henry hyndseleanor ellen k dick'

distance = 328
spam score = 80
title = 'dale norman drakeingrid neesan'

distance = 328
spam score = 81
title = 'nicholas william carrvictoria nichols'

distance = 328
spam score = 82
title = 'george augustus haisemartha jane miles'

distance = 329
spam score = 78
title = 'john mark walkerevonne lynn hoag'

distance = 329
spam score = 79
title = 'john milton hildrethbarbara larsen'

distance = 329
spam score = 76
title = 'david wilsonsarah newman'

distance = 343
spam score = 81
title = 'virgil howardorpha leona rampley'

distance = 343
spam score = 82
title = 'noel edwin van slykekathleen lou powell'

distance = 343
spam score = 82
title = 'roger allen mooreeloise peyton'

distance = 343
spam score = 79
title = 'william elston elstonemma newman'

distance = 343
spam score = 77
title = 'reuben murphynannie lathren'

distance = 344
spam score = 78
title = 'adelbert frank castagnolijacqueline rae baldwin'

distance = 344
spam score = 83
title = 'mr cashmanbetty ann carr'

distance = 344
spam score = 80
title = 'samuel leal griffinsherry griffin'

distance = 344
spam score = 83
title = 'mr mrazdeborah dee elizabeth robinson'

distance = 344
spam score = 81
title = 'lawrence raymond thorpbeatrace race'

distance = 369
spam score = 79
title = 'rollo knight van slykedeanna myrtle price'

distance = 369
spam score = 81
title = 'frederick landis cromermarilyn rose snow'

distance = 370
spam score = 82
title = 'charles harry gorleyflorance ann mcfarlane'

distance = 370
spam score = 82
title = 'enos monroe milesmary eleanor bruce mcroberts'

distance = 370
spam score = 85
title = 'rodney james thurmanrene nestell'

distance = 371
spam score = 81
title = 'elias reuben carrjane florida redding'

distance = 371
spam score = 81
title = 'adam porternancy ellen gallam'

distance = 371
spam score = 80
title = 'apolinario pepeepefania gozon'

distance = 371
spam score = 82
title = 'glenn leroy newmanlois savage wright'

distance = 371
spam score = 81
title = 'mark jessup beardsleydecima campbellena miles'

distance = 1685
spam score = 45
title = 'descendants of thomas borden surname list'

distance = 1687
spam score = 59
title = 'i6817 aeltie jansdr'

distance = 1687
spam score = 60
title = 'caltech tapir group'

distance = 1728
spam score = 4
title = 'surname finder index of i surnames'

distance = 1728
spam score = 6
title = 'surname finder index of i surnames'

distance = 1743
spam score = 54
title = 'mayflower surname list generated by personal ancestral file'

distance = 1846
spam score = 7
title = '1080e 1'

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 55
title = ''

distance = 38
spam score = 55
title = ''

distance = 38
spam score = 55
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 53
title = ''

distance = 38
spam score = 55
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 53
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 52
title = ''

distance = 38
spam score = 54
title = ''

distance = 38
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 79
spam score = 54
title = ''

distance = 82
spam score = 53
title = ''

distance = 82
spam score = 51
title = ''

distance = 82
spam score = 53
title = ''

distance = 82
spam score = 53
title = ''

distance = 82
spam score = 53
title = ''

distance = 82
spam score = 53
title = ''

distance = 82
spam score = 53
title = ''

distance = 82
spam score = 53
title = ''

distance = 82
spam score = 53
title = ''

distance = 82
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 86
spam score = 53
title = ''

distance = 91
spam score = 53
title = ''

distance = 91
spam score = 51
title = ''

distance = 91
spam score = 50
title = ''

distance = 91
spam score = 52
title = ''

distance = 91
spam score = 53
title = ''

distance = 91
spam score = 53
title = ''

distance = 91
spam score = 52
title = ''

distance = 91
spam score = 53
title = ''

distance = 91
spam score = 53
title = ''

distance = 91
spam score = 52
title = ''

distance = 183
spam score = 53
title = ''

distance = 183
spam score = 54
title = ''

distance = 183
spam score = 53
title = ''

distance = 183
spam score = 53
title = ''

distance = 183
spam score = 54
title = ''

distance = 183
spam score = 53
title = ''

distance = 183
spam score = 53
title = ''

distance = 183
spam score = 53
title = ''

distance = 183
spam score = 53
title = ''

distance = 183
spam score = 52
title = ''

distance = 190
spam score = 50
title = ''

distance = 190
spam score = 50
title = ''

distance = 190
spam score = 51
title = ''

distance = 191
spam score = 46
title = ''

distance = 191
spam score = 49
title = ''

distance = 191
spam score = 48
title = ''

distance = 191
spam score = 48
title = ''

distance = 191
spam score = 48
title = ''

distance = 191
spam score = 48
title = ''

distance = 191
spam score = 49
title = ''

distance = 202
spam score = 49
title = ''

distance = 202
spam score = 49
title = ''

distance = 202
spam score = 49
title = ''

distance = 202
spam score = 47
title = ''

distance = 202
spam score = 49
title = ''

distance = 202
spam score = 49
title = ''

distance = 202
spam score = 49
title = ''

distance = 202
spam score = 49
title = ''

distance = 202
spam score = 49
title = ''

distance = 202
spam score = 49
title = ''

distance = 792
spam score = 23
title = 'italian books sitemap'

distance = 792
spam score = 23
title = 'physical education books sitemap'

distance = 793
spam score = 24
title = 'french books sitemap'

distance = 794
spam score = 22
title = 'religious books sitemap'

distance = 795
spam score = 22
title = 'land use books sitemap'

distance = 795
spam score = 21
title = 'family relationships books sitemap'

distance = 796
spam score = 24
title = 'general books sitemap'

distance = 796
spam score = 24
title = 'general books sitemap'

distance = 796
spam score = 20
title = 'dictionaries books sitemap'

distance = 796
spam score = 19
title = 'commerce books sitemap'

distance = 1799
spam score = 2
title = 'sprightly definition of sprightly by webster dictionary'

distance = 1820
spam score = 77
title = 'how to reset the pram macintosh news tips faqs'

distance = 1832
spam score = 42
title = ''

distance = 29
spam score = 55
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 57
title = ''

distance = 29
spam score = 57
title = ''

distance = 29
spam score = 57
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 57
title = ''

distance = 29
spam score = 55
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 57
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 56
title = ''

distance = 29
spam score = 57
title = ''

distance = 67
spam score = 57
title = ''

distance = 69
spam score = 57
title = ''

distance = 70
spam score = 56
title = ''

distance = 70
spam score = 57
title = ''

distance = 70
spam score = 57
title = ''

distance = 71
spam score = 57
title = ''

distance = 71
spam score = 58
title = ''

distance = 71
spam score = 58
title = ''

distance = 71
spam score = 58
title = ''

distance = 71
spam score = 58
title = ''

distance = 78
spam score = 57
title = ''

distance = 78
spam score = 57
title = ''

distance = 78
spam score = 57
title = ''

distance = 78
spam score = 57
title = ''

distance = 78
spam score = 58
title = ''

distance = 79
spam score = 56
title = ''

distance = 79
spam score = 58
title = ''

distance = 80
spam score = 56
title = ''

distance = 81
spam score = 56
title = ''

distance = 83
spam score = 57
title = ''

distance = 106
spam score = 56
title = ''

distance = 106
spam score = 56
title = ''

distance = 106
spam score = 55
title = ''

distance = 106
spam score = 58
title = ''

distance = 107
spam score = 57
title = ''

distance = 108
spam score = 57
title = ''

distance = 108
spam score = 56
title = ''

distance = 108
spam score = 57
title = ''

distance = 108
spam score = 56
title = ''

distance = 108
spam score = 56
title = ''

distance = 122
spam score = 56
title = ''

distance = 122
spam score = 57
title = ''

distance = 122
spam score = 57
title = ''

distance = 122
spam score = 57
title = ''

distance = 122
spam score = 57
title = ''

distance = 122
spam score = 57
title = ''

distance = 123
spam score = 58
title = ''

distance = 124
spam score = 56
title = ''

distance = 124
spam score = 58
title = ''

distance = 125
spam score = 58
title = ''

distance = 151
spam score = 57
title = ''

distance = 151
spam score = 51
title = ''

distance = 152
spam score = 57
title = ''

distance = 153
spam score = 56
title = ''

distance = 153
spam score = 57
title = ''

distance = 154
spam score = 56
title = ''

distance = 159
spam score = 58
title = ''

distance = 163
spam score = 57
title = ''

distance = 165
spam score = 58
title = ''

distance = 172
spam score = 57
title = ''

distance = 402
spam score = 55
title = ''

distance = 402
spam score = 56
title = ''

distance = 402
spam score = 56
title = ''

distance = 402
spam score = 56
title = ''

distance = 402
spam score = 56
title = ''

distance = 402
spam score = 55
title = ''

distance = 402
spam score = 56
title = ''

distance = 402
spam score = 56
title = ''

distance = 402
spam score = 55
title = ''

distance = 402
spam score = 55
title = ''

distance = 430
spam score = 56
title = ''

distance = 432
spam score = 55
title = ''

distance = 432
spam score = 56
title = ''

distance = 435
spam score = 56
title = ''

distance = 436
spam score = 56
title = ''

distance = 436
spam score = 55
title = ''

distance = 439
spam score = 55
title = ''

distance = 439
spam score = 56
title = ''

distance = 439
spam score = 56
title = ''

distance = 439
spam score = 55
title = ''

distance = 443
spam score = 57
title = ''

distance = 443
spam score = 55
title = ''

distance = 446
spam score = 55
title = ''

distance = 446
spam score = 56
title = ''

distance = 446
spam score = 56
title = ''

distance = 446
spam score = 56
title = ''

distance = 447
spam score = 56
title = ''

distance = 450
spam score = 55
title = ''

distance = 453
spam score = 55
title = ''

distance = 461
spam score = 56
title = ''

distance = 1653
spam score = 33
title = 'page bu'

distance = 1653
spam score = 46
title = 'eustephia cav extrait de herbert w 1837 amaryllidaceae'

distance = 1714
spam score = 53
title = 'filed under code unknown and partly hidden'

distance = 1718
spam score = 21
title = 'uttar pradesh'

distance = 1758
spam score = 60
title = 'generic guide to new world scarab beetlesscarabaeidaeaphodiinae'

distance = 1770
spam score = 54
title = 'mozart quothaydn quartetsquot kv 458 b flat major quotthe huntquot 2 menuetto moderato'

distance = 1800
spam score = 46
title = ''

distance = 1807
spam score = 68
title = 'thomas careydavid carey 1827 deed'

distance = 1808
spam score = 11
title = 'fleecing withers golfed protgs parliament unnamed'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 42'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 02'

distance = 3
spam score = 42
title = 'and it is divine volume 1 issue 10 p 32'

distance = 3
spam score = 45
title = 'and it is divine volume 1 issue 10 p 33'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 27'

distance = 3
spam score = 46
title = 'and it is divine volume 1 issue 10 p 02'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 30'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 43'

distance = 3
spam score = 46
title = 'and it is divine volume 1 issue 10 p 03'

distance = 3
spam score = 46
title = 'and it is divine volume 1 issue 10 p 32'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 11'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 26'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 03'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 12'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 13'

distance = 3
spam score = 44
title = 'and it is divine volume 1 issue 10 p 02'

distance = 3
spam score = 45
title = 'and it is divine volume 1 issue 10 p 29'

distance = 3
spam score = 45
title = 'and it is divine volume 1 issue 10 p 28'

distance = 3
spam score = 43
title = 'and it is divine volume 1 issue 10 p 04'

distance = 3
spam score = 46
title = 'and it is divine volume 1 issue 10 p 07'

distance = 124
spam score = 47
title = 'and it is divine volume 1 issue 10 p 31'

distance = 124
spam score = 47
title = 'and it is divine volume 1 issue 10 p 30'

distance = 124
spam score = 47
title = 'and it is divine volume 1 issue 10 p 22'

distance = 124
spam score = 46
title = 'and it is divine volume 1 issue 10 p 87'

distance = 124
spam score = 46
title = 'and it is divine volume 1 issue 10 p 84'

distance = 124
spam score = 47
title = 'and it is divine volume 1 issue 10 p 82'

distance = 124
spam score = 46
title = 'and it is divine volume 1 issue 10 p 44'

distance = 124
spam score = 46
title = 'and it is divine volume 1 issue 10 p 41'

distance = 124
spam score = 47
title = 'and it is divine volume 1 issue 10 p 37'

distance = 124
spam score = 46
title = 'and it is divine volume 1 issue 10 p 21'

distance = 180
spam score = 45
title = 'and it is divine volume 1 issue 10 p 39 love torn page'

distance = 180
spam score = 44
title = 'and it is divine volume 1 issue 10 p 12 article shankara'

distance = 180
spam score = 44
title = 'and it is divine volume 1 issue 10 p 14 article shankara'

distance = 180
spam score = 45
title = 'and it is divine volume 1 issue 10 p 15 article shankara'

distance = 180
spam score = 44
title = 'and it is divine volume 1 issue 10 p 13 article shankara'

distance = 182
spam score = 42
title = 'and it is divine volume 1 issue 10 subscription postcard'

distance = 183
spam score = 45
title = 'and it is divine volume 1 issue 10 p 80 palmistry cont'

distance = 183
spam score = 46
title = 'and it is divine volume 1 issue 10 p 78 palmistry cont'

distance = 183
spam score = 45
title = 'and it is divine volume 1 issue 10 p 79 palmistry cont'

distance = 184
spam score = 41
title = 'and it is divine volume 1 issue 10 p 17 centerfold right'

distance = 215
spam score = 44
title = 'and it is divine volume 1 issue 10 p 74 maharaji what is a mango cont'

distance = 227
spam score = 42
title = 'and it is divine volume 1 issue 10 p 22 maharaji satsang hold on to me'

distance = 227
spam score = 45
title = 'and it is divine volume 1 issue 10 p 88 backcover'

distance = 227
spam score = 46
title = 'and it is divine volume 1 issue 10 p 23 maharaji satsang hold on to me'

distance = 227
spam score = 42
title = 'and it is divine volume 1 issue 10 p 19 maharaji satsang hold on to me'

distance = 227
spam score = 44
title = 'and it is divine volume 1 issue 10 p 18 maharaji satsang hold on to me'

distance = 227
spam score = 45
title = 'and it is divine volume 1 issue 10 p 17 maharaji satsang hold on to me'

distance = 227
spam score = 46
title = 'and it is divine volume 1 issue 10 p 16 maharaji satsang hold on to me'

distance = 233
spam score = 49
title = 'and it is divine volume 1 issue 10 p 01a table of contents'

distance = 242
spam score = 42
title = 'and it is divine volume 1 issue 10 p 46 women together story'

distance = 264
spam score = 46
title = 'and it is divine volume 1 issue 10 p 01 front cover'

distance = 264
spam score = 46
title = 'and it is divine volume 1 issue 10 p 01 front cover'

distance = 265
spam score = 44
title = 'and it is divine volume 1 issue 10 p 23 lost vegas cont'

distance = 265
spam score = 42
title = 'and it is divine volume 1 issue 10 p 24 lost vegas cont'

distance = 265
spam score = 43
title = 'and it is divine volume 1 issue 10 p 25 lost vegas cont'

distance = 265
spam score = 42
title = 'and it is divine volume 1 issue 10 p 26 lost vegas cont'

distance = 265
spam score = 44
title = 'and it is divine volume 1 issue 10 p 70 maharaji perfect master plan'

distance = 270
spam score = 41
title = 'and it is divine volume 1 issue 10 p 22 maharaji satsang such a fine line'

distance = 270
spam score = 43
title = 'and it is divine volume 1 issue 10 p 19 maharaji satsang such a fine line'

distance = 270
spam score = 41
title = 'and it is divine volume 1 issue 10 p 18 maharaji satsang such a fine line'

distance = 312
spam score = 47
title = 'and it is divine volume 1 issue 10 p 26 maharaji love is essential'

distance = 314
spam score = 43
title = 'and it is divine volume 1 issue 10 p 41 back cover inside'

distance = 319
spam score = 46
title = 'and it is divine volume 1 issue 10 p 27 marolyn satsang each step is our goal'

distance = 319
spam score = 46
title = 'and it is divine volume 1 issue 10 p 26 marolyn satsang each step is our goal'

distance = 323
spam score = 43
title = 'and it is divine volume 1 issue 10 p 42 back cover'

distance = 332
spam score = 45
title = 'and it is divine volume 1 issue 10 p 36 maharaji excerpt toronto'

distance = 334
spam score = 42
title = 'and it is divine volume 1 issue 10 p 48 women together story cont'

distance = 334
spam score = 43
title = 'and it is divine volume 1 issue 10 p 52 women together story cont'

distance = 334
spam score = 42
title = 'and it is divine volume 1 issue 10 p 51 women together story cont'

distance = 334
spam score = 42
title = 'and it is divine volume 1 issue 10 p 50 women together story cont'

distance = 417
spam score = 51
title = 'and it is divine special millennium issue p 17 millennium program'

distance = 417
spam score = 52
title = 'and it is divine special millennium issue p 16 millennium program'

distance = 417
spam score = 53
title = 'and it is divine special millennium issue p 15 millennium program'

distance = 417
spam score = 52
title = 'and it is divine special millennium issue p 14 millennium program'

distance = 419
spam score = 56
title = 'and it is divine special millennium issue p 09 table of contents'

distance = 421
spam score = 52
title = 'and it is divine special millennium issue p 39 prophets of the millennium'

distance = 421
spam score = 45
title = 'and it is divine volume 1 issue 10 p 40 maharaji excerpt rome cont'

distance = 421
spam score = 53
title = 'and it is divine special millennium issue p 05 astrodome'

distance = 421
spam score = 53
title = 'and it is divine special millennium issue p 38 prophets of the millennium'

distance = 422
spam score = 51
title = 'and it is divine special millennium issue p 53 arti'

distance = 520
spam score = 38
title = 'and it is divine volume 1 issue 10'

distance = 520
spam score = 38
title = 'and it is divine volume 1 issue 10'

distance = 520
spam score = 39
title = 'and it is divine volume 1 issue 10'

distance = 540
spam score = 51
title = 'and it is divine special millennium issue p 76 rivers merge satsang'

distance = 542
spam score = 51
title = 'and it is divine special millennium issue p 41 little drops of mercy'

distance = 542
spam score = 51
title = 'and it is divine special millennium issue p 42 little drops of mercy'

distance = 545
spam score = 51
title = 'and it is divine special millennium issue p 34 holy family cont'

distance = 545
spam score = 50
title = 'and it is divine special millennium issue p 36 holy family cont'

distance = 545
spam score = 51
title = 'and it is divine special millennium issue p 33 holy family cont'

distance = 545
spam score = 51
title = 'and it is divine special millennium issue p 30 holy family cont'

distance = 616
spam score = 47
title = 'and it is divine volume 1 issue 10'

distance = 621
spam score = 44
title = 'and it is divine volume 1 issue 10'

distance = 690
spam score = 42
title = 'and it is divine'

distance = 696
spam score = 39
title = 'and it is divine volume 1 issue 10'

distance = 701
spam score = 32
title = 'and it is divine special millennium issue'

distance = 703
spam score = 36
title = 'and it is divine volume 1 issue 10'

distance = 703
spam score = 37
title = 'and it is divine volume 1 issue 10'

distance = 733
spam score = 38
title = 'and it is divine volume 1 issue 10'

distance = 748
spam score = 44
title = 'and it is divine'

distance = 750
spam score = 39
title = 'and it is divine volume 1 issue 10'

distance = 1126
spam score = 37
title = 'and it is divine special millennium issue'

distance = 1134
spam score = 40
title = 'and it is divine special millennium issue'

distance = 1515
spam score = 54
title = 'guru maharaji prem rawat info miscellaneous scans'

distance = 113
spam score = 16
title = 'online degree post vanderbilt university'

distance = 120
spam score = 11
title = 'online degree post south university'

distance = 122
spam score = 18
title = 'online degree post university of cincinnati'

distance = 122
spam score = 40
title = 'online degree post university of denver'

distance = 125
spam score = 25
title = 'online degree post university of scranton'

distance = 130
spam score = 16
title = 'online degree post villanova university'

distance = 131
spam score = 17
title = 'online degree post norwich university'

distance = 133
spam score = 13
title = 'online degree post benedictine university'

distance = 137
spam score = 20
title = 'online degree post thunderbird university'

distance = 137
spam score = 21
title = 'online degree post everglades university'

distance = 141
spam score = 14
title = 'online degree post university of liverpool'

distance = 143
spam score = 17
title = 'online degree post strayer university'

distance = 145
spam score = 17
title = 'city university accounting'

distance = 146
spam score = 18
title = 'city university programming in c'

distance = 146
spam score = 18
title = 'city university programming in c'

distance = 150
spam score = 12
title = 'devry university accounting'

distance = 150
spam score = 11
title = 'devry university finance'

distance = 150
spam score = 27
title = 'bellevue university bs in management'

distance = 150
spam score = 30
title = 'online degree post ecornell university'

distance = 160
spam score = 27
title = 'bellevue university ba in leadership'

distance = 303
spam score = 17
title = 'upper iowa university bs in marketing'

distance = 303
spam score = 35
title = 'everglades university masters degree in business administration'

distance = 303
spam score = 10
title = 'kaplan university bs in businessaccounting'

distance = 304
spam score = 36
title = 'national university bachelor of arts in global studies'

distance = 304
spam score = 14
title = 'benedictine university mba in health administration'

distance = 304
spam score = 21
title = 'strayer university undergraduate certificate in accounting'

distance = 304
spam score = 13
title = 'walden university ms in computer science'

distance = 305
spam score = 10
title = 'online degree post jones college'

distance = 305
spam score = 15
title = 'university of denver bachelor of arts in global studies'

distance = 306
spam score = 20
title = 'cardean university graduate certificate in marketing'

distance = 346
spam score = 21
title = 'ashford university bachelor of arts in organizational management in education'

distance = 346
spam score = 13
title = 'grand canyon university bachelor of science in marketing'

distance = 346
spam score = 17
title = 'kaplan university forensic nursing certificate program'

distance = 346
spam score = 29
title = 'south university bachelor of science degree in information technology'

distance = 346
spam score = 13
title = 'capella university doctor of philosophy in organization and management'

distance = 347
spam score = 19
title = 'university of phoenix master of arts in education special education'

distance = 347
spam score = 14
title = 'grand canyon university bachelor of science in accounting'

distance = 348
spam score = 16
title = 'strayer university bachelor of business administration in finance'

distance = 348
spam score = 23
title = 'strayer university master of science in communications technology'

distance = 348
spam score = 15
title = 'regis university executive information technologies'

distance = 364
spam score = 22
title = 'university of phoenix maed curriculum and instruction'

distance = 364
spam score = 14
title = 'regis university undergraduate certificate in public administration'

distance = 364
spam score = 26
title = 'aiu university bachelor of science in criminal justice'

distance = 364
spam score = 17
title = 'norwich university ma in military history'

distance = 364
spam score = 18
title = 'cardean university graduate certificate in professional accounting'

distance = 364
spam score = 17
title = 'villanova university essentials of project management'

distance = 365
spam score = 22
title = 'strayer university associate in arts in database technology'

distance = 365
spam score = 19
title = 'bellevue university master of science in security management'

distance = 365
spam score = 19
title = 'cardean university graduate certificate in business administration'

distance = 365
spam score = 21
title = 'grantham university master of science in informaion technology'

distance = 391
spam score = 18
title = 'berkeley college aas in business administration in marketing'

distance = 391
spam score = 14
title = 'university of phoenix bachelor of science in business finance'

distance = 391
spam score = 17
title = 'ashford university bachelor of arts in organizational management in business'

distance = 391
spam score = 19
title = 'western international university bachelor of science in information technology'

distance = 392
spam score = 21
title = 'american sentinel university executive master of business administration'

distance = 392
spam score = 26
title = 'university of scranton ms in education in curriculum and instruction'

distance = 392
spam score = 21
title = 'fielding graduate university master of arts degrees in organization management'

distance = 393
spam score = 16
title = 'university of denver mas in telecommunications broadband'

distance = 393
spam score = 16
title = 'university of phoenix call center management certificate'

distance = 393
spam score = 16
title = 'baker college online mba in leadership studies'

distance = 414
spam score = 24
title = 'jones international university master of education in educational leadership and administration'

distance = 414
spam score = 12
title = 'kaplan university introduction to computer programming language certificate'

distance = 415
spam score = 20
title = 'university of denver mps in applied communication organizational communication'

distance = 415
spam score = 19
title = 'florida metropolitan university bachelor of science in criminal justice'

distance = 415
spam score = 10
title = 'cardean university master of business administration in management of technology'

distance = 415
spam score = 18
title = 'aiu university master of business administration in healthcare management'

distance = 415
spam score = 26
title = 'national university bachelor of science in criminal justice administration'

distance = 415
spam score = 22
title = 'portland state university bachelors degree in criminology and criminal justice'

distance = 415
spam score = 20
title = 'westwood college online bs in criminal justice'

distance = 415
spam score = 12
title = 'strayer university bachelor of science in computer information systems'

distance = 444
spam score = 12
title = 'westwood college online business administration in concentration in accounting'

distance = 444
spam score = 13
title = 'ellis college of nyit master of business in strategy and economics'

distance = 444
spam score = 21
title = 'grantham university master of science in information management in project management'

distance = 445
spam score = 14
title = 'jones college associate of science in business administration'

distance = 445
spam score = 14
title = 'university of liverpool master of science in information technology msc in it'

distance = 445
spam score = 13
title = 'university of phoenix mba in human resources management'

distance = 445
spam score = 13
title = 'baker college online bachelor in business administration of accounting'

distance = 445
spam score = 36
title = 'colorado technical university ms in business management'

distance = 446
spam score = 20
title = 'american sentinel university certification in project management professional'

distance = 446
spam score = 23
title = 'the college network rn to master of science in nursing'

distance = 472
spam score = 18
title = 'kaplan university advanced start option for bachelor of science in business'

distance = 472
spam score = 16
title = 'the college network bs in computer information systems'

distance = 472
spam score = 20
title = 'ellis college of nyit bachelor of science behavioral sciences in sociology'

distance = 472
spam score = 11
title = 'kaplan university associate of applied science in business administrationaccounting'

distance = 472
spam score = 14
title = 'grand canyon university bachelor of science in public safety administration'

distance = 472
spam score = 23
title = 'aiu university associate of arts in business administration in visual communications'

distance = 472
spam score = 15
title = 'upper iowa university mba in corporate financial management'

distance = 473
spam score = 23
title = 'kaplan university advanced start bachelor of science in information technology'

distance = 473
spam score = 18
title = 'saint leo university ba in business administration and healthcare management'

distance = 473
spam score = 21
title = 'everest college bachelor of science in criminal justice'

distance = 516
spam score = 23
title = 'keiser college ecampus registered nurse to bachelor of science in nursing'

distance = 516
spam score = 18
title = 'clayton college of natural health university bachelor of science in holistic nutrition'

distance = 516
spam score = 25
title = 'clayton college of natural health university doctor of philosophy in holistic nutrition'

distance = 517
spam score = 16
title = 'westwood college online business administration in concentration in sales and marketing'

distance = 518
spam score = 16
title = 'keiser college ecampus associate in health services administration'

distance = 518
spam score = 13
title = 'keller graduate school graduate certificate program in accounting'

distance = 518
spam score = 14
title = 'university of denver mps in applied communication alternative dispute resolution'

distance = 519
spam score = 24
title = 'university of denver mas in environmental policy and management environmental project management'

distance = 520
spam score = 15
title = 'american sentinel university certification in cisco certified network professional'

distance = 520
spam score = 31
title = 'colorado technical university bachelor of science in software engineering in security'

distance = 642
spam score = 15
title = 'berkeley college aas in health services administration medical insurance billing and coding'

distance = 653
spam score = 14
title = 'keller graduate school master of business administration in network and communications management'

distance = 669
spam score = 22
title = 'jones international university master of education in secondary curriculum instruction and assessment in teacher licensure'

distance = 670
spam score = 14
title = 'online degree post aspen university'

distance = 686
spam score = 14
title = 'university of denver mas in computer information systems distributed objectoriented analysis and design'

distance = 854
spam score = 26
title = 'university of maryland ms in health care administrationmba dual degree'

distance = 1795
spam score = 60
title = 'an improved process for milling dehulled rice for producing firmer and less sticky rice texture'

distance = 1802
spam score = 52
title = 'an improved process for milling dehulled rice for producing firmer and less sticky rice texture'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 59
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 59
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 57
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 57
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 27
spam score = 58
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 52
title = 'glias site record with aerial view'

distance = 155
spam score = 52
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 52
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 52
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 155
spam score = 53
title = 'glias site record with aerial view'

distance = 357
spam score = 53
title = 'glias site record with pair of os maps and aerial views'

distance = 357
spam score = 53
title = 'glias site record with pair of os maps and aerial views'

distance = 357
spam score = 53
title = 'glias site record with pair of os maps and aerial views'

distance = 357
spam score = 53
title = 'glias site record with pair of os maps and aerial views'

distance = 357
spam score = 53
title = 'glias site record with pair of os maps and aerial views'

distance = 357
spam score = 53
title = 'glias site record with pair of os maps and aerial views'

distance = 357
spam score = 52
title = 'glias site record with pair of os maps and aerial views'

distance = 357
spam score = 53
title = 'glias site record with pair of os maps and aerial views'

distance = 357
spam score = 53
title = 'glias site record with pair of os maps and aerial views'

distance = 357
spam score = 53
title = 'glias site record with pair of os maps and aerial views'

distance = 1697
spam score = 1
title = 'definition of epexegeticalhtml by click4everything'

distance = 1707
spam score = 54
title = 'trilobite facts'

distance = 1708
spam score = 63
title = 'arabic music nagat egyptian singer'

distance = 1737
spam score = 49
title = 'spinosaurus facts'

distance = 1783
spam score = 24
title = 'moose landing'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 55
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 55
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 0
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 28
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 39
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 47
spam score = 55
title = 'maryland division of the sons of confederate veterans'

distance = 47
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 47
spam score = 55
title = 'maryland division of the sons of confederate veterans'

distance = 50
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 50
spam score = 55
title = 'maryland division of the sons of confederate veterans'

distance = 51
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 51
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 51
spam score = 55
title = 'maryland division of the sons of confederate veterans'

distance = 53
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 54
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 55
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 57
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 62
spam score = 55
title = 'maryland division of the sons of confederate veterans'

distance = 68
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 70
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 77
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 89
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 100
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 107
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 128
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 154
spam score = 56
title = 'maryland division of the sons of confederate veterans'

distance = 1308
spam score = 46
title = 'confederate veterans'

distance = 1563
spam score = 81
title = 'maryland bounce llc testimonials'

distance = 1762
spam score = 27
title = 'neba'

distance = 1868
spam score = 34
title = ''

distance = 1890
spam score = 15
title = 'hai van son bao liem mp3 hai spanking'

distance = 146
spam score = 0
title = ''

distance = 157
spam score = 0
title = ''

distance = 274
spam score = 0
title = ''

distance = 287
spam score = 0
title = ''

distance = 290
spam score = 0
title = ''

distance = 293
spam score = 0
title = ''

distance = 311
spam score = 0
title = ''

distance = 312
spam score = 0
title = ''

distance = 324
spam score = 0
title = ''

distance = 330
spam score = 0
title = ''

distance = 346
spam score = 0
title = ''

distance = 350
spam score = 0
title = ''

distance = 356
spam score = 0
title = ''

distance = 409
spam score = 0
title = ''

distance = 447
spam score = 0
title = ''

distance = 454
spam score = 0
title = ''

distance = 477
spam score = 0
title = ''

distance = 504
spam score = 0
title = ''

distance = 520
spam score = 0
title = ''

distance = 529
spam score = 0
title = ''

distance = 549
spam score = 0
title = ''

distance = 564
spam score = 0
title = ''

distance = 803
spam score = 0
title = ''

distance = 138
spam score = 19
title = 'trafford restaurant directory italian restaurants'

distance = 139
spam score = 20
title = 'trafford restaurant directory spanish restaurants'

distance = 140
spam score = 20
title = 'trafford restaurant directory english restaurants'

distance = 141
spam score = 16
title = 'trafford restaurant directory french restaurants'

distance = 142
spam score = 21
title = 'trafford restaurant directory indian restaurants'

distance = 143
spam score = 17
title = 'trafford restaurant directory american restaurants'

distance = 144
spam score = 19
title = 'trafford restaurant directory chinese restaurants'

distance = 151
spam score = 22
title = 'tameside restaurant directory italian restaurants'

distance = 153
spam score = 19
title = 'warrington restaurant directory american restaurants'

distance = 153
spam score = 25
title = 'tameside restaurant directory english restaurants'

distance = 154
spam score = 19
title = 'trafford restaurant directory portuguese restaurants'

distance = 154
spam score = 17
title = 'trafford restaurant directory mediterranean restaurants'

distance = 155
spam score = 20
title = 'warrington restaurant directory indian restaurants'

distance = 155
spam score = 18
title = 'warrington restaurant directory english restaurants'

distance = 155
spam score = 18
title = 'tameside restaurant directory american restaurants'

distance = 156
spam score = 17
title = 'warrington restaurant directory greek restaurants'

distance = 156
spam score = 20
title = 'tameside restaurant directory chinese restaurants'

distance = 156
spam score = 19
title = 'warrington restaurant directory french restaurants'

distance = 157
spam score = 18
title = 'trafford restaurant directory oriental restaurants'

distance = 158
spam score = 21
title = 'tameside restaurant directory indian restaurants'

distance = 174
spam score = 20
title = 'warrington restaurant directory thai restaurants'

distance = 174
spam score = 18
title = 'tameside restaurant directory pizza restaurants'

distance = 174
spam score = 20
title = 'wirral restaurant directory greek restaurants'

distance = 174
spam score = 20
title = 'sefton restaurant directory chinese restaurants'

distance = 174
spam score = 19
title = 'liverpool restaurant directory greek restaurants'

distance = 175
spam score = 19
title = 'wirral restaurant directory italian restaurants'

distance = 175
spam score = 18
title = 'bolton uk restaurant directory spanish restaurants'

distance = 176
spam score = 20
title = 'wirral restaurant directory french restaurants'

distance = 177
spam score = 36
title = 'liverpool restaurant directory english restaurants'

distance = 177
spam score = 24
title = 'liverpool restaurant directory french restaurants'

distance = 179
spam score = 17
title = 'sefton restaurant directory oriental restaurants'

distance = 179
spam score = 19
title = 'macclesfield restaurant directory english restaurants'

distance = 179
spam score = 20
title = 'bolton uk restaurant directory indian restaurants'

distance = 180
spam score = 20
title = 'warrington restaurant directory pizza restaurants'

distance = 180
spam score = 19
title = 'liverpool restaurant directory italian restaurants'

distance = 181
spam score = 17
title = 'sefton restaurant directory portuguese restaurants'

distance = 181
spam score = 17
title = 'macclesfield restaurant directory american restaurants'

distance = 181
spam score = 19
title = 'liverpool restaurant directory japanese restaurants'

distance = 182
spam score = 23
title = 'bolton uk restaurant directory chinese restaurants'

distance = 182
spam score = 20
title = 'liverpool restaurant directory american restaurants'

distance = 186
spam score = 20
title = 'liverpool restaurant directory turkish restaurants'

distance = 188
spam score = 21
title = 'liverpool restaurant directory mexican restaurants'

distance = 188
spam score = 26
title = 'liverpool restaurant directory mediterranean restaurants'

distance = 189
spam score = 18
title = 'bolton uk restaurant directory mediterranean restaurants'

distance = 190
spam score = 17
title = 'bolton uk restaurant directory oriental restaurants'

distance = 190
spam score = 17
title = 'hyndburn restaurant directory italian restaurants'

distance = 190
spam score = 19
title = 'wirral restaurant directory thai restaurants'

distance = 190
spam score = 22
title = 'macclesfield restaurant directory mediterranean restaurants'

distance = 191
spam score = 20
title = 'bolton uk restaurant directory vegetarian restaurants'

distance = 191
spam score = 19
title = 'bolton uk restaurant directory thai restaurants'

distance = 193
spam score = 18
title = 'sefton restaurant directory pizza restaurants'

distance = 194
spam score = 18
title = 'wirral restaurant directory seafood restaurants'

distance = 195
spam score = 18
title = 'liverpool restaurant directory pizza restaurants'

distance = 195
spam score = 18
title = 'hyndburn restaurant directory chinese restaurants'

distance = 195
spam score = 15
title = 'hyndburn restaurant directory american restaurants'

distance = 196
spam score = 20
title = 'liverpool restaurant directory thai restaurants'

distance = 197
spam score = 17
title = 'hyndburn restaurant directory indian restaurants'

distance = 198
spam score = 20
title = 'wirral restaurant directory pizza restaurants'

distance = 199
spam score = 18
title = 'macclesfield restaurant directory thai restaurants'

distance = 201
spam score = 21
title = 'liverpool restaurant directory vegetarian restaurants'

distance = 222
spam score = 20
title = 'st helens restaurant directory oriental restaurants'

distance = 222
spam score = 26
title = 'blackburn restaurant directory chinese restaurants'

distance = 224
spam score = 20
title = 'blackburn restaurant directory english restaurants'

distance = 226
spam score = 18
title = 'blackburn restaurant directory american restaurants'

distance = 227
spam score = 24
title = 'preston restaurant directory mediterranean restaurants'

distance = 228
spam score = 22
title = 'blackburn restaurant directory indian restaurants'

distance = 237
spam score = 24
title = 'blackburn restaurant directory mediterranean restaurants'

distance = 245
spam score = 22
title = 'lancaster restaurant directory mediterranean restaurants'

distance = 278
spam score = 20
title = 'wigan uk restaurant directory pizza restaurants'

distance = 281
spam score = 19
title = 'salford uk restaurant directory chinese restaurants'

distance = 325
spam score = 18
title = 'halton uk restaurant directory your guide to find the best restaurants'

distance = 329
spam score = 24
title = 'warrington restaurant directory your guide to find the best restaurants'

distance = 408
spam score = 23
title = 'preston restaurant directory your guide from takeaway to delivery or eatin to find the best restaurants'

distance = 413
spam score = 27
title = 'wirral restaurant directory your guide from takeaway to delivery or eatin to find the best restaurants'

distance = 420
spam score = 20
title = 'trafford restaurant directory your guide from takeaway to delivery or eatin to find the best restaurants'

distance = 425
spam score = 32
title = 'bolton uk restaurant directory your guide from takeaway to delivery or eatin to find the best restaurants'

distance = 430
spam score = 22
title = 'blackpool restaurant directory your guide from takeaway to delivery or eatin to find the best restaurants'

distance = 437
spam score = 23
title = 'chester restaurant directory your guide from takeaway to delivery or eatin to find the best restaurants'

distance = 443
spam score = 25
title = 'sefton restaurant directory your guide from takeaway to delivery or eatin to find the best restaurants'

distance = 445
spam score = 22
title = 'stockport restaurant directory your guide from takeaway to delivery or eatin to find the best restaurants'

distance = 562
spam score = 14
title = 'bolton uk restaurant directory italian restaurants'

distance = 572
spam score = 17
title = 'sefton restaurant directory mexican restaurants'

distance = 573
spam score = 19
title = 'chester restaurant directory chinese restaurants'

distance = 574
spam score = 19
title = 'chester restaurant directory italian restaurants'

distance = 574
spam score = 20
title = 'chester restaurant directory english restaurants'

distance = 574
spam score = 17
title = 'trafford restaurant directory thai restaurants'

distance = 575
spam score = 21
title = 'stockport restaurant directory american restaurants'

distance = 577
spam score = 21
title = 'chester restaurant directory spanish restaurants'

distance = 578
spam score = 21
title = 'chester restaurant directory french restaurants'

distance = 579
spam score = 21
title = 'chester restaurant directory indian restaurants'

distance = 597
spam score = 18
title = 'stockport restaurant directory spanish restaurants'

distance = 598
spam score = 19
title = 'stockport restaurant directory chinese restaurants'

distance = 599
spam score = 20
title = 'stockport restaurant directory mediterranean restaurants'

distance = 602
spam score = 17
title = 'stockport restaurant directory thai restaurants'

distance = 604
spam score = 19
title = 'stockport restaurant directory pizza restaurants'

distance = 635
spam score = 49
title = 'blackburn search directory societies and organisations'

distance = 643
spam score = 50
title = 'macclesfield search directory your guide for estate agents solicitors and restaurants'

distance = 727
spam score = 19
title = 'manchester search directory clock repair'

distance = 830
spam score = 30
title = 'merseyside search directory'

distance = 880
spam score = 21
title = 'cheshire search directory'

distance = 1578
spam score = 91
title = 'savernake team information'

distance = 1707
spam score = 18
title = 'bmk restaurant information at bandung tourism official website'

distance = 67
spam score = 24
title = 'journals urlsindexcom'

distance = 67
spam score = 23
title = 'journals urlsindexcom'

distance = 67
spam score = 24
title = 'aids urlsindexcom'

distance = 67
spam score = 23
title = 'good news urlsindexcom'

distance = 67
spam score = 21
title = 'companies urlsindexcom'

distance = 67
spam score = 24
title = 'journalism urlsindexcom'

distance = 96
spam score = 25
title = 'education urlsindexcom'

distance = 96
spam score = 25
title = 'education urlsindexcom'

distance = 96
spam score = 18
title = 'books urlsindexcom'

distance = 96
spam score = 21
title = 'education urlsindexcom'

distance = 96
spam score = 25
title = 'education urlsindexcom'

distance = 96
spam score = 15
title = 'education urlsindexcom'

distance = 97
spam score = 24
title = 'people urlsindexcom'

distance = 98
spam score = 23
title = 'museums urlsindexcom'

distance = 98
spam score = 27
title = 'general news urlsindexcom'

distance = 98
spam score = 18
title = 'training urlsindexcom'

distance = 98
spam score = 18
title = 'washington urlsindexcom'

distance = 98
spam score = 24
title = 'museums urlsindexcom'

distance = 99
spam score = 29
title = 'organizations urlsindexcom'

distance = 99
spam score = 21
title = 'sports urlsindexcom'

distance = 142
spam score = 24
title = 'rural development urlsindexcom'

distance = 142
spam score = 25
title = 'tour operators urlsindexcom'

distance = 143
spam score = 22
title = 'pyromania urlsindexcom'

distance = 143
spam score = 24
title = 'silicosis urlsindexcom'

distance = 143
spam score = 23
title = 'synesthesia urlsindexcom'

distance = 143
spam score = 41
title = 'computer science urlsindexcom'

distance = 143
spam score = 23
title = 'trisomy urlsindexcom'

distance = 143
spam score = 24
title = 'environment and nature urlsindexcom'

distance = 143
spam score = 23
title = 'progeria urlsindexcom'

distance = 143
spam score = 33
title = 'computer science urlsindexcom'

distance = 169
spam score = 19
title = 'vermont urlsindexcom'

distance = 169
spam score = 20
title = 'hawaii urlsindexcom'

distance = 169
spam score = 19
title = 'semiconductors urlsindexcom'

distance = 169
spam score = 25
title = 'trench mouth urlsindexcom'

distance = 169
spam score = 23
title = 'leukemia urlsindexcom'

distance = 169
spam score = 21
title = 'ethics urlsindexcom'

distance = 170
spam score = 24
title = 'selfinjury urlsindexcom'

distance = 170
spam score = 18
title = 'hypnotherapy urlsindexcom'

distance = 170
spam score = 24
title = 'addisons disease urlsindexcom'

distance = 170
spam score = 24
title = 'addisons disease urlsindexcom'

distance = 184
spam score = 24
title = 'endocarditis urlsindexcom'

distance = 184
spam score = 24
title = 'behcets disease urlsindexcom'

distance = 184
spam score = 24
title = 'migraine urlsindexcom'

distance = 184
spam score = 24
title = 'bronchitis urlsindexcom'

distance = 184
spam score = 23
title = 'behcets disease urlsindexcom'

distance = 184
spam score = 22
title = 'pregnancy complications urlsindexcom'

distance = 184
spam score = 24
title = 'lupus urlsindexcom'

distance = 184
spam score = 25
title = 'sinus infection urlsindexcom'

distance = 185
spam score = 24
title = 'cataract urlsindexcom'

distance = 185
spam score = 24
title = 'anthrax urlsindexcom'

distance = 203
spam score = 24
title = 'whooping cough urlsindexcom'

distance = 203
spam score = 25
title = 'infertility urlsindexcom'

distance = 204
spam score = 22
title = 'supercomputing and parallel computing urlsindexcom'

distance = 204
spam score = 16
title = 'contests surveys and polls urlsindexcom'

distance = 204
spam score = 21
title = 'chats and forums urlsindexcom'

distance = 204
spam score = 24
title = 'pleurisy pleuritis urlsindexcom'

distance = 204
spam score = 25
title = 'staph infection urlsindexcom'

distance = 204
spam score = 23
title = 'tuberous sclerosis urlsindexcom'

distance = 204
spam score = 23
title = 'high cholesterol urlsindexcom'

distance = 205
spam score = 23
title = 'mononucleosis urlsindexcom'

distance = 228
spam score = 23
title = 'thoracic outlet syndrome urlsindexcom'

distance = 228
spam score = 25
title = 'apert syndrome urlsindexcom'

distance = 228
spam score = 24
title = 'parkinsons disease urlsindexcom'

distance = 229
spam score = 22
title = 'r urlslistcom'

distance = 229
spam score = 23
title = 'celiac disease urlsindexcom'

distance = 229
spam score = 23
title = 'skin cancer urlsindexcom'

distance = 229
spam score = 21
title = 'cooking urlsindexcom'

distance = 229
spam score = 25
title = 'aspergers syndrome urlsindexcom'

distance = 229
spam score = 25
title = 'mood disorders urlsindexcom'

distance = 229
spam score = 22
title = 'deafblindness urlsindexcom'

distance = 257
spam score = 23
title = 'narcolepsy urlsindexcom'

distance = 258
spam score = 25
title = 'kleinelevin syndrome urlsindexcom'

distance = 258
spam score = 25
title = 'twin to twin transfusion syndrome urlsindexcom'

distance = 258
spam score = 26
title = 'twin to twin transfusion syndrome urlsindexcom'

distance = 258
spam score = 18
title = 'herbs roots and seeds urlsindexcom'

distance = 259
spam score = 23
title = 'vitamin a deficiency vad urlsindexcom'

distance = 260
spam score = 25
title = 'mental health disorders urlsindexcom'

distance = 260
spam score = 17
title = 'calendars urlsindexcom'

distance = 260
spam score = 22
title = 'oral cancer urlsindexcom'

distance = 261
spam score = 24
title = 'chronic fatigue syndrome urlsindexcom'

distance = 312
spam score = 20
title = 'marketing and advertising chooseindexcom'

distance = 313
spam score = 17
title = 'fighting choosedirectorycom'

distance = 313
spam score = 24
title = 'newborn jaundice urlsindexcom'

distance = 314
spam score = 23
title = 'legg calve perthes disease urlsindexcom'

distance = 314
spam score = 18
title = 'booksellers starryindexcom'

distance = 315
spam score = 22
title = 'muscle dysmorphia urlsindexcom'

distance = 316
spam score = 18
title = 'community bands morganitecatalogcom'

distance = 317
spam score = 25
title = 'dissociative identity disorder urlsindexcom'

distance = 318
spam score = 22
title = 'nursing groupurlscom'

distance = 318
spam score = 23
title = 'myasthenia gravis urlsindexcom'

distance = 404
spam score = 18
title = 'plates starryindexcom'

distance = 404
spam score = 18
title = 'crafts starryindexcom'

distance = 404
spam score = 25
title = 'couvade syndrome sympathetic pregnancy urlsindexcom'

distance = 404
spam score = 14
title = 'diseases and conditions groupurlscom'

distance = 405
spam score = 24
title = 'charcotmarietooth disease cmt urlsindexcom'

distance = 405
spam score = 10
title = 'coupons growdirectorycom'

distance = 406
spam score = 19
title = 'pins starryindexcom'

distance = 409
spam score = 13
title = 'outdoors growdirectorycom'

distance = 411
spam score = 19
title = 'photography growdirectorycom'

distance = 412
spam score = 19
title = 'snowglobes starryindexcom'

distance = 1849
spam score = 18
title = 'terrorizer jaarlijst 1997'

distance = 1863
spam score = 19
title = 'nsw vs sa'

distance = 0
spam score = 48
title = ''

distance = 110
spam score = 47
title = ''

distance = 110
spam score = 46
title = ''

distance = 110
spam score = 46
title = ''

distance = 110
spam score = 47
title = ''

distance = 110
spam score = 46
title = ''

distance = 110
spam score = 46
title = ''

distance = 110
spam score = 46
title = ''

distance = 110
spam score = 46
title = ''

distance = 110
spam score = 47
title = ''

distance = 110
spam score = 46
title = ''

distance = 110
spam score = 46
title = ''

distance = 1510
spam score = 50
title = ''

distance = 73
spam score = 17
title = 'by company starryindexcom'

distance = 99
spam score = 19
title = 'publishing starryindexcom'

distance = 100
spam score = 18
title = 'sports starryindexcom'

distance = 102
spam score = 18
title = 'transportation starryindexcom'

distance = 102
spam score = 17
title = 'design starryindexcom'

distance = 103
spam score = 21
title = 'education starryindexcom'

distance = 104
spam score = 18
title = 'history starryindexcom'

distance = 105
spam score = 22
title = 'construction starryindexcom'

distance = 105
spam score = 19
title = 'organizations starryindexcom'

distance = 106
spam score = 17
title = 'weather starryindexcom'

distance = 107
spam score = 19
title = 'news and media starryindexcom'

distance = 107
spam score = 17
title = 'exchanges starryindexcom'

distance = 107
spam score = 16
title = 'information starryindexcom'

distance = 108
spam score = 16
title = 'interviewing starryindexcom'

distance = 109
spam score = 18
title = 'banking starryindexcom'

distance = 109
spam score = 20
title = 'unions starryindexcom'

distance = 109
spam score = 17
title = 'institutes starryindexcom'

distance = 109
spam score = 17
title = 'institutes starryindexcom'

distance = 110
spam score = 18
title = 'development starryindexcom'

distance = 110
spam score = 19
title = 'manufacturing starryindexcom'

distance = 171
spam score = 16
title = 'people starryindexcom'

distance = 171
spam score = 14
title = 'accounting starryindexcom'

distance = 171
spam score = 17
title = 'taxes starryindexcom'

distance = 172
spam score = 17
title = 'corporate philanthropy starryindexcom'

distance = 172
spam score = 18
title = 'publications starryindexcom'

distance = 172
spam score = 15
title = 'aviation starryindexcom'

distance = 172
spam score = 19
title = 'toys starryindexcom'

distance = 172
spam score = 15
title = 'cardiovascular starryindexcom'

distance = 173
spam score = 16
title = 'accounting and auditing starryindexcom'

distance = 173
spam score = 12
title = 'financing starryindexcom'

distance = 195
spam score = 17
title = 'business schools starryindexcom'

distance = 195
spam score = 14
title = 'emergency services starryindexcom'

distance = 195
spam score = 18
title = 'professional organizations starryindexcom'

distance = 196
spam score = 17
title = 'business plans starryindexcom'

distance = 196
spam score = 17
title = 'traffic and road conditions starryindexcom'

distance = 196
spam score = 2
title = 'financial services starryindexcom'

distance = 196
spam score = 16
title = 'commuting starryindexcom'

distance = 196
spam score = 10
title = 'signage starryindexcom'

distance = 196
spam score = 17
title = 'whistleblowing starryindexcom'

distance = 196
spam score = 18
title = 'events starryindexcom'

distance = 224
spam score = 8
title = 'appraisal services starryindexcom'

distance = 224
spam score = 24
title = 'hypotension starryindexcom'

distance = 224
spam score = 18
title = 'united states starryindexcom'

distance = 224
spam score = 17
title = 'religious supplies and services starryindexcom'

distance = 225
spam score = 23
title = 'registries starryindexcom'

distance = 225
spam score = 16
title = 'personal care starryindexcom'

distance = 225
spam score = 18
title = 'technical analysis starryindexcom'

distance = 226
spam score = 15
title = 'statistics starryindexcom'

distance = 226
spam score = 19
title = 'economic development starryindexcom'

distance = 226
spam score = 16
title = 'real estate starryindexcom'

distance = 259
spam score = 16
title = 'statistics and indicators starryindexcom'

distance = 259
spam score = 21
title = 'consumer economy starryindexcom'

distance = 259
spam score = 21
title = 'mumps starryindexcom'

distance = 260
spam score = 23
title = 'heart disease starryindexcom'

distance = 260
spam score = 23
title = 'glomerulonephritis starryindexcom'

distance = 260
spam score = 19
title = 'reference and guides starryindexcom'

distance = 260
spam score = 23
title = 'costochondritis starryindexcom'

distance = 261
spam score = 22
title = 'flatulence starryindexcom'

distance = 261
spam score = 16
title = 'wound care starryindexcom'

distance = 261
spam score = 22
title = 'emphysema starryindexcom'

distance = 289
spam score = 22
title = 'bedsores starryindexcom'

distance = 289
spam score = 23
title = 'urinary incontinence starryindexcom'

distance = 289
spam score = 22
title = 'dry eyes starryindexcom'

distance = 290
spam score = 23
title = 'genetic disorders starryindexcom'

distance = 290
spam score = 24
title = 'organizations starryindexcom'

distance = 290
spam score = 24
title = 'shwachman syndrome starryindexcom'

distance = 291
spam score = 22
title = 'hypochondria starryindexcom'

distance = 291
spam score = 23
title = 'leishmaniasis starryindexcom'

distance = 291
spam score = 23
title = 'aphasia starryindexcom'

distance = 292
spam score = 24
title = 'staph infection starryindexcom'

distance = 316
spam score = 23
title = 'measles starryindexcom'

distance = 316
spam score = 22
title = 'respiratory diseases starryindexcom'

distance = 316
spam score = 22
title = 'gastrointestinal diseases starryindexcom'

distance = 316
spam score = 17
title = 'yoga starryindexcom'

distance = 316
spam score = 22
title = 'craniofacial anomalies starryindexcom'

distance = 316
spam score = 23
title = 'epilepsy starryindexcom'

distance = 316
spam score = 23
title = 'cerebral palsy starryindexcom'

distance = 316
spam score = 22
title = 'colon cancer starryindexcom'

distance = 317
spam score = 22
title = 'brain injury starryindexcom'

distance = 317
spam score = 15
title = 'booksellers starryindexcom'

distance = 350
spam score = 24
title = 'pigmented villonodular synovitis starryindexcom'

distance = 350
spam score = 24
title = 'parry romberg syndrome starryindexcom'

distance = 351
spam score = 22
title = 'jock itch starryindexcom'

distance = 352
spam score = 22
title = 'mastocytosis starryindexcom'

distance = 352
spam score = 22
title = 'jaundice starryindexcom'

distance = 353
spam score = 11
title = 'safety and security starryindexcom'

distance = 354
spam score = 22
title = 'kidney infection starryindexcom'

distance = 354
spam score = 22
title = 'cyclothymic disorder starryindexcom'

distance = 355
spam score = 24
title = 'alcoholism starryindexcom'

distance = 356
spam score = 23
title = 'amebiasis starryindexcom'

distance = 415
spam score = 11
title = 'pools spas and hot tubs starryindexcom'

distance = 415
spam score = 25
title = 'west nile virus infection starryindexcom'

distance = 416
spam score = 25
title = 'thrombocytopenia absent radius tar syndrome starryindexcom'

distance = 416
spam score = 23
title = 'ehlersdanlos syndrome starryindexcom'

distance = 418
spam score = 24
title = 'alzheimers disease starryindexcom'

distance = 420
spam score = 22
title = 'nephrogenic diabetes insipidus starryindexcom'

distance = 421
spam score = 23
title = 'cornelia de lange syndrome starryindexcom'

distance = 422
spam score = 24
title = 'lymphagioleiomyomatosis lam starryindexcom'

distance = 425
spam score = 24
title = 'polycystic ovarian syndrome pcos starryindexcom'

distance = 426
spam score = 22
title = 'fibrodysplasia ossificans progressiva starryindexcom'

distance = 1
spam score = 47
title = ''

distance = 1
spam score = 47
title = ''

distance = 1
spam score = 46
title = ''

distance = 1
spam score = 46
title = ''

distance = 1
spam score = 46
title = ''

distance = 1
spam score = 45
title = ''

distance = 1
spam score = 47
title = ''

distance = 1
spam score = 47
title = ''

distance = 1
spam score = 46
title = ''

distance = 1
spam score = 47
title = ''

distance = 1
spam score = 46
title = ''

distance = 52
spam score = 48
title = ''

distance = 103
spam score = 44
title = ''

distance = 125
spam score = 45
title = ''

distance = 133
spam score = 46
title = ''

distance = 162
spam score = 48
title = ''

distance = 168
spam score = 47
title = ''

distance = 196
spam score = 46
title = ''

distance = 225
spam score = 43
title = ''

distance = 234
spam score = 44
title = ''

distance = 268
spam score = 43
title = ''

distance = 288
spam score = 41
title = ''

distance = 311
spam score = 42
title = ''

distance = 378
spam score = 50
title = ''

distance = 380
spam score = 47
title = ''

distance = 469
spam score = 45
title = ''

distance = 882
spam score = 49
title = ''

distance = 1873
spam score = 60
title = ''

distance = 0
spam score = 17
title = 'r excellentcatalogcom'

distance = 0
spam score = 17
title = 'q excellentcatalogcom'

distance = 36
spam score = 13
title = 'sporting goods excellentcatalogcom'

distance = 45
spam score = 14
title = 'rugby excellentcatalogcom'

distance = 45
spam score = 17
title = 'science excellentcatalogcom'

distance = 47
spam score = 14
title = 'rowing excellentcatalogcom'

distance = 47
spam score = 16
title = 'contests excellentcatalogcom'

distance = 47
spam score = 14
title = 'orienteering excellentcatalogcom'

distance = 47
spam score = 16
title = 'collectibles excellentcatalogcom'

distance = 48
spam score = 14
title = 'boxing excellentcatalogcom'

distance = 49
spam score = 15
title = 'movies excellentcatalogcom'

distance = 49
spam score = 18
title = 'x excellentcatalogcom'

distance = 49
spam score = 18
title = 'n excellentcatalogcom'

distance = 49
spam score = 18
title = 'y excellentcatalogcom'

distance = 50
spam score = 16
title = 'schedules excellentcatalogcom'

distance = 52
spam score = 18
title = 'v excellentcatalogcom'

distance = 52
spam score = 18
title = 'w excellentcatalogcom'

distance = 52
spam score = 17
title = 'u excellentcatalogcom'

distance = 52
spam score = 14
title = 'skiing excellentcatalogcom'

distance = 53
spam score = 9
title = 'hockey excellentcatalogcom'

distance = 84
spam score = 16
title = 'tchoukball excellentcatalogcom'

distance = 86
spam score = 15
title = 'trade magazines excellentcatalogcom'

distance = 89
spam score = 17
title = 'mountainboarding excellentcatalogcom'

distance = 89
spam score = 14
title = 'paddleball excellentcatalogcom'

distance = 90
spam score = 16
title = 'tugofwar excellentcatalogcom'

distance = 91
spam score = 15
title = 'motorcycle racing excellentcatalogcom'

distance = 92
spam score = 14
title = 'finance and investment excellentcatalogcom'

distance = 92
spam score = 14
title = 'real estate excellentcatalogcom'

distance = 94
spam score = 14
title = 'football excellentcatalogcom'

distance = 94
spam score = 16
title = 'running excellentcatalogcom'

distance = 103
spam score = 14
title = 'swimming and diving excellentcatalogcom'

distance = 104
spam score = 17
title = 'organizations excellentcatalogcom'

distance = 104
spam score = 13
title = 'table tennis excellentcatalogcom'

distance = 108
spam score = 14
title = 'hunting excellentcatalogcom'

distance = 108
spam score = 14
title = 'institutes excellentcatalogcom'

distance = 108
spam score = 13
title = 'basketball excellentcatalogcom'

distance = 109
spam score = 16
title = 'skeleton excellentcatalogcom'

distance = 110
spam score = 14
title = 'paddling excellentcatalogcom'

distance = 111
spam score = 17
title = 'inventions excellentcatalogcom'

distance = 112
spam score = 13
title = 'sailing excellentcatalogcom'

distance = 127
spam score = 14
title = 'kickball excellentcatalogcom'

distance = 127
spam score = 15
title = 'olympic games excellentcatalogcom'

distance = 127
spam score = 14
title = 'badminton excellentcatalogcom'

distance = 128
spam score = 13
title = 'memorabilia excellentcatalogcom'

distance = 128
spam score = 13
title = 'surfing excellentcatalogcom'

distance = 128
spam score = 18
title = 'organizations excellentcatalogcom'

distance = 129
spam score = 16
title = 'windsurfing excellentcatalogcom'

distance = 129
spam score = 15
title = 'consumer economy excellentcatalogcom'

distance = 130
spam score = 13
title = 'buzkashi excellentcatalogcom'

distance = 130
spam score = 13
title = 'water sports excellentcatalogcom'

distance = 143
spam score = 16
title = 'track and field excellentcatalogcom'

distance = 143
spam score = 14
title = 'macrobiotics excellentcatalogcom'

distance = 144
spam score = 16
title = 'squash excellentcatalogcom'

distance = 144
spam score = 14
title = 'calories excellentcatalogcom'

distance = 145
spam score = 13
title = 'water polo excellentcatalogcom'

distance = 148
spam score = 14
title = 'triathlon excellentcatalogcom'

distance = 148
spam score = 14
title = 'volleyball excellentcatalogcom'

distance = 148
spam score = 16
title = 'web directories excellentcatalogcom'

distance = 150
spam score = 15
title = 'mountainboarding excellentcatalogcom'

distance = 150
spam score = 16
title = 'sepak takraw excellentcatalogcom'

distance = 165
spam score = 14
title = 'skating excellentcatalogcom'

distance = 166
spam score = 13
title = 'softball excellentcatalogcom'

distance = 166
spam score = 16
title = 'polo excellentcatalogcom'

distance = 166
spam score = 16
title = 'snowboarding excellentcatalogcom'

distance = 167
spam score = 14
title = 'nutrition labels excellentcatalogcom'

distance = 167
spam score = 15
title = 'web directories excellentcatalogcom'

distance = 168
spam score = 14
title = 'curling excellentcatalogcom'

distance = 168
spam score = 17
title = 'stadiums and venues excellentcatalogcom'

distance = 168
spam score = 15
title = 'softball excellentcatalogcom'

distance = 168
spam score = 14
title = 'handball excellentcatalogcom'

distance = 187
spam score = 14
title = 'korfball excellentcatalogcom'

distance = 188
spam score = 16
title = 'rounders excellentcatalogcom'

distance = 188
spam score = 16
title = 'rowing excellentcatalogcom'

distance = 188
spam score = 14
title = 'employment excellentcatalogcom'

distance = 189
spam score = 14
title = 'equestrian excellentcatalogcom'

distance = 190
spam score = 14
title = 'dogsledding excellentcatalogcom'

distance = 192
spam score = 13
title = 'netball excellentcatalogcom'

distance = 194
spam score = 16
title = 'racewalking excellentcatalogcom'

distance = 198
spam score = 15
title = 'rodeo excellentcatalogcom'

distance = 200
spam score = 13
title = 'first aid excellentcatalogcom'

distance = 240
spam score = 13
title = 'audiology excellentcatalogcom'

distance = 243
spam score = 15
title = 'ask an expert excellentcatalogcom'

distance = 245
spam score = 14
title = 'archery excellentcatalogcom'

distance = 246
spam score = 12
title = 'outdoors excellentcatalogcom'

distance = 258
spam score = 14
title = 'publishers excellentcatalogcom'

distance = 261
spam score = 13
title = 'emergency and safety excellentcatalogcom'

distance = 263
spam score = 16
title = 'diseases and conditions excellentcatalogcom'

distance = 267
spam score = 13
title = 'drug testing excellentcatalogcom'

distance = 267
spam score = 12
title = 'back and spine excellentcatalogcom'

distance = 267
spam score = 14
title = 'male pattern hair loss excellentcatalogcom'

distance = 337
spam score = 12
title = 'home test kits excellentcatalogcom'

distance = 349
spam score = 10
title = 'medical equipment excellentcatalogcom'

distance = 357
spam score = 13
title = 'medical alert jewelry excellentcatalogcom'

distance = 361
spam score = 12
title = 'medical law excellentcatalogcom'

distance = 384
spam score = 12
title = 'commercial and summer camps excellentcatalogcom'

distance = 391
spam score = 13
title = 'ear nose and throat excellentcatalogcom'

distance = 400
spam score = 12
title = 'umbilical cord blood storage excellentcatalogcom'

distance = 786
spam score = 13
title = 'a excellentcatalogcom'

distance = 789
spam score = 13
title = 'o excellentcatalogcom'

distance = 810
spam score = 14
title = 'l excellentcatalogcom'

distance = 1802
spam score = 37
title = 'results for nrha 7180'

distance = 1834
spam score = 30
title = ''

distance = 44
spam score = 46
title = ''

distance = 44
spam score = 45
title = ''

distance = 44
spam score = 46
title = ''

distance = 44
spam score = 45
title = ''

distance = 44
spam score = 45
title = ''

distance = 44
spam score = 45
title = ''

distance = 44
spam score = 45
title = ''

distance = 44
spam score = 45
title = ''

distance = 44
spam score = 46
title = ''

distance = 44
spam score = 45
title = ''

distance = 44
spam score = 45
title = ''

distance = 44
spam score = 46
title = ''

distance = 44
spam score = 44
title = ''

distance = 44
spam score = 45
title = ''

distance = 57
spam score = 41
title = ''

distance = 57
spam score = 43
title = ''

distance = 57
spam score = 44
title = ''

distance = 57
spam score = 44
title = ''

distance = 57
spam score = 43
title = ''

distance = 57
spam score = 44
title = ''

distance = 57
spam score = 43
title = ''

distance = 57
spam score = 43
title = ''

distance = 57
spam score = 44
title = ''

distance = 57
spam score = 43
title = ''

distance = 57
spam score = 45
title = ''

distance = 57
spam score = 44
title = ''

distance = 57
spam score = 45
title = ''

distance = 57
spam score = 43
title = ''

distance = 57
spam score = 42
title = ''

distance = 114
spam score = 40
title = ''

distance = 114
spam score = 41
title = ''

distance = 114
spam score = 39
title = ''

distance = 114
spam score = 39
title = ''

distance = 114
spam score = 39
title = ''

distance = 114
spam score = 40
title = ''

distance = 114
spam score = 40
title = ''

distance = 114
spam score = 40
title = ''

distance = 114
spam score = 40
title = ''

distance = 114
spam score = 41
title = ''

distance = 114
spam score = 41
title = ''

distance = 116
spam score = 43
title = ''

distance = 116
spam score = 45
title = ''

distance = 116
spam score = 46
title = ''

distance = 116
spam score = 42
title = ''

distance = 116
spam score = 45
title = ''

distance = 116
spam score = 44
title = ''

distance = 116
spam score = 46
title = ''

distance = 116
spam score = 44
title = ''

distance = 116
spam score = 44
title = ''

distance = 116
spam score = 45
title = ''

distance = 116
spam score = 45
title = ''

distance = 121
spam score = 48
title = ''

distance = 121
spam score = 47
title = ''

distance = 131
spam score = 44
title = ''

distance = 131
spam score = 44
title = ''

distance = 174
spam score = 50
title = ''

distance = 174
spam score = 49
title = ''

distance = 174
spam score = 49
title = ''

distance = 174
spam score = 50
title = ''

distance = 174
spam score = 49
title = ''

distance = 174
spam score = 49
title = ''

distance = 174
spam score = 49
title = ''

distance = 185
spam score = 50
title = ''

distance = 466
spam score = 44
title = ''

distance = 509
spam score = 39
title = ''

distance = 561
spam score = 53
title = ''

distance = 589
spam score = 49
title = ''

distance = 589
spam score = 50
title = ''

distance = 589
spam score = 52
title = ''

distance = 589
spam score = 49
title = ''

distance = 589
spam score = 51
title = ''

distance = 589
spam score = 50
title = ''

distance = 589
spam score = 52
title = ''

distance = 589
spam score = 51
title = ''

distance = 589
spam score = 51
title = ''

distance = 589
spam score = 51
title = ''

distance = 589
spam score = 51
title = ''

distance = 638
spam score = 45
title = ''

distance = 639
spam score = 47
title = ''

distance = 639
spam score = 47
title = ''

distance = 753
spam score = 41
title = ''

distance = 755
spam score = 42
title = ''

distance = 795
spam score = 45
title = ''

distance = 871
spam score = 43
title = ''

distance = 890
spam score = 53
title = ''

distance = 949
spam score = 50
title = ''

distance = 1178
spam score = 59
title = ''

distance = 1178
spam score = 58
title = ''

distance = 1191
spam score = 55
title = ''

distance = 1670
spam score = 48
title = ''

distance = 187
spam score = 37
title = ''

distance = 187
spam score = 37
title = ''

distance = 275
spam score = 58
title = ''

distance = 277
spam score = 54
title = ''

distance = 308
spam score = 56
title = ''

distance = 326
spam score = 56
title = ''

distance = 423
spam score = 51
title = ''

distance = 476
spam score = 59
title = ''

distance = 577
spam score = 58
title = ''

distance = 898
spam score = 50
title = ''

distance = 221
spam score = 21
title = 'new york adirondacks 2 adk78 trillium adirondack preserve hardie truesdale fine art photography'

distance = 227
spam score = 22
title = 'new york catskills 1 cks73 vernooykill catskill preserve hardie truesdale fine art photography'

distance = 229
spam score = 22
title = 'new york adirondacks 4 adk146 wallface adirondack preserve hardie truesdale fine art photography'

distance = 271
spam score = 22
title = 'new york adirondacks 4 adk160 ampersand lake adirondack preserve hardie truesdale fine art photography'

distance = 271
spam score = 22
title = 'new york adirondacks 2 adk82 rainbow falls adirondack preserve hardie truesdale fine art photography'

distance = 271
spam score = 22
title = 'new york adirondacks 2 adk74 rainbow falls adirondack preserve hardie truesdale fine art photography'

distance = 273
spam score = 22
title = 'new york catskills 1 cks181 blackhead mountain catskill preserve hardie truesdale fine art photography'

distance = 275
spam score = 22
title = 'new york adirondacks 4 adk127 colden on ice adirondack preserve hardie truesdale fine art photography'

distance = 278
spam score = 21
title = 'new york catskills 1 cks191 wittenberg views catskill preserve hardie truesdale fine art photography'

distance = 279
spam score = 21
title = 'new york adirondacks 2 adk55 sunrise from cascade adirondack preserve hardie truesdale fine art photography'

distance = 281
spam score = 22
title = 'new york adirondacks 2 adk84 spring patterns adirondack preserve hardie truesdale fine art photography'

distance = 282
spam score = 22
title = 'new york adirondacks 2 adk73 owls head adirondack preserve hardie truesdale fine art photography'

distance = 282
spam score = 21
title = 'new york adirondacks 2 adk58 cascade summit adirondack preserve hardie truesdale fine art photography'

distance = 285
spam score = 23
title = 'new york adirondacks 4 adk144 indian pass trail adirondack preserve hardie truesdale fine art photography'

distance = 285
spam score = 21
title = 'new york adirondacks 2 adk76 mossed trees adirondack preserve hardie truesdale fine art photography'

distance = 286
spam score = 23
title = 'new york adirondacks 4 adk159 saranac lakes adirondack preserve hardie truesdale fine art photography'

distance = 286
spam score = 22
title = 'new york adirondacks 4 adk164 chapel pond adirondack preserve hardie truesdale fine art photography'

distance = 286
spam score = 21
title = 'new york adirondacks 2 adk89 chapel pond adirondack preserve hardie truesdale fine art photography'

distance = 288
spam score = 23
title = 'new york nyc nyc71 times square hardie truesdale fine art photography'

distance = 293
spam score = 22
title = 'new york adirondacks 2 adk54 lake placid adirondack preserve hardie truesdale fine art photography'

distance = 321
spam score = 22
title = 'new york adirondacks 2 adk80 lower ausable lake adirondack preserve hardie truesdale fine art photography'

distance = 327
spam score = 21
title = 'new york skytop gks629 pretty in pink hardie truesdale fine art photography'

distance = 328
spam score = 22
title = 'new york adirondacks 4 adk132 lake tear of the clouds adirondack preserve hardie truesdale fine art photography'

distance = 328
spam score = 21
title = 'new york skytop gks670 ferris farm skytop hardie truesdale fine art photography'

distance = 329
spam score = 21
title = 'new york adirondacks 2 adk91 upper cascade lake adirondack preserve hardie truesdale fine art photography'

distance = 332
spam score = 23
title = 'new york catskills 1 cks170 fall ridge patterns catskill preserve hardie truesdale fine art photography'

distance = 333
spam score = 22
title = 'new york adirondacks 4 adk180 lower saranac lake adirondack preserve hardie truesdale fine art photography'

distance = 333
spam score = 21
title = 'new york catskills 1 cks173 wittenberg views fall catskill preserve hardie truesdale fine art photography'

distance = 333
spam score = 21
title = 'new york catskills 1 cks150 vromans nose views catskill preserve hardie truesdale fine art photography'

distance = 334
spam score = 21
title = 'new york skytop gks582 divided fields and skytop hardie truesdale fine art photography'

distance = 343
spam score = 23
title = 'new york catskills 1 cks158 slide mountain summit catskill preserve hardie truesdale fine art photography'

distance = 343
spam score = 20
title = 'new york skytop gks678 bare tree skytop hardie truesdale fine art photography'

distance = 344
spam score = 20
title = 'new york mohonk preserve winter gks18 blizzard yellow wall hardie truesdale fine art photography'

distance = 345
spam score = 21
title = 'new york adirondacks 3 adk101 sunrise mountain adirondack preserve hardie truesdale fine art photography'

distance = 346
spam score = 21
title = 'new york skytop gks483 summer haze skytop hardie truesdale fine art photography'

distance = 347
spam score = 19
title = 'new york adirondacks 3 adk123 sentinel range adirondack preserve hardie truesdale fine art photography'

distance = 351
spam score = 20
title = 'new york minnewaska state park 2 gks479 blue minnewaska hardie truesdale fine art photography'

distance = 352
spam score = 15
title = 'new york catskills 2 cks227 fallen boulders catskill preserve hardie truesdale fine art photography'

distance = 355
spam score = 19
title = 'new york adirondacks 3 adk94 giants washbowl adirondack preserve hardie truesdale fine art photography'

distance = 355
spam score = 20
title = 'new york adirondacks 3 adk113 lake colden adirondack preserve hardie truesdale fine art photography'

distance = 373
spam score = 20
title = 'new york skytop gks687 lingering mist skytop hardie truesdale fine art photography'

distance = 373
spam score = 16
title = 'new york catskills 2 cks216 bare ridgelines catskill preserve hardie truesdale fine art photography'

distance = 383
spam score = 21
title = 'new york mohonk preserve winter gks662 frozen carriageway hardie truesdale fine art photography'

distance = 384
spam score = 17
title = 'new york adirondacks 4 adk135 lake harris adirondack preserve hardie truesdale fine art photography'

distance = 387
spam score = 19
title = 'new york adirondacks 3 adk158 blue mountain lake adirondack preserve hardie truesdale fine art photography'

distance = 394
spam score = 20
title = 'new york adirondacks 3 adk121 second pond sunrise adirondack preserve hardie truesdale fine art photography'

distance = 395
spam score = 22
title = 'new york nyc nyc26 columbus fountain manhatten hardie truesdale fine art photography'

distance = 398
spam score = 20
title = 'new york adirondacks 3 adk163 owens pond trail adirondack preserve hardie truesdale fine art photography'

distance = 402
spam score = 21
title = 'new york catskills 1 cks28 winter waterfall platte clove preserve hardie truesdale fine art photography'

distance = 406
spam score = 19
title = 'new york adirondacks 3 adk115 barnstorm keene valley adirondack preserve hardie truesdale fine art photography'

distance = 418
spam score = 22
title = 'new york adirondacks 4 adk181 lily pads saranac river adirondack preserve hardie truesdale fine art photography'

distance = 418
spam score = 16
title = 'new york adirondacks 1 adk1 indian lake sunrise adirondack preserve hardie truesdale fine art photography'

distance = 420
spam score = 21
title = 'new york mohonk preserve winter gks377 pine hill ravine hardie truesdale fine art photography'

distance = 420
spam score = 19
title = 'new york mohonk preserve winter gks175 near trapps winter storm hardie truesdale fine art photography'

distance = 420
spam score = 19
title = 'new york adirondacks 3 adk111 big slide creek adirondack preserve hardie truesdale fine art photography'

distance = 421
spam score = 22
title = 'new york minnewaska state park 1 gks314 lichfield fall hardie truesdale fine art photography'

distance = 425
spam score = 20
title = 'new york minnewaska state park 2 gks639 awosting falls hardie truesdale fine art photography'

distance = 427
spam score = 21
title = 'new york mohonk preserve springsummer gks580 millbrook talus hardie truesdale fine art photography'

distance = 427
spam score = 20
title = 'new york skytop gks686 slow burning mist skytop hardie truesdale fine art photography'

distance = 427
spam score = 21
title = 'new york minnewaska state park 2 gks477 gertrudes nose hardie truesdale fine art photography'

distance = 440
spam score = 14
title = 'new york skytop gks646 long shadows hardie truesdale fine art photography'

distance = 442
spam score = 21
title = 'new york mohonk preserve winter gks141 eagle cliff ice storm hardie truesdale fine art photography'

distance = 442
spam score = 21
title = 'new york minnewaska state park 2 gks611 over the falls awosting falls hardie truesdale fine art photography'

distance = 442
spam score = 20
title = 'new york minnewaska state park 2 gks565 fall awosting falls hardie truesdale fine art photography'

distance = 445
spam score = 21
title = 'new york minnewaska state park 1 gks443 frozen awosting hardie truesdale fine art photography'

distance = 448
spam score = 22
title = 'new york mohonk preserve springsummer gks677 zadies bower hardie truesdale fine art photography'

distance = 449
spam score = 20
title = 'new york adirondacks 3 adk118 high falls gorge adirondacks hardie truesdale fine art photography'

distance = 451
spam score = 20
title = 'new york hudson highlands hr131 storm king from breakneck hardie truesdale fine art photography'

distance = 453
spam score = 23
title = 'new york nyc nyc69 christmas lights tavern on the green hardie truesdale fine art photography'

distance = 453
spam score = 23
title = 'new york nyc nyc70 christmas lights tavern on the green hardie truesdale fine art photography'

distance = 464
spam score = 21
title = 'new york mohonk preserve winter gks455 sunburst and ice laden tree hardie truesdale fine art photography'

distance = 464
spam score = 21
title = 'new york minnewaska state park 1 gks94 misty fall woods hardie truesdale fine art photography'

distance = 464
spam score = 22
title = 'new york mohonk preserve winter gks2 green talus trapps cliff hardie truesdale fine art photography'

distance = 464
spam score = 23
title = 'new york minnewaska state park 1 gks376 ice floes peterskill hardie truesdale fine art photography'

distance = 465
spam score = 22
title = 'new york mohonk preserve winter gks592 pinnacle path winter snowfall hardie truesdale fine art photography'

distance = 471
spam score = 22
title = 'new york mohonk preserve winter gks635 fresh snow sunshine lost city hardie truesdale fine art photography'

distance = 474
spam score = 19
title = 'new york nyc hr21 hudson river nyc skyline before 911 hardie truesdale fine art photography'

distance = 476
spam score = 21
title = 'new york minnewaska state park 2 gks529 dickie barre cliffs hardie truesdale fine art photography'

distance = 479
spam score = 22
title = 'new york minnewaska state park 1 gks238 lake awosting fall hardie truesdale fine art photography'

distance = 481
spam score = 22
title = 'new york mohonk preserve springsummer gks671 laurel and trapps mist hardie truesdale fine art photography'

distance = 489
spam score = 21
title = 'new york mohonk preserve winter gks604 bent tree skytop talus hardie truesdale fine art photography'

distance = 495
spam score = 21
title = 'new york mohonk preserve springsummer gks534 mountain laurel bonticou hardie truesdale fine art photography'

distance = 495
spam score = 17
title = 'new york nyc nyc39 statue of liberty national monument hardie truesdale fine art photography'

distance = 498
spam score = 22
title = 'new york minnewaska state park 2 gks642 pinnacles palmaghatt ravine hardie truesdale fine art photography'

distance = 508
spam score = 22
title = 'new york hudson highlands hr94 breakneck views hudson highlands state park hardie truesdale fine art photography'

distance = 508
spam score = 21
title = 'new york hudson highlands hr96 breakneck views hudson highlands state park hardie truesdale fine art photography'

distance = 513
spam score = 18
title = 'new york southeastern ny sny6 early snowfall neversink preserve hardie truesdale fine art photography'

distance = 514
spam score = 22
title = 'new york mohonk preserve winter gks525 lunch table rock undercliff road hardie truesdale fine art photography'

distance = 522
spam score = 22
title = 'new york minnewaska state park 1 gks87 dancing birch lichfield ledges hardie truesdale fine art photography'

distance = 526
spam score = 22
title = 'new york minnewaska state park 2 gks564 fall carriageway sunset path hardie truesdale fine art photography'

distance = 539
spam score = 22
title = 'new york hudson highlands hr133 arden valley harriman state park hardie truesdale fine art photography'

distance = 541
spam score = 19
title = 'new york minnewaska state park 2 gks654 beam me up scotty awosting falls hardie truesdale fine art photography'

distance = 546
spam score = 21
title = 'new york hudson highlands hr203 lifting mist storm king mountain hardie truesdale fine art photography'

distance = 547
spam score = 22
title = 'new york mohonk preserve winter gks372 snow laden limbs and near trapps hardie truesdale fine art photography'

distance = 549
spam score = 22
title = 'new york hudson highlands hr143 bear mtn bridge hudson highlands state park hardie truesdale fine art photography'

distance = 549
spam score = 22
title = 'new york western ny wny24 sedimentary layers letchworth state park hardie truesdale fine art photography'

distance = 551
spam score = 22
title = 'new york minnewaska state park 1 gks269 hidden laurel gertrudes nose hardie truesdale fine art photography'

distance = 552
spam score = 16
title = 'new york minnewaska state park 1 gks162 misty fall huckleberries hardie truesdale fine art photography'

distance = 554
spam score = 21
title = 'new york mohonk preserve winter gks457 first light fresh snow near trapps hardie truesdale fine art photography'

distance = 554
spam score = 21
title = 'new york hudson highlands hr118 reeves meadow harriman state park hardie truesdale fine art photography'

distance = 578
spam score = 23
title = 'new york hudson highlands hr73 storm king breakneck ridge hudson river hardie truesdale fine art photography'

distance = 582
spam score = 25
title = 'new york western ny wny61 middle falls rainbow letchworth state park hardie truesdale fine art photography'

distance = 588
spam score = 16
title = 'new york mohonk preserve springsummer gks358 leaning tree undercliff road hardie truesdale fine art photography'

distance = 588
spam score = 17
title = 'new york minnewaska state park 2 gks681 balanced boulders old minnewaska road hardie truesdale fine art photography'

distance = 618
spam score = 20
title = 'new york minnewaska state park 2 gks685 lone pink laurel palmaghatt ravine hardie truesdale fine art photography'

distance = 657
spam score = 17
title = 'new york hudson highlands hr142 little stony point hudson highlands state park hardie truesdale fine art photography'

distance = 660
spam score = 17
title = 'new york hudson river 1 hr174 esopus sunset mills norrie state park hardie truesdale fine art photography'

distance = 1628
spam score = 98
title = 'inzones website design portfolio'

distance = 240
spam score = 46
title = 'gallery plan b'

distance = 241
spam score = 51
title = 'gallery plan b'

distance = 248
spam score = 49
title = 'gallery plan b'

distance = 249
spam score = 53
title = 'gallery plan b'

distance = 249
spam score = 52
title = 'gallery plan b'

distance = 251
spam score = 48
title = 'gallery plan b'

distance = 254
spam score = 47
title = 'gallery plan b'

distance = 255
spam score = 51
title = 'gallery plan b'

distance = 260
spam score = 49
title = 'gallery plan b'

distance = 260
spam score = 47
title = 'gallery plan b'

distance = 261
spam score = 46
title = 'gallery plan b'

distance = 263
spam score = 48
title = 'gallery plan b'

distance = 263
spam score = 48
title = 'gallery plan b'

distance = 263
spam score = 49
title = 'gallery plan b'

distance = 263
spam score = 49
title = 'gallery plan b'

distance = 263
spam score = 49
title = 'gallery plan b'

distance = 263
spam score = 49
title = 'gallery plan b'

distance = 263
spam score = 49
title = 'gallery plan b'

distance = 263
spam score = 49
title = 'gallery plan b'

distance = 263
spam score = 48
title = 'gallery plan b'

distance = 326
spam score = 48
title = 'gallery plan b'

distance = 327
spam score = 52
title = 'gallery plan b'

distance = 327
spam score = 48
title = 'gallery plan b'

distance = 329
spam score = 49
title = 'gallery plan b'

distance = 329
spam score = 50
title = 'gallery plan b'

distance = 330
spam score = 50
title = 'gallery plan b'

distance = 330
spam score = 50
title = 'gallery plan b'

distance = 330
spam score = 50
title = 'gallery plan b'

distance = 330
spam score = 50
title = 'gallery plan b'

distance = 330
spam score = 49
title = 'gallery plan b'

distance = 354
spam score = 52
title = 'gallery plan b'

distance = 354
spam score = 48
title = 'gallery plan b'

distance = 355
spam score = 52
title = 'gallery plan b'

distance = 355
spam score = 51
title = 'gallery plan b'

distance = 355
spam score = 52
title = 'gallery plan b'

distance = 355
spam score = 51
title = 'gallery plan b'

distance = 356
spam score = 51
title = 'gallery plan b'

distance = 356
spam score = 51
title = 'gallery plan b'

distance = 357
spam score = 54
title = 'gallery plan b'

distance = 358
spam score = 48
title = 'gallery plan b'

distance = 371
spam score = 46
title = 'gallery plan b'

distance = 371
spam score = 50
title = 'gallery plan b'

distance = 372
spam score = 47
title = 'gallery plan b'

distance = 373
spam score = 53
title = 'gallery plan b'

distance = 373
spam score = 48
title = 'gallery plan b'

distance = 373
spam score = 49
title = 'gallery plan b'

distance = 373
spam score = 47
title = 'gallery plan b'

distance = 373
spam score = 49
title = 'gallery plan b'

distance = 373
spam score = 49
title = 'gallery plan b'

distance = 373
spam score = 50
title = 'gallery plan b'

distance = 388
spam score = 51
title = 'gallery plan b'

distance = 388
spam score = 51
title = 'gallery plan b'

distance = 389
spam score = 49
title = 'gallery plan b'

distance = 389
spam score = 51
title = 'gallery plan b'

distance = 389
spam score = 52
title = 'gallery plan b'

distance = 390
spam score = 51
title = 'gallery plan b'

distance = 390
spam score = 50
title = 'gallery plan b'

distance = 390
spam score = 49
title = 'gallery plan b'

distance = 391
spam score = 48
title = 'gallery plan b'

distance = 391
spam score = 48
title = 'gallery plan b'

distance = 408
spam score = 52
title = 'gallery plan b'

distance = 408
spam score = 51
title = 'gallery plan b'

distance = 408
spam score = 45
title = 'gallery plan b'

distance = 408
spam score = 53
title = 'gallery plan b'

distance = 408
spam score = 51
title = 'gallery plan b'

distance = 408
spam score = 52
title = 'gallery plan b'

distance = 408
spam score = 51
title = 'gallery plan b'

distance = 409
spam score = 50
title = 'gallery plan b'

distance = 409
spam score = 50
title = 'gallery plan b'

distance = 410
spam score = 50
title = 'gallery plan b'

distance = 433
spam score = 51
title = 'gallery plan b'

distance = 433
spam score = 53
title = 'gallery plan b'

distance = 433
spam score = 49
title = 'gallery plan b'

distance = 433
spam score = 47
title = 'gallery plan b'

distance = 434
spam score = 48
title = 'gallery plan b'

distance = 434
spam score = 53
title = 'gallery plan b'

distance = 435
spam score = 51
title = 'gallery plan b'

distance = 435
spam score = 51
title = 'gallery plan b'

distance = 435
spam score = 48
title = 'gallery plan b'

distance = 435
spam score = 49
title = 'gallery plan b'

distance = 463
spam score = 53
title = 'gallery plan b'

distance = 463
spam score = 53
title = 'gallery plan b'

distance = 464
spam score = 49
title = 'gallery plan b'

distance = 465
spam score = 51
title = 'gallery plan b'

distance = 466
spam score = 46
title = 'gallery plan b'

distance = 467
spam score = 48
title = 'gallery plan b'

distance = 467
spam score = 55
title = 'gallery plan b'

distance = 468
spam score = 47
title = 'gallery plan b'

distance = 469
spam score = 53
title = 'gallery plan b'

distance = 469
spam score = 52
title = 'gallery plan b'

distance = 517
spam score = 52
title = 'gallery plan b'

distance = 517
spam score = 51
title = 'gallery plan b'

distance = 519
spam score = 50
title = 'gallery plan b'

distance = 519
spam score = 50
title = 'gallery plan b'

distance = 519
spam score = 50
title = 'gallery plan b'

distance = 519
spam score = 50
title = 'gallery plan b'

distance = 519
spam score = 51
title = 'gallery plan b'

distance = 519
spam score = 49
title = 'gallery plan b'

distance = 519
spam score = 50
title = 'gallery plan b'

distance = 519
spam score = 51
title = 'gallery plan b'

distance = 1492
spam score = 53
title = 'creations gallery featured artist offerings'

distance = 1618
spam score = 62
title = 'meyerrice house in highland park'

distance = 108
spam score = 57
title = 'ohfootsteps ohchampaign co photo brown'

distance = 108
spam score = 60
title = 'ohfootsteps ohchampaign co photo brown'

distance = 108
spam score = 60
title = 'ohfootsteps ohchampaign co photo brown'

distance = 110
spam score = 60
title = 'ohfootsteps ohchampaign co photo wheeler'

distance = 111
spam score = 56
title = 'ohfootsteps ohchampaign co photo apple'

distance = 115
spam score = 60
title = 'ohfootsteps ohchampaign co photo white'

distance = 116
spam score = 62
title = 'ohfootsteps ohchampaign co photo smith'

distance = 116
spam score = 61
title = 'ohfootsteps ohchampaign co photo smith'

distance = 116
spam score = 58
title = 'ohfootsteps ohchampaign co photo apple'

distance = 116
spam score = 57
title = 'ohfootsteps ohchampaign co photo smith'

distance = 117
spam score = 62
title = 'ohfootsteps ohchampaign co photo wells'

distance = 118
spam score = 58
title = 'ohfootsteps ohchampaign co photo deal'

distance = 120
spam score = 58
title = 'ohfootsteps ohchampaign co photo wilks'

distance = 121
spam score = 59
title = 'ohfootsteps ohchampaign co photo arnold'

distance = 121
spam score = 58
title = 'ohfootsteps ohchampaign co photo fry'

distance = 121
spam score = 56
title = 'ohfootsteps ohchampaign co photo unknown'

distance = 123
spam score = 56
title = 'ohfootsteps ohchampaign co photo tannehill'

distance = 123
spam score = 59
title = 'ohfootsteps ohchampaign co photo anderson'

distance = 127
spam score = 59
title = 'ohfootsteps ohchampaign co photo baker'

distance = 127
spam score = 59
title = 'ohfootsteps ohchampaign co photo spence'

distance = 183
spam score = 58
title = 'ohfootsteps ohchampaign co photo berrey'

distance = 183
spam score = 55
title = 'ohfootsteps ohchampaign co photo bodey'

distance = 184
spam score = 56
title = 'ohfootsteps ohchampaign co photo bodey'

distance = 184
spam score = 58
title = 'ohfootsteps ohchampaign co photo stevens'

distance = 184
spam score = 57
title = 'ohfootsteps ohchampaign co photo heaton'

distance = 184
spam score = 59
title = 'ohfootsteps ohchampaign co photo beckwith'

distance = 185
spam score = 60
title = 'ohfootsteps ohchampaign co photo apple'

distance = 185
spam score = 55
title = 'ohfootsteps ohchampaign co photo stapleton'

distance = 185
spam score = 61
title = 'ohfootsteps ohchampaign co photo pence'

distance = 186
spam score = 60
title = 'ohfootsteps ohchampaign co photo george'

distance = 210
spam score = 58
title = 'ohfootsteps ohchampaign co photo mcmorran'

distance = 211
spam score = 57
title = 'ohfootsteps ohchampaign co photo scott'

distance = 211
spam score = 55
title = 'ohfootsteps ohchampaign co photo scott'

distance = 211
spam score = 61
title = 'ohfootsteps ohchampaign co photo northcraft'

distance = 211
spam score = 61
title = 'ohfootsteps ohchampaign co photo scott'

distance = 212
spam score = 59
title = 'ohfootsteps ohchampaign co photo deal'

distance = 212
spam score = 62
title = 'ohfootsteps ohchampaign co photo tomlin'

distance = 213
spam score = 62
title = 'ohfootsteps ohchampaign co photo batdorf'

distance = 213
spam score = 53
title = 'ohfootsteps ohchampaign co photo french'

distance = 213
spam score = 61
title = 'ohfootsteps ohchampaign co photo richeson'

distance = 232
spam score = 58
title = 'ohfootsteps ohchampaign co photo brecount'

distance = 232
spam score = 64
title = 'ohfootsteps ohchampaign co photo pence'

distance = 233
spam score = 54
title = 'ohfootsteps ohchampaign co photo brighton'

distance = 233
spam score = 61
title = 'ohfootsteps ohchampaign co photo evans'

distance = 233
spam score = 62
title = 'ohfootsteps ohchampaign co photo furrow'

distance = 233
spam score = 61
title = 'ohfootsteps ohchampaign co photo sloan'

distance = 233
spam score = 56
title = 'ohfootsteps ohchampaign co photo foust'

distance = 233
spam score = 58
title = 'ohfootsteps ohchampaign co photo briggs'

distance = 234
spam score = 60
title = 'ohfootsteps ohchampaign co photo gibbs'

distance = 234
spam score = 58
title = 'ohfootsteps ohchampaign co photo slack'

distance = 264
spam score = 63
title = 'ohfootsteps ohchampaign co photo white'

distance = 265
spam score = 58
title = 'ohfootsteps ohchampaign co photo shank'

distance = 265
spam score = 62
title = 'ohfootsteps ohchampaign co photo desh'

distance = 265
spam score = 61
title = 'ohfootsteps ohchampaign co photo buckles'

distance = 265
spam score = 58
title = 'ohfootsteps ohchampaign co photo davis'

distance = 266
spam score = 56
title = 'ohfootsteps ohchampaign co photo luxon'

distance = 267
spam score = 56
title = 'ohfootsteps ohchampaign co photo slack'

distance = 268
spam score = 62
title = 'ohfootsteps ohchampaign co photo irwin'

distance = 268
spam score = 56
title = 'ohfootsteps ohchampaign co photo gibbs'

distance = 268
spam score = 60
title = 'ohfootsteps ohchampaign co photo mccoy'

distance = 368
spam score = 60
title = 'ohfootsteps ohdelaware co photo whipple'

distance = 371
spam score = 62
title = 'ohfootsteps ohdelaware co photo breece'

distance = 372
spam score = 62
title = 'ohfootsteps ohdelaware co photo main'

distance = 372
spam score = 61
title = 'ohfootsteps ohdelaware co photo main'

distance = 372
spam score = 64
title = 'ohfootsteps ohdelaware co photo main'

distance = 372
spam score = 59
title = 'ohfootsteps ohdelaware co photo main'

distance = 373
spam score = 59
title = 'ohfootsteps ohlogan co photo jenkins'

distance = 376
spam score = 62
title = 'ohfootsteps ohchampaign co photo souders'

distance = 377
spam score = 62
title = 'ohfootsteps ohchampaign co photo zeller'

distance = 378
spam score = 59
title = 'ohfootsteps ohtrumbull co photo gilson'

distance = 444
spam score = 62
title = 'ohfootsteps ohlogan co photo hamilton'

distance = 444
spam score = 61
title = 'ohfootsteps ohdelaware co photo main'

distance = 445
spam score = 61
title = 'ohfootsteps ohdelaware co photo wornstaff'

distance = 446
spam score = 60
title = 'ohfootsteps ohlucas co photo lacy'

distance = 446
spam score = 61
title = 'ohfootsteps ohlucas co photo lacy'

distance = 446
spam score = 61
title = 'ohfootsteps ohlogan co photo devine'

distance = 447
spam score = 62
title = 'ohfootsteps ohdelaware co photo mccreary'

distance = 447
spam score = 59
title = 'ohfootsteps ohtrumbull co photo jenkins'

distance = 447
spam score = 61
title = 'ohfootsteps ohtrumbull co photo jenkins'

distance = 448
spam score = 60
title = 'ohfootsteps remove'

distance = 494
spam score = 60
title = 'ohfootsteps ohhancock co photo cooper'

distance = 494
spam score = 63
title = 'ohfootsteps ohdelaware co photo ashbrook'

distance = 496
spam score = 62
title = 'ohfootsteps ohdelaware co photo edmondson'

distance = 496
spam score = 61
title = 'ohfootsteps ohdelaware co photo carter'

distance = 496
spam score = 61
title = 'ohfootsteps ohdelaware co photo main'

distance = 496
spam score = 60
title = 'ohfootsteps ohathens co photo pughline'

distance = 496
spam score = 59
title = 'ohfootsteps ohlogan co photo lyon'

distance = 497
spam score = 61
title = 'ohfootsteps ohlogan co photo levan'

distance = 497
spam score = 61
title = 'ohfootsteps ohdelaware co photo ashbrook'

distance = 498
spam score = 62
title = 'ohfootsteps ohtuscarawas co photo deardorff'

distance = 540
spam score = 56
title = 'ohfootsteps ohdelaware co photo eagon'

distance = 540
spam score = 63
title = 'ohfootsteps ohhancock co photo gayton'

distance = 540
spam score = 56
title = 'ohfootsteps ohdelaware co photo casteel'

distance = 541
spam score = 63
title = 'ohfootsteps ohhancock co photo hutchinson'

distance = 541
spam score = 60
title = 'ohfootsteps ohhancock co photo everingham'

distance = 542
spam score = 63
title = 'ohfootsteps ohhancock co photo davis'

distance = 542
spam score = 61
title = 'ohfootsteps ohdelaware co photo foust'

distance = 542
spam score = 58
title = 'ohfootsteps ohhancock co photo apger'

distance = 542
spam score = 59
title = 'ohfootsteps ohlogan co photo mcclain'

distance = 542
spam score = 55
title = 'ohfootsteps ohdelaware co photo eby'

distance = 1676
spam score = 40
title = ''

distance = 1691
spam score = 45
title = 'sheri az mahin amid negah'

distance = 1762
spam score = 82
title = 'kick ass bands all play at cream'

distance = 1790
spam score = 45
title = 'circa 252750 stalag 4b numbers'

distance = 1806
spam score = 28
title = ''

distance = 1865
spam score = 82
title = 'gerd schrderturks publications'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 60
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 60
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 60
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 63
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 60
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 60
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 60
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 0
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 63
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 63
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 61
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 63
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 113
spam score = 63
title = 'graphic witness visual arts amp social commentary'

distance = 272
spam score = 59
title = 'graphic witness visual arts amp social commentary'

distance = 277
spam score = 54
title = 'graphic witness visual arts amp social commentary'

distance = 691
spam score = 62
title = 'graphic witness visual arts amp social commentary'

distance = 1195
spam score = 71
title = 'graphic witness visual arts amp social commentary'

distance = 1329
spam score = 73
title = 'graphic witness visual arts amp social commentary'

distance = 1342
spam score = 69
title = 'graphic witness visual arts amp social commentary'

distance = 1347
spam score = 61
title = 'graphic witness george grosz'

distance = 1367
spam score = 71
title = 'graphic witness visual arts amp social commentary'

distance = 1372
spam score = 73
title = 'graphic witness visual arts amp social commentary'

distance = 1401
spam score = 73
title = 'graphic witness visual arts amp social commentary'

distance = 1759
spam score = 68
title = 'for immediate release'

distance = 277
spam score = 77
title = ''

distance = 581
spam score = 69
title = ''

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 155'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 156'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 153'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 160'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 175'

distance = 140
spam score = 48
title = 'untitled web journal pupukea sat 102007 174'

distance = 140
spam score = 48
title = 'untitled web journal pupukea sat 102007 176'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 159'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 161'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 166'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 164'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 167'

distance = 140
spam score = 45
title = 'untitled web journal pupukea sat 102007 169'

distance = 140
spam score = 48
title = 'untitled web journal pupukea sat 102007 171'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 152'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 154'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 151'

distance = 140
spam score = 48
title = 'untitled web journal pupukea sat 102007 158'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 163'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 168'

distance = 140
spam score = 45
title = 'untitled web journal pupukea sat 102007 140'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 137'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 150'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 144'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 103'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 112'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 072'

distance = 140
spam score = 47
title = 'untitled web journal pupukea sat 102007 084'

distance = 140
spam score = 48
title = 'untitled web journal pupukea sat 102007 063'

distance = 140
spam score = 46
title = 'untitled web journal pupukea sat 102007 059'

distance = 189
spam score = 47
title = 'untitled web journal gas chambers sat 093006 137'

distance = 189
spam score = 47
title = 'untitled web journal gas chambers sat 093006 110'

distance = 189
spam score = 47
title = 'untitled web journal gas chambers sat 093006 117'

distance = 189
spam score = 49
title = 'untitled web journal gas chambers sat 093006 112'

distance = 189
spam score = 47
title = 'untitled web journal gas chambers sat 093006 118'

distance = 189
spam score = 47
title = 'untitled web journal gas chambers sat 093006 138'

distance = 189
spam score = 48
title = 'untitled web journal gas chambers sat 093006 120'

distance = 189
spam score = 48
title = 'untitled web journal gas chambers sat 093006 143'

distance = 189
spam score = 48
title = 'untitled web journal gas chambers sat 093006 136'

distance = 189
spam score = 49
title = 'untitled web journal gas chambers sat 093006 146'

distance = 189
spam score = 48
title = 'untitled web journal gas chambers sat 093006 091'

distance = 189
spam score = 49
title = 'untitled web journal gas chambers sat 093006 096'

distance = 189
spam score = 48
title = 'untitled web journal gas chambers sat 093006 098'

distance = 189
spam score = 48
title = 'untitled web journal gas chambers sat 093006 113'

distance = 189
spam score = 47
title = 'untitled web journal gas chambers sat 093006 129'

distance = 189
spam score = 48
title = 'untitled web journal gas chambers sat 093006 127'

distance = 189
spam score = 48
title = 'untitled web journal gas chambers sat 093006 130'

distance = 189
spam score = 49
title = 'untitled web journal gas chambers sat 093006 123'

distance = 189
spam score = 48
title = 'untitled web journal gas chambers sat 093006 124'

distance = 189
spam score = 49
title = 'untitled web journal gas chambers sat 093006 122'

distance = 491
spam score = 48
title = 'untitled web journal queens sun 091706 036'

distance = 491
spam score = 50
title = 'untitled web journal queens sun 091706 012'

distance = 491
spam score = 48
title = 'untitled web journal queens sun 091706 028'

distance = 491
spam score = 49
title = 'untitled web journal queens sun 091706 041'

distance = 491
spam score = 49
title = 'untitled web journal queens sun 091706 048'

distance = 520
spam score = 51
title = 'untitled web journal 6c8b0081'

distance = 520
spam score = 52
title = 'untitled web journal 6c8b0187'

distance = 520
spam score = 52
title = 'untitled web journal 6c8b0016'

distance = 520
spam score = 52
title = 'untitled web journal 6c8b0189'

distance = 520
spam score = 51
title = 'untitled web journal 6c8b0158'

distance = 520
spam score = 51
title = 'untitled web journal 6c8b0045'

distance = 520
spam score = 52
title = 'untitled web journal 6c8b0064'

distance = 520
spam score = 50
title = 'untitled web journal 6c8b0080'

distance = 520
spam score = 50
title = 'untitled web journal 6c8b0108'

distance = 520
spam score = 51
title = 'untitled web journal 6c8b0120'

distance = 542
spam score = 54
title = 'untitled web journal 6c8b0034'

distance = 542
spam score = 52
title = 'untitled web journal 6c8b0048'

distance = 542
spam score = 53
title = 'untitled web journal 6c8b0003'

distance = 542
spam score = 52
title = 'untitled web journal 6c8b0045'

distance = 542
spam score = 54
title = 'untitled web journal 6c8b0008'

distance = 558
spam score = 54
title = 'untitled web journal 172'

distance = 558
spam score = 55
title = 'untitled web journal 177'

distance = 558
spam score = 55
title = 'untitled web journal 179'

distance = 558
spam score = 54
title = 'untitled web journal 182'

distance = 562
spam score = 50
title = 'untitled web journal 6c8b0028'

distance = 562
spam score = 48
title = 'untitled web journal 6c8b0030'

distance = 564
spam score = 50
title = 'untitled web journal shawn 19'

distance = 564
spam score = 51
title = 'untitled web journal shawn 10'

distance = 564
spam score = 52
title = 'untitled web journal shawn 07'

distance = 564
spam score = 51
title = 'untitled web journal shawn 20'

distance = 587
spam score = 45
title = 'queensmon091806 queens mon 91806 105'

distance = 587
spam score = 46
title = 'queensmon091806 queens mon 91806 124'

distance = 587
spam score = 46
title = 'queensmon091806 queens mon 91806 123'

distance = 587
spam score = 44
title = 'queensmon091806 queens mon 91806 119'

distance = 587
spam score = 47
title = 'queensmon091806 queens mon 91806 112'

distance = 587
spam score = 46
title = 'queensmon091806 queens mon 91806 121'

distance = 587
spam score = 46
title = 'queensmon091806 queens mon 91806 120'

distance = 587
spam score = 45
title = 'queensmon091806 queens mon 91806 111'

distance = 587
spam score = 46
title = 'queensmon091806 queens mon 91806 104'

distance = 587
spam score = 45
title = 'queensmon091806 queens mon 91806 102'

distance = 587
spam score = 44
title = 'queensmon091806 queens mon 91806 117'

distance = 587
spam score = 47
title = 'queensmon091806 queens mon 91806 060'

distance = 587
spam score = 45
title = 'queensmon091806 queens mon 91806 118'

distance = 587
spam score = 47
title = 'queensmon091806 queens mon 91806 063'

distance = 587
spam score = 46
title = 'queensmon091806 queens mon 91806 057'

distance = 587
spam score = 47
title = 'queensmon091806 queens mon 91806 056'

distance = 587
spam score = 46
title = 'queensmon091806 queens mon 91806 089'

distance = 587
spam score = 46
title = 'queensmon091806 queens mon 91806 079'

distance = 587
spam score = 47
title = 'queensmon091806 queens mon 91806 072'

distance = 587
spam score = 46
title = 'queensmon091806 queens mon 91806 059'

distance = 1827
spam score = 50
title = 'oxyfile 636 the biochemical mechanisms of the metabolic disorders in gestosis'

distance = 106
spam score = 19
title = 'companies starrydirectorycom'

distance = 112
spam score = 16
title = 'companies archcatalogcom'

distance = 117
spam score = 18
title = 'companies urlspagecom'

distance = 145
spam score = 23
title = 'events starrydirectorycom'

distance = 147
spam score = 17
title = 'stories urlspagecom'

distance = 147
spam score = 15
title = 'maps starrydirectorycom'

distance = 147
spam score = 21
title = 'running starrydirectorycom'

distance = 147
spam score = 21
title = 'running starrydirectorycom'

distance = 148
spam score = 21
title = 'products urlspagecom'

distance = 149
spam score = 18
title = 'get well urlspagecom'

distance = 149
spam score = 18
title = 'games starrydirectorycom'

distance = 150
spam score = 21
title = 'birding starrydirectorycom'

distance = 151
spam score = 19
title = 'lighting urlspagecom'

distance = 151
spam score = 21
title = 'publishers urlspagecom'

distance = 152
spam score = 20
title = 'organizations urlspagecom'

distance = 152
spam score = 22
title = 'organizations urlspagecom'

distance = 152
spam score = 19
title = 'organizations urlspagecom'

distance = 152
spam score = 20
title = 'organizations urlspagecom'

distance = 153
spam score = 21
title = 'news and media starrydirectorycom'

distance = 153
spam score = 20
title = 'news and media starrydirectorycom'

distance = 279
spam score = 20
title = 'transportation stayindirectorycom'

distance = 279
spam score = 21
title = 'education stayindirectorycom'

distance = 279
spam score = 16
title = 'childrens swimwear urlspagecom'

distance = 279
spam score = 13
title = 'vision choosedirectorycom'

distance = 279
spam score = 19
title = 'transportation stayindirectorycom'

distance = 279
spam score = 19
title = 'transportation stayindirectorycom'

distance = 279
spam score = 21
title = 'education stayindirectorycom'

distance = 279
spam score = 20
title = 'snowboarding begindirectorycom'

distance = 279
spam score = 21
title = 'education stayindirectorycom'

distance = 279
spam score = 22
title = 'education stayindirectorycom'

distance = 298
spam score = 22
title = 'schools directorybravocom'

distance = 298
spam score = 18
title = 'recreation and sports freepagesubmissioncom'

distance = 298
spam score = 19
title = 'education choosedirectorycom'

distance = 298
spam score = 24
title = 'panama nonstopdircom'

distance = 298
spam score = 17
title = 'business and economy freepagesubmissioncom'

distance = 298
spam score = 22
title = 'gifts and collectibles directorybravocom'

distance = 298
spam score = 12
title = 'religion and spirituality begindirectorycom'

distance = 298
spam score = 23
title = 'brunei nonstopdircom'

distance = 298
spam score = 24
title = 'events and shows directorybravocom'

distance = 298
spam score = 11
title = 'united states nonstopdircom'

distance = 318
spam score = 20
title = 'maps and views stayindirectorycom'

distance = 318
spam score = 21
title = 'maps and views stayindirectorycom'

distance = 318
spam score = 21
title = 'bottles directorybravocom'

distance = 318
spam score = 18
title = 'recreation and sports freepagesubmissioncom'

distance = 318
spam score = 19
title = 'newsletters begincatalogcom'

distance = 318
spam score = 23
title = 'television nonstopdircom'

distance = 318
spam score = 20
title = 'maps and views stayindirectorycom'

distance = 318
spam score = 16
title = 'business and economy freepagesubmissioncom'

distance = 318
spam score = 18
title = 'support services urlspagecom'

distance = 318
spam score = 19
title = 'society and culture freepagesubmissioncom'

distance = 334
spam score = 24
title = 'books nonstopdircom'

distance = 334
spam score = 16
title = 'shopping freepagesubmissioncom'

distance = 334
spam score = 22
title = 'arts and entertainment nonstopdircom'

distance = 334
spam score = 25
title = 'libraries nonstopdircom'

distance = 334
spam score = 27
title = 'scientists nonstopdircom'

distance = 334
spam score = 19
title = 'arts and entertainment stayindirectorycom'

distance = 334
spam score = 20
title = 'pachinko growdirectorycom'

distance = 334
spam score = 16
title = 'theory faircatalogcom'

distance = 334
spam score = 21
title = 'genealogy growdirectorycom'

distance = 334
spam score = 20
title = 'arts and entertainment stayindirectorycom'

distance = 351
spam score = 25
title = 'recreation and sports nonstopdircom'

distance = 351
spam score = 16
title = 'radio urlslistcom'

distance = 351
spam score = 17
title = 'teen substance abuse dinamitdirectorycom'

distance = 351
spam score = 19
title = 'bowling founddircom'

distance = 351
spam score = 16
title = 'slot machines urlslistcom'

distance = 351
spam score = 17
title = 'museum stores choosedirectorycom'

distance = 351
spam score = 19
title = 'maps and views freepagesubmissioncom'

distance = 351
spam score = 18
title = 'guides and directories freepagesubmissioncom'

distance = 351
spam score = 18
title = 'travel and tourism freepagesubmissioncom'

distance = 351
spam score = 18
title = 'autographs starryindexcom'

distance = 372
spam score = 11
title = 'music groupurlscom'

distance = 372
spam score = 23
title = 'four wheel drive directorybravocom'

distance = 372
spam score = 17
title = 'wilderness education begincatalogcom'

distance = 372
spam score = 17
title = 'posters and prints choosedirectorycom'

distance = 372
spam score = 15
title = 'children home decor onyxlistcom'

distance = 372
spam score = 20
title = 'transportation stayindirectorycom'

distance = 372
spam score = 22
title = 'commercial investment nonstopdircom'

distance = 372
spam score = 18
title = 'real estate stayindirectorycom'

distance = 372
spam score = 18
title = 'kites urlspagecom'

distance = 372
spam score = 20
title = 'gastrointestinal diseases dinamitdirectorycom'

distance = 397
spam score = 18
title = 'games directorybravocom'

distance = 397
spam score = 20
title = 'supplies and equipment urlslistcom'

distance = 397
spam score = 18
title = 'entertainment and media groupurlscom'

distance = 397
spam score = 19
title = 'travel and tourism stayindirectorycom'

distance = 397
spam score = 21
title = 'guides and directories stayindirectorycom'

distance = 397
spam score = 20
title = 'railway enthusiasts urlspagecom'

distance = 398
spam score = 13
title = 'insurance morganitedirectorycom'

distance = 398
spam score = 14
title = 'watches urlslistcom'

distance = 398
spam score = 12
title = 'jokes urlslistcom'

distance = 398
spam score = 24
title = 'real estate nonstopdircom'

distance = 453
spam score = 10
title = 'online grocery stores choosedirectorycom'

distance = 454
spam score = 20
title = 'science and environment freepagesubmissioncom'

distance = 454
spam score = 15
title = 'timeshares begincatalogcom'

distance = 454
spam score = 20
title = 'biofeedback archcatalogcom'

distance = 454
spam score = 23
title = 'recreation and sports nonstopdircom'

distance = 454
spam score = 21
title = 'religious and sacred dance growdirectorycom'

distance = 454
spam score = 19
title = 'rocks gems and minerals urlspagecom'

distance = 454
spam score = 23
title = 'news and media groupurlscom'

distance = 454
spam score = 19
title = 'prostatitis choosedirectorycom'

distance = 454
spam score = 11
title = 'trade nonstopdircom'

distance = 1795
spam score = 27
title = 'linares anibal open'

distance = 1871
spam score = 25
title = ''

distance = 87
spam score = 45
title = '93274tultul01219htm'

distance = 102
spam score = 47
title = '93274tultul02982htm'

distance = 114
spam score = 47
title = '93274tultul00105htm'

distance = 115
spam score = 46
title = '93274tultul00170htm'

distance = 117
spam score = 46
title = '93274tultul11864htm'

distance = 117
spam score = 47
title = '93274tultul01961htm'

distance = 121
spam score = 47
title = '93274tultul11708htm'

distance = 126
spam score = 46
title = '93274tultul11782htm'

distance = 128
spam score = 45
title = '93274tultul04100htm'

distance = 130
spam score = 47
title = '93274tultul11858htm'

distance = 132
spam score = 47
title = '93274tultul11997htm'

distance = 132
spam score = 45
title = '93274tultul11874htm'

distance = 133
spam score = 46
title = '93274tultul02604htm'

distance = 133
spam score = 47
title = '93274tultul02513htm'

distance = 136
spam score = 46
title = '93274tultul02584htm'

distance = 137
spam score = 46
title = '93274tultul00746htm'

distance = 138
spam score = 46
title = '93274tultul11669htm'

distance = 141
spam score = 44
title = '93274tultul11920htm'

distance = 141
spam score = 47
title = '93274tultul11956htm'

distance = 141
spam score = 45
title = '93274tultul00152htm'

distance = 209
spam score = 48
title = '93274tultul11689htm'

distance = 209
spam score = 46
title = '93274tultul11970htm'

distance = 210
spam score = 47
title = '93274tultul01358htm'

distance = 210
spam score = 48
title = '93274tultul11851htm'

distance = 211
spam score = 48
title = '93274tultul01565htm'

distance = 211
spam score = 46
title = '93274tultul02076htm'

distance = 211
spam score = 48
title = '93274tultul11904htm'

distance = 212
spam score = 46
title = '93274tultul11895htm'

distance = 212
spam score = 48
title = '93274tultul00039htm'

distance = 212
spam score = 46
title = '93274tultul01824htm'

distance = 221
spam score = 47
title = '93274tultul11398htm'

distance = 222
spam score = 47
title = '93274tultul01098htm'

distance = 224
spam score = 49
title = '93274tultul11959htm'

distance = 224
spam score = 47
title = '93274tultul11935htm'

distance = 225
spam score = 46
title = '93274tultul11787htm'

distance = 225
spam score = 44
title = '93274tultul00744htm'

distance = 226
spam score = 48
title = '93615cutcut03402htm'

distance = 226
spam score = 48
title = '93615cutcut03371htm'

distance = 226
spam score = 47
title = '93274tultul11778htm'

distance = 226
spam score = 47
title = '93615cutcut03392htm'

distance = 233
spam score = 46
title = '93615cutcut00560htm'

distance = 234
spam score = 47
title = '93274tultul11449htm'

distance = 234
spam score = 47
title = '93274tultul11690htm'

distance = 235
spam score = 46
title = '93274tultul04228htm'

distance = 236
spam score = 47
title = '93274tultul02886htm'

distance = 237
spam score = 48
title = '93274tultul11783htm'

distance = 239
spam score = 47
title = '93274tultul11951htm'

distance = 243
spam score = 47
title = '93274tultul00934htm'

distance = 243
spam score = 48
title = '93274tultul00002htm'

distance = 244
spam score = 47
title = '93274tultul02853htm'

distance = 273
spam score = 47
title = '93615cutcut00987htm'

distance = 277
spam score = 47
title = '93615cutcut02182htm'

distance = 278
spam score = 46
title = '93274tultul00950htm'

distance = 278
spam score = 47
title = '93615cutcut01513htm'

distance = 280
spam score = 47
title = '93247linlin01766htm'

distance = 280
spam score = 47
title = '93615cutcut03419htm'

distance = 280
spam score = 47
title = '93615cutcut03345htm'

distance = 282
spam score = 47
title = '93615cutcut01567htm'

distance = 283
spam score = 47
title = '93247linlin01981htm'

distance = 285
spam score = 49
title = '93615cutcut00081htm'

distance = 293
spam score = 47
title = '93615cutcut03430htm'

distance = 293
spam score = 48
title = '93274tultul11891htm'

distance = 293
spam score = 47
title = '93615cutcut03360htm'

distance = 294
spam score = 46
title = '93247linlin02645htm'

distance = 294
spam score = 48
title = '93615cutcut03374htm'

distance = 295
spam score = 48
title = '93274tultul01935htm'

distance = 296
spam score = 47
title = '93247linlin00141htm'

distance = 296
spam score = 48
title = '93274tultul11866htm'

distance = 297
spam score = 48
title = '93615cutcut12097htm'

distance = 297
spam score = 46
title = '93615cutcut04395htm'

distance = 306
spam score = 46
title = '93615cutcut01421htm'

distance = 310
spam score = 45
title = '93274tultul02452htm'

distance = 310
spam score = 48
title = '93247linlin00734htm'

distance = 311
spam score = 46
title = '93247linlin04720htm'

distance = 311
spam score = 48
title = '93615cutcut12094htm'

distance = 312
spam score = 47
title = '93615cutcut12095htm'

distance = 315
spam score = 47
title = '93274tultul02270htm'

distance = 315
spam score = 49
title = '93274tultul04431htm'

distance = 316
spam score = 46
title = '93615cutcut12096htm'

distance = 316
spam score = 49
title = '93274tultul01776htm'

distance = 333
spam score = 49
title = '93274tultul02485htm'

distance = 333
spam score = 49
title = '93274tultul01507htm'

distance = 336
spam score = 48
title = '93274tultul04297htm'

distance = 336
spam score = 47
title = '93274tultul04611htm'

distance = 342
spam score = 48
title = '93274tultul01760htm'

distance = 342
spam score = 47
title = '93615cutcut02978htm'

distance = 342
spam score = 48
title = '93274tultul01761htm'

distance = 344
spam score = 46
title = '93247linlin02540htm'

distance = 346
spam score = 48
title = '93274tultul11929htm'

distance = 351
spam score = 47
title = '93247linlin02664htm'

distance = 384
spam score = 47
title = '93247linlin03989htm'

distance = 385
spam score = 49
title = '93247linlin01975htm'

distance = 385
spam score = 49
title = '93615cutcut03931htm'

distance = 385
spam score = 48
title = '93615cutcut02975htm'

distance = 386
spam score = 48
title = '93247linlin04867htm'

distance = 387
spam score = 47
title = '93247linlin02359htm'

distance = 388
spam score = 48
title = '93247linlin02350htm'

distance = 391
spam score = 47
title = '93247linlin04299htm'

distance = 393
spam score = 47
title = '93247linlin11620htm'

distance = 395
spam score = 47
title = '93247linlin01971htm'

distance = 1730
spam score = 24
title = ''

distance = 1743
spam score = 58
title = 'aljans dollie v herrlickheit'

distance = 1805
spam score = 61
title = 'the official home of hillcrest baseball'

distance = 119
spam score = 65
title = 'carpathorusyn community'

distance = 119
spam score = 65
title = 'carpathorusyn community'

distance = 123
spam score = 64
title = 'carpathorusyn community'

distance = 128
spam score = 68
title = 'carpathorusyn community'

distance = 128
spam score = 67
title = 'carpathorusyn community'

distance = 140
spam score = 65
title = 'carpathorusyn community'

distance = 140
spam score = 65
title = 'carpathorusyn community'

distance = 143
spam score = 65
title = 'carpathorusyn community'

distance = 143
spam score = 64
title = 'carpathorusyn community'

distance = 145
spam score = 64
title = 'carpathorusyn community'

distance = 150
spam score = 66
title = 'carpathorusyn community'

distance = 151
spam score = 66
title = 'carpathorusyn community'

distance = 152
spam score = 68
title = 'carpathorusyn community'

distance = 152
spam score = 67
title = 'carpathorusyn community'

distance = 152
spam score = 67
title = 'carpathorusyn community'

distance = 155
spam score = 64
title = 'carpathorusyn community'

distance = 155
spam score = 64
title = 'carpathorusyn community'

distance = 155
spam score = 64
title = 'carpathorusyn community'

distance = 155
spam score = 65
title = 'carpathorusyn community'

distance = 158
spam score = 68
title = 'carpathorusyn community'

distance = 229
spam score = 65
title = 'carpathorusyn community'

distance = 234
spam score = 63
title = 'carpathorusyn community'

distance = 234
spam score = 62
title = 'carpathorusyn community'

distance = 264
spam score = 63
title = 'carpathorusyn community'

distance = 265
spam score = 63
title = 'carpathorusyn community'

distance = 266
spam score = 62
title = 'carpathorusyn community'

distance = 274
spam score = 62
title = 'carpathorusyn community'

distance = 354
spam score = 63
title = 'carpathorusyn community'

distance = 354
spam score = 63
title = 'carpathorusyn community'

distance = 356
spam score = 64
title = 'carpathorusyn community'

distance = 458
spam score = 70
title = 'carpathorusyn community log in'

distance = 458
spam score = 71
title = 'carpathorusyn community log in'

distance = 458
spam score = 70
title = 'carpathorusyn community log in'

distance = 458
spam score = 70
title = 'carpathorusyn community log in'

distance = 458
spam score = 72
title = 'carpathorusyn community log in'

distance = 458
spam score = 70
title = 'carpathorusyn community log in'

distance = 458
spam score = 72
title = 'carpathorusyn community log in'

distance = 458
spam score = 70
title = 'carpathorusyn community log in'

distance = 458
spam score = 72
title = 'carpathorusyn community log in'

distance = 458
spam score = 71
title = 'carpathorusyn community log in'

distance = 458
spam score = 72
title = 'carpathorusyn community log in'

distance = 458
spam score = 71
title = 'carpathorusyn community log in'

distance = 468
spam score = 71
title = 'carpathorusyn community log in'

distance = 468
spam score = 72
title = 'carpathorusyn community log in'

distance = 468
spam score = 71
title = 'carpathorusyn community log in'

distance = 468
spam score = 71
title = 'carpathorusyn community log in'

distance = 468
spam score = 70
title = 'carpathorusyn community log in'

distance = 468
spam score = 73
title = 'carpathorusyn community log in'

distance = 468
spam score = 73
title = 'carpathorusyn community log in'

distance = 468
spam score = 71
title = 'carpathorusyn community log in'

distance = 473
spam score = 71
title = 'carpathorusyn community log in'

distance = 474
spam score = 72
title = 'carpathorusyn community log in'

distance = 474
spam score = 73
title = 'carpathorusyn community log in'

distance = 476
spam score = 70
title = 'carpathorusyn community log in'

distance = 477
spam score = 70
title = 'carpathorusyn community log in'

distance = 477
spam score = 70
title = 'carpathorusyn community log in'

distance = 477
spam score = 70
title = 'carpathorusyn community log in'

distance = 477
spam score = 70
title = 'carpathorusyn community log in'

distance = 477
spam score = 71
title = 'carpathorusyn community log in'

distance = 477
spam score = 72
title = 'carpathorusyn community log in'

distance = 481
spam score = 71
title = 'carpathorusyn community log in'

distance = 481
spam score = 71
title = 'carpathorusyn community log in'

distance = 481
spam score = 70
title = 'carpathorusyn community log in'

distance = 484
spam score = 70
title = 'carpathorusyn community log in'

distance = 484
spam score = 72
title = 'carpathorusyn community log in'

distance = 486
spam score = 71
title = 'carpathorusyn community log in'

distance = 486
spam score = 70
title = 'carpathorusyn community log in'

distance = 486
spam score = 71
title = 'carpathorusyn community log in'

distance = 486
spam score = 69
title = 'carpathorusyn community log in'

distance = 486
spam score = 70
title = 'carpathorusyn community log in'

distance = 490
spam score = 70
title = 'carpathorusyn community log in'

distance = 490
spam score = 70
title = 'carpathorusyn community log in'

distance = 492
spam score = 72
title = 'carpathorusyn community log in'

distance = 492
spam score = 70
title = 'carpathorusyn community log in'

distance = 493
spam score = 69
title = 'carpathorusyn community log in'

distance = 493
spam score = 72
title = 'carpathorusyn community log in'

distance = 493
spam score = 71
title = 'carpathorusyn community log in'

distance = 493
spam score = 70
title = 'carpathorusyn community log in'

distance = 493
spam score = 71
title = 'carpathorusyn community log in'

distance = 495
spam score = 70
title = 'carpathorusyn community log in'

distance = 501
spam score = 71
title = 'carpathorusyn community log in'

distance = 502
spam score = 71
title = 'carpathorusyn community log in'

distance = 502
spam score = 70
title = 'carpathorusyn community log in'

distance = 502
spam score = 71
title = 'carpathorusyn community log in'

distance = 504
spam score = 71
title = 'carpathorusyn community log in'

distance = 504
spam score = 70
title = 'carpathorusyn community log in'

distance = 505
spam score = 70
title = 'carpathorusyn community log in'

distance = 505
spam score = 72
title = 'carpathorusyn community log in'

distance = 505
spam score = 72
title = 'carpathorusyn community log in'

distance = 506
spam score = 70
title = 'carpathorusyn community log in'

distance = 509
spam score = 70
title = 'carpathorusyn community log in'

distance = 509
spam score = 71
title = 'carpathorusyn community log in'

distance = 515
spam score = 70
title = 'carpathorusyn community log in'

distance = 516
spam score = 71
title = 'carpathorusyn community log in'

distance = 516
spam score = 73
title = 'carpathorusyn community log in'

distance = 519
spam score = 71
title = 'carpathorusyn community log in'

distance = 520
spam score = 71
title = 'carpathorusyn community log in'

distance = 522
spam score = 70
title = 'carpathorusyn community log in'

distance = 522
spam score = 69
title = 'carpathorusyn community log in'

distance = 522
spam score = 69
title = 'carpathorusyn community log in'

distance = 1372
spam score = 81
title = 'talk blather index'

distance = 1474
spam score = 83
title = 'carpathorusyn knowledge base organizations'

distance = 1583
spam score = 66
title = 'laura'

distance = 145
spam score = 85
title = ''

distance = 148
spam score = 85
title = ''

distance = 162
spam score = 84
title = ''

distance = 165
spam score = 84
title = ''

distance = 171
spam score = 85
title = ''

distance = 173
spam score = 83
title = ''

distance = 180
spam score = 84
title = ''

distance = 183
spam score = 84
title = ''

distance = 184
spam score = 84
title = ''

distance = 184
spam score = 84
title = ''

distance = 187
spam score = 85
title = ''

distance = 187
spam score = 84
title = ''

distance = 187
spam score = 83
title = ''

distance = 188
spam score = 83
title = ''

distance = 193
spam score = 85
title = ''

distance = 193
spam score = 84
title = ''

distance = 196
spam score = 84
title = ''

distance = 196
spam score = 81
title = ''

distance = 196
spam score = 85
title = ''

distance = 196
spam score = 84
title = ''

distance = 198
spam score = 84
title = ''

distance = 199
spam score = 83
title = ''

distance = 207
spam score = 82
title = ''

distance = 209
spam score = 84
title = ''

distance = 211
spam score = 85
title = ''

distance = 215
spam score = 85
title = ''

distance = 217
spam score = 83
title = ''

distance = 223
spam score = 85
title = ''

distance = 225
spam score = 83
title = ''

distance = 226
spam score = 84
title = ''

distance = 226
spam score = 83
title = ''

distance = 230
spam score = 82
title = ''

distance = 234
spam score = 86
title = ''

distance = 236
spam score = 84
title = ''

distance = 237
spam score = 86
title = ''

distance = 241
spam score = 84
title = ''

distance = 248
spam score = 86
title = ''

distance = 249
spam score = 85
title = ''

distance = 251
spam score = 84
title = ''

distance = 253
spam score = 81
title = ''

distance = 257
spam score = 80
title = ''

distance = 259
spam score = 84
title = ''

distance = 264
spam score = 84
title = ''

distance = 264
spam score = 84
title = ''

distance = 265
spam score = 80
title = ''

distance = 266
spam score = 85
title = ''

distance = 266
spam score = 86
title = ''

distance = 273
spam score = 84
title = ''

distance = 273
spam score = 84
title = ''

distance = 275
spam score = 85
title = ''

distance = 276
spam score = 85
title = ''

distance = 279
spam score = 82
title = ''

distance = 288
spam score = 84
title = ''

distance = 288
spam score = 86
title = ''

distance = 292
spam score = 84
title = ''

distance = 292
spam score = 85
title = ''

distance = 294
spam score = 82
title = ''

distance = 295
spam score = 85
title = ''

distance = 295
spam score = 85
title = ''

distance = 298
spam score = 84
title = ''

distance = 300
spam score = 84
title = ''

distance = 304
spam score = 84
title = ''

distance = 304
spam score = 86
title = ''

distance = 305
spam score = 84
title = ''

distance = 305
spam score = 82
title = ''

distance = 308
spam score = 83
title = ''

distance = 308
spam score = 84
title = ''

distance = 309
spam score = 84
title = ''

distance = 316
spam score = 83
title = ''

distance = 316
spam score = 85
title = ''

distance = 319
spam score = 84
title = ''

distance = 321
spam score = 83
title = ''

distance = 345
spam score = 85
title = ''

distance = 347
spam score = 84
title = ''

distance = 374
spam score = 85
title = ''

distance = 386
spam score = 84
title = ''

distance = 387
spam score = 84
title = ''

distance = 425
spam score = 84
title = ''

distance = 529
spam score = 84
title = ''

distance = 537
spam score = 83
title = ''

distance = 668
spam score = 81
title = ''

distance = 966
spam score = 48
title = ''

distance = 1003
spam score = 64
title = ''

distance = 1091
spam score = 69
title = ''

distance = 1144
spam score = 80
title = ''

distance = 1149
spam score = 80
title = ''

distance = 1153
spam score = 79
title = ''

distance = 1155
spam score = 79
title = ''

distance = 1156
spam score = 74
title = ''

distance = 1157
spam score = 80
title = ''

distance = 1168
spam score = 69
title = ''

distance = 1247
spam score = 62
title = ''

distance = 386
spam score = 77
title = ''

distance = 542
spam score = 79
title = ''

distance = 219
spam score = 41
title = ''

distance = 221
spam score = 43
title = ''

distance = 237
spam score = 36
title = ''

distance = 237
spam score = 37
title = ''

distance = 251
spam score = 43
title = ''

distance = 258
spam score = 40
title = ''

distance = 263
spam score = 37
title = ''

distance = 263
spam score = 37
title = ''

distance = 264
spam score = 36
title = ''

distance = 264
spam score = 37
title = ''

distance = 267
spam score = 36
title = ''

distance = 270
spam score = 41
title = ''

distance = 270
spam score = 37
title = ''

distance = 270
spam score = 39
title = ''

distance = 272
spam score = 37
title = ''

distance = 272
spam score = 35
title = ''

distance = 272
spam score = 38
title = ''

distance = 277
spam score = 38
title = ''

distance = 281
spam score = 44
title = ''

distance = 283
spam score = 43
title = ''

distance = 307
spam score = 40
title = ''

distance = 307
spam score = 39
title = ''

distance = 310
spam score = 35
title = ''

distance = 310
spam score = 36
title = ''

distance = 310
spam score = 38
title = ''

distance = 311
spam score = 45
title = ''

distance = 317
spam score = 42
title = ''

distance = 318
spam score = 41
title = ''

distance = 319
spam score = 44
title = ''

distance = 323
spam score = 42
title = ''

distance = 338
spam score = 39
title = ''

distance = 338
spam score = 40
title = ''

distance = 341
spam score = 43
title = ''

distance = 343
spam score = 38
title = ''

distance = 345
spam score = 39
title = ''

distance = 347
spam score = 43
title = ''

distance = 348
spam score = 37
title = ''

distance = 349
spam score = 35
title = ''

distance = 351
spam score = 36
title = ''

distance = 352
spam score = 38
title = ''

distance = 361
spam score = 45
title = ''

distance = 362
spam score = 39
title = ''

distance = 365
spam score = 45
title = ''

distance = 365
spam score = 45
title = ''

distance = 365
spam score = 45
title = ''

distance = 365
spam score = 38
title = ''

distance = 370
spam score = 38
title = ''

distance = 370
spam score = 36
title = ''

distance = 376
spam score = 44
title = ''

distance = 377
spam score = 39
title = ''

distance = 384
spam score = 35
title = ''

distance = 384
spam score = 40
title = ''

distance = 386
spam score = 39
title = ''

distance = 386
spam score = 39
title = ''

distance = 388
spam score = 40
title = ''

distance = 389
spam score = 39
title = ''

distance = 390
spam score = 40
title = ''

distance = 390
spam score = 39
title = ''

distance = 392
spam score = 39
title = ''

distance = 394
spam score = 40
title = ''

distance = 409
spam score = 43
title = ''

distance = 410
spam score = 39
title = ''

distance = 412
spam score = 39
title = ''

distance = 412
spam score = 37
title = ''

distance = 414
spam score = 41
title = ''

distance = 419
spam score = 42
title = ''

distance = 420
spam score = 38
title = ''

distance = 420
spam score = 38
title = ''

distance = 427
spam score = 44
title = ''

distance = 429
spam score = 39
title = ''

distance = 452
spam score = 37
title = ''

distance = 455
spam score = 39
title = ''

distance = 461
spam score = 38
title = ''

distance = 465
spam score = 43
title = ''

distance = 468
spam score = 44
title = ''

distance = 474
spam score = 44
title = ''

distance = 475
spam score = 38
title = ''

distance = 480
spam score = 42
title = ''

distance = 481
spam score = 38
title = ''

distance = 482
spam score = 43
title = ''

distance = 519
spam score = 44
title = ''

distance = 533
spam score = 40
title = ''

distance = 535
spam score = 42
title = ''

distance = 548
spam score = 41
title = ''

distance = 550
spam score = 39
title = ''

distance = 558
spam score = 40
title = ''

distance = 564
spam score = 42
title = ''

distance = 574
spam score = 41
title = ''

distance = 576
spam score = 41
title = ''

distance = 584
spam score = 43
title = ''

distance = 690
spam score = 39
title = ''

distance = 690
spam score = 38
title = ''

distance = 690
spam score = 39
title = ''

distance = 705
spam score = 41
title = ''

distance = 705
spam score = 42
title = ''

distance = 710
spam score = 40
title = ''

distance = 714
spam score = 39
title = ''

distance = 714
spam score = 38
title = ''

distance = 716
spam score = 43
title = ''

distance = 736
spam score = 42
title = ''

distance = 799
spam score = 39
title = ''

distance = 802
spam score = 41
title = ''

distance = 802
spam score = 41
title = ''

distance = 820
spam score = 42
title = ''

distance = 1676
spam score = 33
title = 'lp hints on making proofs go faster'

distance = 108
spam score = 74
title = 'line i05e subsection a'

distance = 108
spam score = 74
title = 'line i05e subsection b'

distance = 119
spam score = 73
title = 'line i09n subsection b'

distance = 119
spam score = 73
title = 'line i09n subsection a'

distance = 119
spam score = 76
title = 'line i07n subsection a'

distance = 119
spam score = 76
title = 'line i07n subsection e'

distance = 119
spam score = 76
title = 'line i10 subsection b'

distance = 119
spam score = 76
title = 'line i07n subsection b'

distance = 119
spam score = 76
title = 'line i07n subsection d'

distance = 119
spam score = 76
title = 'line i07n subsection c'

distance = 119
spam score = 77
title = 'line i10 subsection a'

distance = 126
spam score = 74
title = 'line a24 subsection d'

distance = 126
spam score = 73
title = 'line a24 subsection c'

distance = 126
spam score = 74
title = 'line a24 subsection b'

distance = 126
spam score = 73
title = 'line a24 subsection a'

distance = 127
spam score = 73
title = 'line p17n section'

distance = 127
spam score = 74
title = 'line p17c section'

distance = 133
spam score = 75
title = 'line i08n section'

distance = 133
spam score = 76
title = 'line i05w section'

distance = 133
spam score = 76
title = 'line i05w section'

distance = 174
spam score = 71
title = 'line s04p subsection b'

distance = 174
spam score = 73
title = 'line s04p subsection a'

distance = 174
spam score = 73
title = 'line s04p subsection c'

distance = 174
spam score = 71
title = 'line s04p subsection b'

distance = 174
spam score = 72
title = 'line s04p subsection a'

distance = 177
spam score = 74
title = 'line s04i sibsection a'

distance = 177
spam score = 75
title = 'lines p16ap17a section'

distance = 177
spam score = 69
title = 'line s04i sibsection b'

distance = 177
spam score = 72
title = 'line s04i sibsection c'

distance = 177
spam score = 75
title = 'lines p16ap17a section'

distance = 209
spam score = 79
title = 'line s04i sibsection c'

distance = 209
spam score = 80
title = 'line s04i sibsection a'

distance = 209
spam score = 76
title = 'line s04i sibsection b'

distance = 212
spam score = 78
title = 'line a16s save5 subsection c'

distance = 212
spam score = 78
title = 'line a16s save5 subsection a'

distance = 212
spam score = 79
title = 'line a16s save5 subsection b'

distance = 229
spam score = 74
title = 'line p17ep section'

distance = 229
spam score = 73
title = 'line p17ep section'

distance = 229
spam score = 74
title = 'line p19cp section'

distance = 229
spam score = 74
title = 'line p19cp section'

distance = 266
spam score = 81
title = 'i03 section'

distance = 266
spam score = 76
title = 'i03 section'

distance = 266
spam score = 77
title = 'i03 section'

distance = 268
spam score = 78
title = 'meteor 115 subsection b'

distance = 268
spam score = 78
title = 'meteor 115 subsection d'

distance = 268
spam score = 78
title = 'meteor 115 subsection c'

distance = 268
spam score = 79
title = 'meteor 115 subsection a'

distance = 315
spam score = 74
title = 'line a16s save6 section'

distance = 315
spam score = 77
title = 'line a16 mctt section'

distance = 315
spam score = 74
title = 'line a16s save6 section'

distance = 349
spam score = 79
title = 'save3 subsection b'

distance = 349
spam score = 77
title = 'save4 subsection c'

distance = 350
spam score = 73
title = 'oceanus 134 subsection e'

distance = 350
spam score = 72
title = 'oceanus 134 subsection d'

distance = 350
spam score = 71
title = 'oceanus 134 subsection b'

distance = 350
spam score = 72
title = 'oceanus 134 subsection a'

distance = 350
spam score = 71
title = 'oceanus 134 subsection c'

distance = 350
spam score = 72
title = 'oceanus 134 subsection f'

distance = 355
spam score = 73
title = 'wbex 1 subsections b'

distance = 355
spam score = 72
title = 'wbex 1 subsections a'

distance = 432
spam score = 71
title = 'line s04i'

distance = 434
spam score = 76
title = 'line i10 sections'

distance = 434
spam score = 77
title = 'line i09n sections'

distance = 438
spam score = 67
title = 'line s04p sections'

distance = 438
spam score = 68
title = 'line s04p sections'

distance = 439
spam score = 70
title = 'i04i05wi07c sections'

distance = 439
spam score = 70
title = 'i04i05wi07c sections'

distance = 440
spam score = 66
title = 'line p17c section'

distance = 440
spam score = 66
title = 'line p17c section'

distance = 440
spam score = 65
title = 'line p19c sections'

distance = 499
spam score = 76
title = 'ttn045n'

distance = 499
spam score = 76
title = 'ttn043n'

distance = 500
spam score = 65
title = 'line a16s save5 sections'

distance = 500
spam score = 64
title = 'line a16s save5 sections'

distance = 505
spam score = 69
title = 'line a21 meteor 115'

distance = 505
spam score = 69
title = 'line a21 meteor 115'

distance = 509
spam score = 75
title = 'line a21 meteor 115'

distance = 513
spam score = 64
title = 'lines p16a and p17a'

distance = 513
spam score = 65
title = 'lines p16a and p17a'

distance = 520
spam score = 75
title = 'ttn054s'

distance = 601
spam score = 71
title = 'save2 sections'

distance = 601
spam score = 70
title = 'save3 sections'

distance = 612
spam score = 66
title = 'save4 sections'

distance = 612
spam score = 59
title = 'atlantic 119'

distance = 612
spam score = 59
title = 'atlantic 119'

distance = 612
spam score = 66
title = 'save4 sections'

distance = 615
spam score = 65
title = 'atlantic 119'

distance = 619
spam score = 69
title = 'save3 sections'

distance = 619
spam score = 69
title = 'save2 sections'

distance = 619
spam score = 70
title = 'save2 sections'

distance = 745
spam score = 55
title = 'ross sea nbp9703m'

distance = 745
spam score = 55
title = 'ross sea nbp9703m'

distance = 746
spam score = 64
title = 'ross sea nbp9605'

distance = 751
spam score = 55
title = 'ross sea nbp9708'

distance = 751
spam score = 55
title = 'ross sea nbp9708'

distance = 752
spam score = 55
title = 'ross sea nbp9604a'

distance = 752
spam score = 55
title = 'ross sea nbp9604a'

distance = 754
spam score = 69
title = 'oceanus134 sections'

distance = 754
spam score = 69
title = 'oceanus134 sections'

distance = 755
spam score = 55
title = 'ross sea nbp9701'

distance = 1125
spam score = 62
title = 'jgosf arabian sea study'

distance = 1125
spam score = 62
title = 'jgosf arabian sea study'

distance = 1136
spam score = 61
title = 'jgosf arabian sea study'

distance = 1136
spam score = 60
title = 'jgosf arabian sea study'

distance = 1136
spam score = 66
title = 'jgosf arabian sea study'

distance = 1148
spam score = 70
title = 'beamcppoc regressions for ross sea'

distance = 1504
spam score = 45
title = ''

distance = 1504
spam score = 46
title = ''

distance = 164
spam score = 94
title = ''

distance = 173
spam score = 95
title = ''

distance = 250
spam score = 93
title = ''

distance = 270
spam score = 93
title = ''

distance = 348
spam score = 95
title = ''

distance = 356
spam score = 92
title = ''

distance = 458
spam score = 94
title = ''

distance = 512
spam score = 94
title = ''

distance = 567
spam score = 95
title = ''

distance = 689
spam score = 93
title = ''

distance = 695
spam score = 94
title = ''

distance = 750
spam score = 91
title = ''

distance = 55
spam score = 16
title = 'companies starrydirectorycom'

distance = 82
spam score = 20
title = 'history starrydirectorycom'

distance = 82
spam score = 19
title = 'history starrydirectorycom'

distance = 84
spam score = 20
title = 'education starrydirectorycom'

distance = 89
spam score = 21
title = 'organizations starrydirectorycom'

distance = 89
spam score = 16
title = 'organizations starrydirectorycom'

distance = 89
spam score = 21
title = 'organizations starrydirectorycom'

distance = 89
spam score = 23
title = 'alternative starrydirectorycom'

distance = 89
spam score = 18
title = 'books starrydirectorycom'

distance = 89
spam score = 20
title = 'organizations starrydirectorycom'

distance = 94
spam score = 19
title = 'journals starrydirectorycom'

distance = 94
spam score = 21
title = 'nursing starrydirectorycom'

distance = 95
spam score = 19
title = 'news and media starrydirectorycom'

distance = 95
spam score = 19
title = 'news and media starrydirectorycom'

distance = 97
spam score = 18
title = 'institutes starrydirectorycom'

distance = 97
spam score = 21
title = 'institutes starrydirectorycom'

distance = 97
spam score = 18
title = 'institutes starrydirectorycom'

distance = 98
spam score = 22
title = 'aging starrydirectorycom'

distance = 98
spam score = 17
title = 'magazines starrydirectorycom'

distance = 101
spam score = 19
title = 'aids hiv starrydirectorycom'

distance = 168
spam score = 23
title = 'dissociative disorders starrydirectorycom'

distance = 168
spam score = 19
title = 'circumcision starrydirectorycom'

distance = 168
spam score = 19
title = 'audiology starrydirectorycom'

distance = 169
spam score = 19
title = 'knotting starrydirectorycom'

distance = 169
spam score = 20
title = 'infectious diseases starrydirectorycom'

distance = 169
spam score = 17
title = 'companies starrydirectorycom'

distance = 170
spam score = 17
title = 'nursing home care starrydirectorycom'

distance = 170
spam score = 19
title = 'neurology starrydirectorycom'

distance = 170
spam score = 18
title = 'collecting starrydirectorycom'

distance = 171
spam score = 20
title = 'impotence starrydirectorycom'

distance = 193
spam score = 18
title = 'health care starrydirectorycom'

distance = 194
spam score = 22
title = 'organizations starrydirectorycom'

distance = 194
spam score = 10
title = 'weight issues starrydirectorycom'

distance = 195
spam score = 19
title = 'foosball starrydirectorycom'

distance = 195
spam score = 20
title = 'myomectomy starrydirectorycom'

distance = 195
spam score = 20
title = 'environmental medicine starrydirectorycom'

distance = 195
spam score = 18
title = 'extracorporeal life support starrydirectorycom'

distance = 195
spam score = 19
title = 'child safety starrydirectorycom'

distance = 195
spam score = 22
title = 'dentistry starrydirectorycom'

distance = 195
spam score = 22
title = 'blood disorders starrydirectorycom'

distance = 214
spam score = 21
title = 'food allergies starrydirectorycom'

distance = 214
spam score = 19
title = 'web directories starrydirectorycom'

distance = 214
spam score = 18
title = 'eating disorders starrydirectorycom'

distance = 214
spam score = 19
title = 'models starrydirectorycom'

distance = 214
spam score = 18
title = 'epidural analgesia starrydirectorycom'

distance = 214
spam score = 17
title = 'statistics starrydirectorycom'

distance = 215
spam score = 18
title = 'nuclear medicine starrydirectorycom'

distance = 215
spam score = 19
title = 'events starrydirectorycom'

distance = 215
spam score = 19
title = 'biology starrydirectorycom'

distance = 215
spam score = 19
title = 'aviation and aerospace medicine starrydirectorycom'

distance = 233
spam score = 20
title = 'pregnancy and birth starrydirectorycom'

distance = 233
spam score = 17
title = 'ratings starrydirectorycom'

distance = 234
spam score = 20
title = 'news and media starrydirectorycom'

distance = 234
spam score = 15
title = 'penis enlargement starrydirectorycom'

distance = 234
spam score = 18
title = 'employment starrydirectorycom'

distance = 234
spam score = 20
title = 'risk analysis and management starrydirectorycom'

distance = 234
spam score = 15
title = 'home video starrydirectorycom'

distance = 235
spam score = 21
title = 'birth control starrydirectorycom'

distance = 235
spam score = 18
title = 'radiation and health physics starrydirectorycom'

distance = 237
spam score = 18
title = 'faqs starrydirectorycom'

distance = 262
spam score = 20
title = 'supplies and equipment starrydirectorycom'

distance = 262
spam score = 17
title = 'web directories starrydirectorycom'

distance = 262
spam score = 17
title = 'web directories starrydirectorycom'

distance = 262
spam score = 18
title = 'web directories starrydirectorycom'

distance = 263
spam score = 19
title = 'news and media starrydirectorycom'

distance = 263
spam score = 18
title = 'teen substance abuse starrydirectorycom'

distance = 263
spam score = 17
title = 'awards starrydirectorycom'

distance = 263
spam score = 20
title = 'fashion shows starrydirectorycom'

distance = 264
spam score = 18
title = 'shaken baby syndrome starrydirectorycom'

distance = 264
spam score = 19
title = 'photography starrydirectorycom'

distance = 281
spam score = 16
title = 'film and video starrydirectorycom'

distance = 281
spam score = 17
title = 'medline starrydirectorycom'

distance = 281
spam score = 18
title = 'jet engines starrydirectorycom'

distance = 282
spam score = 17
title = 'horror starrydirectorycom'

distance = 282
spam score = 20
title = 'rocks gems and minerals starrydirectorycom'

distance = 283
spam score = 14
title = 'games starrydirectorycom'

distance = 283
spam score = 21
title = 'hunting starrydirectorycom'

distance = 283
spam score = 19
title = 'roller hockey starrydirectorycom'

distance = 283
spam score = 15
title = 'gaming starrydirectorycom'

distance = 284
spam score = 19
title = 'inline skating starrydirectorycom'

distance = 310
spam score = 22
title = 'prom starrydirectorycom'

distance = 310
spam score = 16
title = 'publishing starrydirectorycom'

distance = 310
spam score = 18
title = 'web directories starrydirectorycom'

distance = 310
spam score = 17
title = 'web directories starrydirectorycom'

distance = 311
spam score = 18
title = 'internet broadcasts starrydirectorycom'

distance = 311
spam score = 20
title = 'talent and crew starrydirectorycom'

distance = 311
spam score = 20
title = 'news and media starrydirectorycom'

distance = 312
spam score = 20
title = 'home and garden starrydirectorycom'

distance = 312
spam score = 21
title = 'holidays and observances starrydirectorycom'

distance = 312
spam score = 12
title = 'diet analysis tools starrydirectorycom'

distance = 362
spam score = 19
title = 'conventions and trade shows starrydirectorycom'

distance = 362
spam score = 16
title = 'consumer information starrydirectorycom'

distance = 363
spam score = 18
title = 'web directories starrydirectorycom'

distance = 366
spam score = 16
title = 'video poker starrydirectorycom'

distance = 366
spam score = 19
title = 'dance therapy starrydirectorycom'

distance = 367
spam score = 18
title = 'studios and production companies starrydirectorycom'

distance = 369
spam score = 18
title = 'infant colic starrydirectorycom'

distance = 371
spam score = 11
title = 'television and movies starrydirectorycom'

distance = 371
spam score = 15
title = 'beauty pageants starrydirectorycom'

distance = 372
spam score = 16
title = 'employment starrydirectorycom'

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 35
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 34
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 0
spam score = 33
title = ''

distance = 1586
spam score = 36
title = ''

distance = 1762
spam score = 7
title = ''

distance = 1762
spam score = 39
title = ''

distance = 1806
spam score = 50
title = ''

distance = 1856
spam score = 7
title = ''

distance = 75
spam score = 44
title = 'simpleviewer'

distance = 75
spam score = 41
title = 'simpleviewer'

distance = 80
spam score = 35
title = 'simpleviewer'

distance = 80
spam score = 34
title = 'simpleviewer'

distance = 94
spam score = 40
title = 'simpleviewer'

distance = 96
spam score = 37
title = 'simpleviewer'

distance = 96
spam score = 37
title = 'simpleviewer'

distance = 99
spam score = 40
title = 'simpleviewer'

distance = 103
spam score = 38
title = 'simpleviewer'

distance = 103
spam score = 40
title = 'simpleviewer'

distance = 105
spam score = 32
title = 'simpleviewer'

distance = 110
spam score = 35
title = 'simpleviewer'

distance = 116
spam score = 37
title = 'simpleviewer'

distance = 116
spam score = 37
title = 'simpleviewer'

distance = 117
spam score = 37
title = 'francis'

distance = 117
spam score = 33
title = 'simpleviewer'

distance = 117
spam score = 38
title = 'francis'

distance = 123
spam score = 50
title = 'c2006'

distance = 123
spam score = 41
title = 'simpleviewer'

distance = 123
spam score = 40
title = 'simpleviewer'

distance = 158
spam score = 40
title = 'simpleviewer'

distance = 158
spam score = 41
title = 'simpleviewer'

distance = 158
spam score = 40
title = 'simpleviewer'

distance = 158
spam score = 40
title = 'simpleviewer'

distance = 158
spam score = 40
title = 'simpleviewer'

distance = 158
spam score = 40
title = 'simpleviewer'

distance = 158
spam score = 41
title = 'simpleviewer'

distance = 158
spam score = 41
title = 'simpleviewer'

distance = 158
spam score = 41
title = 'simpleviewer'

distance = 158
spam score = 41
title = 'simpleviewer'

distance = 159
spam score = 48
title = ''

distance = 159
spam score = 48
title = ''

distance = 159
spam score = 48
title = ''

distance = 159
spam score = 49
title = ''

distance = 159
spam score = 49
title = ''

distance = 159
spam score = 49
title = ''

distance = 159
spam score = 50
title = ''

distance = 159
spam score = 49
title = ''

distance = 159
spam score = 48
title = ''

distance = 159
spam score = 50
title = ''

distance = 184
spam score = 49
title = ''

distance = 185
spam score = 49
title = ''

distance = 185
spam score = 49
title = ''

distance = 185
spam score = 49
title = ''

distance = 185
spam score = 50
title = ''

distance = 185
spam score = 38
title = 'simpleviewer'

distance = 185
spam score = 37
title = 'simpleviewer'

distance = 185
spam score = 45
title = 'varie'

distance = 185
spam score = 49
title = ''

distance = 186
spam score = 35
title = 'simpleviewer'

distance = 214
spam score = 35
title = 'simpleviewer'

distance = 214
spam score = 41
title = 'dagvanderegio'

distance = 215
spam score = 43
title = 'grenzen'

distance = 215
spam score = 36
title = 'originaledekorativ'

distance = 215
spam score = 43
title = 'grenzen'

distance = 216
spam score = 41
title = 'all about 50 classics'

distance = 216
spam score = 38
title = 'simpleviewer'

distance = 216
spam score = 46
title = 'simpleviewer'

distance = 216
spam score = 46
title = 'simpleviewer'

distance = 216
spam score = 40
title = ''

distance = 283
spam score = 43
title = 'ellusionist shadow masters custom bicycle deck gallery'

distance = 284
spam score = 42
title = 'vidwan vittal sirs gallery'

distance = 284
spam score = 40
title = 'avesid chicas y chicos'

distance = 284
spam score = 48
title = 'kantine silvester 2008'

distance = 284
spam score = 42
title = 'vidwan vittal sirs gallery'

distance = 290
spam score = 34
title = 'v navaratnam memorial'

distance = 290
spam score = 34
title = 'anton balasingham memorial'

distance = 291
spam score = 35
title = 'maheswaran memorial'

distance = 293
spam score = 30
title = 'gala dinner pics'

distance = 297
spam score = 32
title = 'simpleviewer'

distance = 382
spam score = 32
title = 'simpleviewer'

distance = 385
spam score = 40
title = ''

distance = 386
spam score = 44
title = 'sarah giannobile'

distance = 386
spam score = 44
title = 'sarah giannobile'

distance = 388
spam score = 43
title = 'reykjavik iceland 2007 new lens and karis party'

distance = 390
spam score = 38
title = 'avesid galeria de fotos parque el caballito'

distance = 391
spam score = 39
title = ''

distance = 393
spam score = 32
title = '24h du mans 2010'

distance = 393
spam score = 42
title = 'site title'

distance = 393
spam score = 42
title = 'site title'

distance = 568
spam score = 31
title = 'flora herfst'

distance = 571
spam score = 33
title = 'simpleviewer'

distance = 581
spam score = 25
title = 'simpleviewer'

distance = 581
spam score = 26
title = 'simpleviewer'

distance = 581
spam score = 44
title = 'stage raku fbl janvier 2011'

distance = 586
spam score = 29
title = 'simpleviewer'

distance = 587
spam score = 31
title = 'simpleviewer'

distance = 587
spam score = 31
title = 'simpleviewer'

distance = 590
spam score = 35
title = 'autoviewer'

distance = 590
spam score = 36
title = 'autoviewer'

distance = 861
spam score = 29
title = 'weddingphotos'

distance = 864
spam score = 62
title = 'ottawa photographer david knox wedding'

distance = 873
spam score = 37
title = 'weddings in various locations'

distance = 873
spam score = 36
title = 'weddings in various locations'

distance = 875
spam score = 46
title = 'fantastic friday calypso semi finals'

distance = 876
spam score = 44
title = 'miss svg 2011 contestants at young island resort'

distance = 876
spam score = 46
title = 'landschapsfotografie'

distance = 876
spam score = 47
title = 'landschapsfotografie'

distance = 877
spam score = 34
title = ''

distance = 877
spam score = 35
title = ''

distance = 1544
spam score = 27
title = ''

distance = 1557
spam score = 63
title = 'hobos bearded collie chat'

distance = 1749
spam score = 76
title = 'verney carron hunting guns semiautomatic rifle guns and rifles'

distance = 1781
spam score = 76
title = 'verney carron hunting guns semiautomatic rifle guns and rifles'

distance = 42
spam score = 55
title = ''

distance = 49
spam score = 56
title = ''

distance = 75
spam score = 55
title = ''

distance = 75
spam score = 55
title = ''

distance = 81
spam score = 58
title = ''

distance = 83
spam score = 56
title = ''

distance = 139
spam score = 57
title = ''

distance = 174
spam score = 56
title = ''

distance = 184
spam score = 55
title = ''

distance = 206
spam score = 55
title = ''

distance = 211
spam score = 54
title = ''

distance = 216
spam score = 54
title = ''

distance = 224
spam score = 55
title = ''

distance = 226
spam score = 55
title = ''

distance = 1818
spam score = 69
title = ''

distance = 198
spam score = 51
title = ''

distance = 201
spam score = 50
title = ''

distance = 207
spam score = 51
title = ''

distance = 215
spam score = 51
title = ''

distance = 226
spam score = 50
title = ''

distance = 229
spam score = 51
title = ''

distance = 230
spam score = 49
title = ''

distance = 230
spam score = 52
title = ''

distance = 231
spam score = 50
title = ''

distance = 232
spam score = 50
title = ''

distance = 235
spam score = 54
title = ''

distance = 235
spam score = 52
title = ''

distance = 237
spam score = 51
title = ''

distance = 239
spam score = 48
title = ''

distance = 240
spam score = 51
title = ''

distance = 241
spam score = 51
title = ''

distance = 243
spam score = 52
title = ''

distance = 245
spam score = 51
title = ''

distance = 246
spam score = 50
title = ''

distance = 248
spam score = 49
title = ''

distance = 249
spam score = 52
title = ''

distance = 249
spam score = 52
title = ''

distance = 251
spam score = 52
title = ''

distance = 253
spam score = 52
title = ''

distance = 255
spam score = 53
title = ''

distance = 257
spam score = 52
title = ''

distance = 257
spam score = 50
title = ''

distance = 260
spam score = 51
title = ''

distance = 261
spam score = 50
title = ''

distance = 264
spam score = 51
title = ''

distance = 265
spam score = 51
title = ''

distance = 266
spam score = 51
title = ''

distance = 270
spam score = 50
title = ''

distance = 276
spam score = 54
title = ''

distance = 277
spam score = 53
title = ''

distance = 277
spam score = 52
title = ''

distance = 278
spam score = 53
title = ''

distance = 281
spam score = 55
title = ''

distance = 284
spam score = 52
title = ''

distance = 285
spam score = 47
title = ''

distance = 285
spam score = 50
title = ''

distance = 291
spam score = 53
title = ''

distance = 291
spam score = 51
title = ''

distance = 291
spam score = 50
title = ''

distance = 293
spam score = 53
title = ''

distance = 294
spam score = 53
title = ''

distance = 296
spam score = 50
title = ''

distance = 298
spam score = 53
title = ''

distance = 298
spam score = 51
title = ''

distance = 300
spam score = 53
title = ''

distance = 302
spam score = 51
title = ''

distance = 303
spam score = 50
title = ''

distance = 305
spam score = 53
title = ''

distance = 306
spam score = 53
title = ''

distance = 307
spam score = 52
title = ''

distance = 315
spam score = 50
title = ''

distance = 317
spam score = 49
title = ''

distance = 318
spam score = 49
title = ''

distance = 319
spam score = 50
title = ''

distance = 321
spam score = 56
title = ''

distance = 321
spam score = 50
title = ''

distance = 323
spam score = 51
title = ''

distance = 325
spam score = 51
title = ''

distance = 329
spam score = 52
title = ''

distance = 333
spam score = 50
title = ''

distance = 333
spam score = 51
title = ''

distance = 334
spam score = 53
title = ''

distance = 340
spam score = 52
title = ''

distance = 340
spam score = 50
title = ''

distance = 344
spam score = 51
title = ''

distance = 353
spam score = 51
title = ''

distance = 353
spam score = 48
title = ''

distance = 360
spam score = 51
title = ''

distance = 361
spam score = 55
title = ''

distance = 368
spam score = 53
title = ''

distance = 371
spam score = 53
title = ''

distance = 371
spam score = 48
title = ''

distance = 382
spam score = 50
title = ''

distance = 384
spam score = 53
title = ''

distance = 389
spam score = 50
title = ''

distance = 408
spam score = 53
title = ''

distance = 412
spam score = 51
title = ''

distance = 415
spam score = 53
title = ''

distance = 431
spam score = 55
title = ''

distance = 449
spam score = 53
title = ''

distance = 452
spam score = 55
title = ''

distance = 483
spam score = 49
title = ''

distance = 492
spam score = 53
title = ''

distance = 506
spam score = 50
title = ''

distance = 524
spam score = 51
title = ''

distance = 654
spam score = 53
title = ''

distance = 1165
spam score = 42
title = ''

distance = 1711
spam score = 15
title = ''

distance = 1777
spam score = 9
title = ''

distance = 1809
spam score = 17
title = ''

distance = 1866
spam score = 41
title = ''

distance = 5
spam score = 1
title = '100 u2 lyrics 2011 new albums and songs'

distance = 5
spam score = 2
title = '100 nerd lyrics 2011 new albums and songs'

distance = 5
spam score = 2
title = '100 apartment 26 lyrics 2011 new albums and songs'

distance = 5
spam score = 5
title = '100 stun lyrics 2011 new albums and songs'

distance = 5
spam score = 5
title = '100 slab lyrics 2011 new albums and songs'

distance = 5
spam score = 4
title = '100 him lyrics 2010 new albums and songs'

distance = 5
spam score = 4
title = '100 us5 lyrics 2011 new albums and songs'

distance = 5
spam score = 2
title = '100 pod lyrics 2011 new albums and songs'

distance = 5
spam score = 4
title = '100 all 4 one lyrics 2011 new albums and songs'

distance = 5
spam score = 4
title = '100 yes lyrics 2011 new albums and songs'

distance = 5
spam score = 4
title = '100 six4one lyrics 2011 new albums and songs'

distance = 5
spam score = 4
title = '100 upo lyrics 2011 new albums and songs'

distance = 5
spam score = 5
title = '100 gogos lyrics 2010 new albums and songs'

distance = 37
spam score = 4
title = '100 ok go lyrics 2011 new albums and songs'

distance = 65
spam score = 2
title = '100 d12 lyrics 2011 new albums and songs'

distance = 65
spam score = 5
title = '100 100 years lyrics 2011 new albums and songs'

distance = 65
spam score = 5
title = '100 dht lyrics 2010 new albums and songs'

distance = 65
spam score = 4
title = '100 112 f ti lyrics 2011 new albums and songs'

distance = 65
spam score = 1
title = '100 112 lyrics 2011 new albums and songs'

distance = 65
spam score = 4
title = '100 213 lyrics 2011 new albums and songs'

distance = 110
spam score = 5
title = '100 swampdawam lyrics 2011 new albums and songs'

distance = 110
spam score = 5
title = '100 slab f tc kendro lyrics 2011 new albums and songs'

distance = 111
spam score = 4
title = '100 atomship lyrics 2011 new albums and songs'

distance = 111
spam score = 2
title = '100 omarion lyrics 2011 new albums and songs'

distance = 114
spam score = 4
title = '100 ahanti lyrics 2011 new albums and songs'

distance = 126
spam score = 7
title = '100 new song lyrics 2011 new albums and songs'

distance = 132
spam score = 4
title = '100 112 f ludacris lyrics 2011 new albums and songs'

distance = 135
spam score = 5
title = '100 last ketchup lyrics 2011 new albums and songs'

distance = 139
spam score = 1
title = '100 dido lyrics 2010 new albums and songs'

distance = 139
spam score = 5
title = '100 nonstop lyrics 2011 new albums and songs'

distance = 172
spam score = 4
title = '100 severine ferrer lyrics 2011 new albums and songs'

distance = 172
spam score = 5
title = '100 james ingram lyrics 2011 new albums and songs'

distance = 172
spam score = 1
title = '100 hardfi lyrics 2010 new albums and songs'

distance = 172
spam score = 4
title = '100 alkaline trio lyrics 2011 new albums and songs'

distance = 172
spam score = 2
title = '100 allison krausse lyrics 2011 new albums and songs'

distance = 172
spam score = 5
title = '100 jagged edge lyrics 2011 new albums and songs'

distance = 173
spam score = 4
title = '100 youngbloodz f backbone lyrics 2011 new albums and songs'

distance = 173
spam score = 5
title = '100 silvia night lyrics 2011 new albums and songs'

distance = 173
spam score = 5
title = '100 lucie silvas lyrics 2011 new albums and songs'

distance = 173
spam score = 3
title = '100 young gunz lyrics 2011 new albums and songs'

distance = 181
spam score = 4
title = '100 young chris lyrics 2011 new albums and songs'

distance = 181
spam score = 5
title = '100 shiri maimon lyrics 2011 new albums and songs'

distance = 182
spam score = 4
title = '100 ghostface f jadakiss lyrics 2010 new albums and songs'

distance = 182
spam score = 1
title = '100 leann rimes lyrics 2011 new albums and songs'

distance = 182
spam score = 2
title = '100 angie stone lyrics 2011 new albums and songs'

distance = 182
spam score = 2
title = '100 anthony hamilton lyrics 2011 new albums and songs'

distance = 182
spam score = 5
title = '100 gin wigmore lyrics 2010 new albums and songs'

distance = 182
spam score = 5
title = '100 ace of base lyrics 2011 new albums and songs'

distance = 182
spam score = 2
title = '100 sistem of a down lyrics 2011 new albums and songs'

distance = 182
spam score = 5
title = '100 geir ronning lyrics 2010 new albums and songs'

distance = 192
spam score = 4
title = '100 jessica simpson lyrics 2011 new albums and songs'

distance = 193
spam score = 5
title = '100 led zepplin lyrics 2011 new albums and songs'

distance = 193
spam score = 5
title = '100 justin timberlake lyrics 2011 new albums and songs'

distance = 193
spam score = 5
title = '100 art garfunkel lyrics 2011 new albums and songs'

distance = 193
spam score = 4
title = '100 aaron lines lyrics 2011 new albums and songs'

distance = 193
spam score = 5
title = '100 aaliyah f timbaland lyrics 2011 new albums and songs'

distance = 194
spam score = 5
title = '100 joy division lyrics 2011 new albums and songs'

distance = 194
spam score = 5
title = '100 loquillo and trogloditas lyrics 2011 new albums and songs'

distance = 194
spam score = 5
title = '100 johnny cash lyrics 2011 new albums and songs'

distance = 194
spam score = 5
title = '100 larry graham lyrics 2011 new albums and songs'

distance = 237
spam score = 4
title = '100 dan fogelberg lyrics 2011 new albums and songs'

distance = 237
spam score = 3
title = '100 dashboard confessional lyrics 2010 new albums and songs'

distance = 239
spam score = 5
title = '100 nu flavor lyrics 2011 new albums and songs'

distance = 239
spam score = 2
title = '100 vanilla ice lyrics 2011 new albums and songs'

distance = 239
spam score = 4
title = '100 natalia podolskaya lyrics 2011 new albums and songs'

distance = 240
spam score = 5
title = '100 fefe dobson lyrics 2010 new albums and songs'

distance = 240
spam score = 5
title = '100 dolly parton lyrics 2010 new albums and songs'

distance = 240
spam score = 4
title = '100 vivian green lyrics 2011 new albums and songs'

distance = 240
spam score = 4
title = '100 davey brothers lyrics 2010 new albums and songs'

distance = 240
spam score = 3
title = '100 zona jones lyrics 2011 new albums and songs'

distance = 275
spam score = 4
title = '100 ashanti f black child lyrics 2011 new albums and songs'

distance = 276
spam score = 4
title = '100 paid in full f paul wall lyrics 2011 new albums and songs'

distance = 276
spam score = 4
title = '100 omarion f big boi lyrics 2011 new albums and songs'

distance = 277
spam score = 3
title = '100 alicia keys f lellow lyrics 2011 new albums and songs'

distance = 277
spam score = 1
title = '100 american hifi lyrics 2011 new albums and songs'

distance = 277
spam score = 4
title = '100 ali f murphey lee lyrics 2011 new albums and songs'

distance = 278
spam score = 5
title = '100 young rome f oryan lyrics 2011 new albums and songs'

distance = 279
spam score = 5
title = '100 lenny kravitz f jayz lyrics 2011 new albums and songs'

distance = 280
spam score = 5
title = '100 obie trice f timbaland lyrics 2011 new albums and songs'

distance = 282
spam score = 4
title = '100 young buck f 50 cent lyrics 2011 new albums and songs'

distance = 418
spam score = 4
title = '100 outkast f sleepy brown jazze pha lyrics 2011 new albums and songs'

distance = 424
spam score = 4
title = '100 lee ryan blue leadsinger lyrics 2011 new albums and songs'

distance = 430
spam score = 4
title = '100 young sicc f mr lil one youngstah lyrics 2011 new albums and songs'

distance = 431
spam score = 3
title = '100 young steff featuring bow wow lyrics 2011 new albums and songs'

distance = 435
spam score = 4
title = '100 ja rule f fat joe jadakiss lyrics 2010 new albums and songs'

distance = 437
spam score = 4
title = '100 angie martinez f lil mo sacario lyrics 2011 new albums and songs'

distance = 437
spam score = 5
title = '100 outkast f khujo goodie ceelo lyrics 2011 new albums and songs'

distance = 438
spam score = 4
title = '100 nappy roots f ying yang twins lyrics 2011 new albums and songs'

distance = 439
spam score = 4
title = '100 p diddy f mario winans loon ginuwine lyrics 2011 new albums and songs'

distance = 439
spam score = 5
title = '100 slab f zro archie lee lil c mr 32 lyrics 2011 new albums and songs'

distance = 761
spam score = 1
title = 'arsenium feat natalia gordienko connectr loca lyrics'

distance = 774
spam score = 4
title = '100 young buck f 50 cent daz dillinger lloyd banks snoop dogg supafly lyrics 2011 new albums and songs'

distance = 779
spam score = 0
title = 'eurovision 2008 song contest nico vlad peo margine de lume lyrics'

distance = 806
spam score = 0
title = 'eurovision 2008 song contest simon mathew all night long lyrics'

distance = 809
spam score = 0
title = 'eurovision 2008 song contest dustin the turkey irelande douze pointe lyrics'

distance = 810
spam score = 1
title = 'kittie brackish lyrics'

distance = 842
spam score = 5
title = '100 dame dash kanye west beanie sigel camron young chris twista dream team lyrics 2011 new albums and songs'

distance = 892
spam score = 0
title = 'eurovision 2008 song contest tamara vrcak adrijan let me love you lyrics'

distance = 918
spam score = 2
title = 'crazi frog in the 80 lyrics'

distance = 918
spam score = 2
title = 'crazi frog ymca lyrics'

distance = 1764
spam score = 1
title = 'withering surface lyrics'

distance = 1779
spam score = 2
title = 'xwild lyrics'

distance = 1810
spam score = 1
title = 'dawn of relic lyrics'

distance = 1811
spam score = 2
title = 'dies ater lyrics'

distance = 219
spam score = 79
title = 'white grape varieties baltsiki'

distance = 239
spam score = 79
title = 'white grape varieties kouri'

distance = 255
spam score = 79
title = 'white grape varieties svarna'

distance = 276
spam score = 80
title = 'white grape varieties sapountzis'

distance = 277
spam score = 79
title = 'white grape varieties blachanova'

distance = 278
spam score = 80
title = 'white grape varieties samia'

distance = 280
spam score = 80
title = 'white grape varieties sourla'

distance = 283
spam score = 80
title = 'white grape varieties dafnia'

distance = 283
spam score = 80
title = 'white grape varieties biritsia'

distance = 286
spam score = 80
title = 'white grape varieties areti'

distance = 293
spam score = 80
title = 'white grape varieties pance jaune'

distance = 301
spam score = 78
title = 'white grape varieties pyriki'

distance = 303
spam score = 79
title = 'white grape varieties lefko'

distance = 303
spam score = 80
title = 'white grape varieties tsilores'

distance = 305
spam score = 79
title = 'white grape varieties agrida'

distance = 311
spam score = 80
title = 'white grape varieties voska'

distance = 316
spam score = 80
title = 'white grape varieties tryferapodia'

distance = 317
spam score = 79
title = 'white grape varieties patines'

distance = 317
spam score = 79
title = 'white grape varieties chlori'

distance = 320
spam score = 79
title = 'white grape varieties georgouli'

distance = 350
spam score = 78
title = 'white grape varieties lagovizi'

distance = 352
spam score = 79
title = 'white grape varieties katsano'

distance = 359
spam score = 79
title = 'white grape varieties kokkithari'

distance = 360
spam score = 81
title = 'white grape varieties dafnato'

distance = 362
spam score = 80
title = 'white grape varieties melissa'

distance = 364
spam score = 79
title = 'white grape varieties saki'

distance = 366
spam score = 80
title = 'white grape varieties ravistra'

distance = 367
spam score = 80
title = 'aspro grape varieties asprofilero'

distance = 368
spam score = 80
title = 'white grape varieties xouvlaratos'

distance = 370
spam score = 79
title = 'white grape varieties xeropodia'

distance = 384
spam score = 79
title = 'white grape varieties xylopodia'

distance = 384
spam score = 80
title = 'white grape varieties tsoupi'

distance = 390
spam score = 81
title = 'white grape varieties lefko ntopio'

distance = 394
spam score = 78
title = 'white grape varieties chondrasprouda'

distance = 396
spam score = 79
title = 'white grape varieties bastardiko'

distance = 397
spam score = 80
title = 'white grape varieties flaskato'

distance = 399
spam score = 80
title = 'white grape varieties flora'

distance = 401
spam score = 80
title = 'white grape varieties gretzelo'

distance = 402
spam score = 78
title = 'white grape varieties makrypodia'

distance = 403
spam score = 81
title = 'white grape varieties tsougiannides'

distance = 414
spam score = 79
title = 'white grape varieties aspro opsimo'

distance = 414
spam score = 79
title = 'white grape varieties malamezia'

distance = 414
spam score = 80
title = 'red grape varieties vidiano'

distance = 424
spam score = 80
title = 'rose grape varieties akaki'

distance = 424
spam score = 79
title = 'white grape varieties agrioglykada'

distance = 426
spam score = 78
title = 'white grape varieties petrogoumastos'

distance = 427
spam score = 80
title = 'white grape varieties sani lefko'

distance = 428
spam score = 82
title = 'white grape varieties rousa'

distance = 430
spam score = 80
title = 'white grape varieties chasani'

distance = 432
spam score = 80
title = 'white grape varieties voulgariko'

distance = 444
spam score = 81
title = 'white grape varieties koutsoumpeli'

distance = 446
spam score = 79
title = 'white grape varieties sklava'

distance = 447
spam score = 78
title = 'white grape varieties aspropotamisia'

distance = 449
spam score = 79
title = 'white grape varieties lemonostafylo'

distance = 449
spam score = 81
title = 'white grape varieties tryfera'

distance = 451
spam score = 80
title = 'white grape varieties karydato lefko'

distance = 454
spam score = 79
title = 'white grape varieties kaniskadiano'

distance = 455
spam score = 80
title = 'white grape varieties lianospyriko'

distance = 457
spam score = 78
title = 'white grape varieties aspromandylaria'

distance = 458
spam score = 78
title = 'white grape varieties maloukato'

distance = 468
spam score = 79
title = 'white grape varieties nerostafylo'

distance = 471
spam score = 79
title = 'white grape varieties aspro proimo'

distance = 474
spam score = 79
title = 'white grape varieties askathari'

distance = 476
spam score = 77
title = 'white grape varietiesamerikaniko'

distance = 476
spam score = 80
title = 'white grape varieties keserlidiko'

distance = 486
spam score = 80
title = 'white grape varieties aspri papadia'

distance = 489
spam score = 80
title = 'white grape varieties glykeri lefko'

distance = 494
spam score = 79
title = 'white grape varieties aspro komotinis'

distance = 499
spam score = 80
title = 'white grape varieties laorkos'

distance = 503
spam score = 80
title = 'white grape varieties divromo'

distance = 517
spam score = 80
title = 'white grape varieties asprofilero no 13'

distance = 521
spam score = 80
title = 'white grape varieties vaftra aspri'

distance = 522
spam score = 80
title = 'white grape varieties glykerithra'

distance = 522
spam score = 81
title = 'white grape varieties asyrtiko'

distance = 528
spam score = 78
title = 'white grape varieties goumasi lianorago'

distance = 532
spam score = 79
title = 'white grape varieties moschopatata'

distance = 537
spam score = 80
title = 'white grape varieties mygdali'

distance = 540
spam score = 79
title = 'white grape varieties klimataria protis'

distance = 541
spam score = 78
title = 'white grape varieties cheimoniatiko kyprou'

distance = 545
spam score = 82
title = 'red grape varieties vranizades'

distance = 562
spam score = 82
title = 'red grape varieties draganitis'

distance = 566
spam score = 80
title = 'white grape varieties serifiotiko'

distance = 570
spam score = 81
title = 'white grape varieties kakotrygis'

distance = 570
spam score = 77
title = 'whte grape varieties aftogiouli chondrorago'

distance = 571
spam score = 79
title = 'red grape varieties mavreli'

distance = 574
spam score = 79
title = 'white grape varieties zacharo'

distance = 580
spam score = 81
title = 'white grape varieties kritiko lefko'

distance = 580
spam score = 79
title = 'white grape varieties malagouzia'

distance = 581
spam score = 79
title = 'white grape varieties moschato kerkyras'

distance = 585
spam score = 80
title = 'white grape varieties asprouda spetson'

distance = 610
spam score = 79
title = 'white grape varieties asprouda messinias'

distance = 617
spam score = 79
title = 'white grape varieties koukouli'

distance = 643
spam score = 80
title = 'white grape varieties asprouda chalkidos'

distance = 649
spam score = 82
title = 'white grape varieties dempina'

distance = 661
spam score = 77
title = 'white grape varieties monemvasia megaloragi'

distance = 668
spam score = 81
title = 'white grape varieties asprouda patron santameriana'

distance = 680
spam score = 81
title = 'white grape varieties potamisio lefko'

distance = 685
spam score = 82
title = 'white grape varieties rompola'

distance = 698
spam score = 81
title = 'rose grape varieties tourkopoula'

distance = 700
spam score = 81
title = 'white grape varieties asprouda santorinis'

distance = 805
spam score = 78
title = 'white grape varieties vertzami lefko'

distance = 813
spam score = 82
title = 'red grape varieties mavro mesenikolas'

distance = 834
spam score = 82
title = 'red grape varieties liatiko agias babaras'

distance = 862
spam score = 82
title = 'red grape varieties zalovitiko'

distance = 876
spam score = 80
title = 'red grape varieties karampraiumlmis'

distance = 876
spam score = 82
title = 'white grape varieties athiri'

distance = 1184
spam score = 61
title = 'white grape varieties priknadi'

distance = 44
spam score = 11
title = ''

distance = 44
spam score = 11
title = ''

distance = 81
spam score = 11
title = ''

distance = 81
spam score = 11
title = ''

distance = 98
spam score = 11
title = ''

distance = 104
spam score = 11
title = ''

distance = 124
spam score = 11
title = ''

distance = 133
spam score = 12
title = ''

distance = 142
spam score = 11
title = ''

distance = 144
spam score = 11
title = ''

distance = 144
spam score = 11
title = ''

distance = 144
spam score = 11
title = ''

distance = 144
spam score = 12
title = ''

distance = 144
spam score = 12
title = ''

distance = 144
spam score = 11
title = ''

distance = 144
spam score = 12
title = ''

distance = 144
spam score = 11
title = ''

distance = 144
spam score = 11
title = ''

distance = 144
spam score = 12
title = ''

distance = 144
spam score = 11
title = ''

distance = 144
spam score = 12
title = ''

distance = 144
spam score = 12
title = ''

distance = 144
spam score = 12
title = ''

distance = 145
spam score = 12
title = ''

distance = 150
spam score = 10
title = ''

distance = 150
spam score = 10
title = ''

distance = 155
spam score = 11
title = ''

distance = 156
spam score = 10
title = ''

distance = 156
spam score = 10
title = ''

distance = 156
spam score = 10
title = ''

distance = 156
spam score = 10
title = ''

distance = 156
spam score = 11
title = ''

distance = 156
spam score = 11
title = ''

distance = 156
spam score = 11
title = ''

distance = 156
spam score = 10
title = ''

distance = 160
spam score = 10
title = ''

distance = 163
spam score = 11
title = ''

distance = 173
spam score = 11
title = ''

distance = 177
spam score = 10
title = ''

distance = 178
spam score = 9
title = ''

distance = 178
spam score = 9
title = ''

distance = 178
spam score = 10
title = ''

distance = 178
spam score = 9
title = ''

distance = 178
spam score = 10
title = ''

distance = 185
spam score = 11
title = ''

distance = 186
spam score = 12
title = ''

distance = 191
spam score = 11
title = ''

distance = 192
spam score = 10
title = ''

distance = 192
spam score = 12
title = ''

distance = 192
spam score = 11
title = ''

distance = 194
spam score = 10
title = ''

distance = 198
spam score = 10
title = ''

distance = 199
spam score = 12
title = ''

distance = 201
spam score = 11
title = ''

distance = 202
spam score = 10
title = ''

distance = 202
spam score = 10
title = ''

distance = 203
spam score = 12
title = ''

distance = 205
spam score = 11
title = ''

distance = 210
spam score = 11
title = ''

distance = 212
spam score = 11
title = ''

distance = 214
spam score = 10
title = ''

distance = 214
spam score = 10
title = ''

distance = 223
spam score = 9
title = ''

distance = 224
spam score = 10
title = ''

distance = 225
spam score = 10
title = ''

distance = 238
spam score = 11
title = ''

distance = 241
spam score = 10
title = ''

distance = 1230
spam score = 3
title = ''

distance = 1254
spam score = 16
title = ''

distance = 1376
spam score = 46
title = ''

distance = 1497
spam score = 56
title = ''

distance = 1597
spam score = 21
title = ''

distance = 1823
spam score = 1
title = ''

distance = 1823
spam score = 1
title = ''

distance = 134
spam score = 82
title = ''

distance = 147
spam score = 83
title = ''

distance = 152
spam score = 83
title = ''

distance = 177
spam score = 83
title = ''

distance = 189
spam score = 83
title = ''

distance = 196
spam score = 83
title = ''

distance = 212
spam score = 83
title = ''

distance = 230
spam score = 83
title = ''

distance = 233
spam score = 83
title = ''

distance = 235
spam score = 82
title = ''

distance = 236
spam score = 81
title = ''

distance = 236
spam score = 83
title = ''

distance = 237
spam score = 81
title = ''

distance = 240
spam score = 81
title = ''

distance = 240
spam score = 81
title = ''

distance = 242
spam score = 82
title = ''

distance = 245
spam score = 82
title = ''

distance = 249
spam score = 82
title = ''

distance = 259
spam score = 82
title = ''

distance = 260
spam score = 83
title = ''

distance = 290
spam score = 82
title = ''

distance = 304
spam score = 82
title = ''

distance = 337
spam score = 83
title = ''

distance = 369
spam score = 82
title = ''

distance = 369
spam score = 83
title = ''

distance = 370
spam score = 81
title = ''

distance = 394
spam score = 82
title = ''

distance = 397
spam score = 82
title = ''

distance = 401
spam score = 82
title = ''

distance = 439
spam score = 82
title = ''

distance = 443
spam score = 84
title = ''

distance = 475
spam score = 86
title = ''

distance = 504
spam score = 83
title = ''

distance = 508
spam score = 86
title = ''

distance = 535
spam score = 85
title = ''

distance = 542
spam score = 83
title = ''

distance = 563
spam score = 84
title = ''

distance = 638
spam score = 83
title = ''

distance = 656
spam score = 83
title = ''

distance = 697
spam score = 84
title = ''

distance = 704
spam score = 81
title = ''

distance = 709
spam score = 88
title = ''

distance = 711
spam score = 84
title = ''

distance = 1411
spam score = 62
title = ''

distance = 1498
spam score = 65
title = ''

distance = 489
spam score = 0
title = ''

distance = 511
spam score = 1
title = ''

distance = 87
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 526'

distance = 92
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 91'

distance = 92
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 12'

distance = 98
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 53'

distance = 102
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 115'

distance = 103
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 74'

distance = 104
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 181'

distance = 105
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 75'

distance = 105
spam score = 69
title = 'the genealogy of one vermonter darrell a martin single surname index 318'

distance = 106
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 342'

distance = 106
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 122'

distance = 107
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 457'

distance = 107
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 413'

distance = 110
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 151'

distance = 111
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 569'

distance = 111
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 322'

distance = 111
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 144'

distance = 112
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 410'

distance = 112
spam score = 74
title = 'the genealogy of one vermonter darrell a martin single surname index 592'

distance = 112
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 327'

distance = 158
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 633'

distance = 159
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 180'

distance = 160
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 590'

distance = 160
spam score = 69
title = 'the genealogy of one vermonter darrell a martin single surname index 154'

distance = 161
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 587'

distance = 162
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 58'

distance = 162
spam score = 76
title = 'the genealogy of one vermonter darrell a martin single surname index 51'

distance = 163
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 222'

distance = 163
spam score = 69
title = 'the genealogy of one vermonter darrell a martin single surname index 338'

distance = 164
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 492'

distance = 192
spam score = 77
title = 'the genealogy of one vermonter darrell a martin single surname index 98'

distance = 194
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 25'

distance = 194
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 4'

distance = 194
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 223'

distance = 195
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 440'

distance = 195
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 631'

distance = 196
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 337'

distance = 196
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 282'

distance = 197
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 235'

distance = 197
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 266'

distance = 221
spam score = 74
title = 'the genealogy of one vermonter darrell a martin single surname index 200'

distance = 222
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 407'

distance = 222
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 532'

distance = 222
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 26'

distance = 222
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 419'

distance = 222
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 558'

distance = 222
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 93'

distance = 223
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 585'

distance = 223
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 111'

distance = 224
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 168'

distance = 252
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 468'

distance = 252
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 423'

distance = 253
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 369'

distance = 254
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 604'

distance = 255
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 573'

distance = 256
spam score = 77
title = 'the genealogy of one vermonter darrell a martin single surname index 560'

distance = 256
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 496'

distance = 256
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 638'

distance = 256
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 609'

distance = 258
spam score = 69
title = 'the genealogy of one vermonter darrell a martin single surname index 163'

distance = 309
spam score = 69
title = 'the genealogy of one vermonter darrell a martin single surname index 430'

distance = 310
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 251'

distance = 311
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 364'

distance = 312
spam score = 67
title = 'the genealogy of one vermonter darrell a martin single surname index 333'

distance = 313
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 18'

distance = 316
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 392'

distance = 316
spam score = 69
title = 'the genealogy of one vermonter darrell a martin single surname index 403'

distance = 316
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 478'

distance = 317
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 44'

distance = 318
spam score = 73
title = 'the genealogy of one vermonter darrell a martin single surname index 641'

distance = 385
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 309'

distance = 386
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 33'

distance = 389
spam score = 75
title = 'the genealogy of one vermonter darrell a martin single surname index 361'

distance = 391
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 320'

distance = 392
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 378'

distance = 393
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 20'

distance = 395
spam score = 69
title = 'the genealogy of one vermonter darrell a martin single surname index 405'

distance = 395
spam score = 76
title = 'the genealogy of one vermonter darrell a martin single surname index 271'

distance = 397
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 191'

distance = 397
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 99'

distance = 660
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 157'

distance = 666
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 399'

distance = 671
spam score = 68
title = 'the genealogy of one vermonter darrell a martin single surname index 632'

distance = 683
spam score = 69
title = 'the genealogy of one vermonter darrell a martin single surname index 185'

distance = 693
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 66'

distance = 697
spam score = 67
title = 'the genealogy of one vermonter darrell a martin single surname index 505'

distance = 699
spam score = 70
title = 'the genealogy of one vermonter darrell a martin single surname index 386'

distance = 710
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 239'

distance = 711
spam score = 71
title = 'the genealogy of one vermonter darrell a martin single surname index 201'

distance = 717
spam score = 68
title = 'the genealogy of one vermonter darrell a martin single surname index 443'

distance = 913
spam score = 84
title = 'the genealogy of one vermonter darrell a martin person page 1671'

distance = 914
spam score = 82
title = 'place index 278'

distance = 916
spam score = 79
title = 'place index 104'

distance = 917
spam score = 76
title = 'place index 97'

distance = 927
spam score = 79
title = 'place index 370'

distance = 935
spam score = 76
title = 'place index 265'

distance = 938
spam score = 81
title = 'the genealogy of one vermonter darrell a martin person page 1494'

distance = 976
spam score = 72
title = 'the genealogy of one vermonter darrell a martin person page 2688'

distance = 977
spam score = 72
title = 'the genealogy of one vermonter darrell a martin single surname index 230'

distance = 979
spam score = 79
title = 'place index 103'

distance = 76
spam score = 41
title = ''

distance = 76
spam score = 41
title = ''

distance = 97
spam score = 44
title = ''

distance = 97
spam score = 43
title = ''

distance = 99
spam score = 42
title = ''

distance = 99
spam score = 43
title = ''

distance = 107
spam score = 40
title = ''

distance = 107
spam score = 39
title = ''

distance = 107
spam score = 41
title = ''

distance = 107
spam score = 40
title = ''

distance = 107
spam score = 41
title = ''

distance = 112
spam score = 43
title = ''

distance = 116
spam score = 43
title = ''

distance = 116
spam score = 42
title = ''

distance = 139
spam score = 40
title = ''

distance = 139
spam score = 40
title = ''

distance = 146
spam score = 40
title = ''

distance = 152
spam score = 42
title = ''

distance = 211
spam score = 42
title = ''

distance = 211
spam score = 43
title = ''

distance = 211
spam score = 42
title = ''

distance = 228
spam score = 41
title = ''

distance = 228
spam score = 41
title = ''

distance = 233
spam score = 43
title = ''

distance = 245
spam score = 41
title = ''

distance = 245
spam score = 42
title = ''

distance = 245
spam score = 42
title = ''

distance = 250
spam score = 43
title = ''

distance = 253
spam score = 42
title = ''

distance = 253
spam score = 43
title = ''

distance = 255
spam score = 41
title = ''

distance = 255
spam score = 41
title = ''

distance = 259
spam score = 41
title = ''

distance = 267
spam score = 44
title = ''

distance = 274
spam score = 41
title = ''

distance = 278
spam score = 43
title = ''

distance = 280
spam score = 41
title = ''

distance = 280
spam score = 41
title = ''

distance = 281
spam score = 40
title = ''

distance = 286
spam score = 43
title = ''

distance = 286
spam score = 42
title = ''

distance = 290
spam score = 41
title = ''

distance = 303
spam score = 43
title = ''

distance = 303
spam score = 43
title = ''

distance = 303
spam score = 42
title = ''

distance = 308
spam score = 42
title = ''

distance = 308
spam score = 42
title = ''

distance = 314
spam score = 43
title = ''

distance = 323
spam score = 44
title = ''

distance = 345
spam score = 40
title = ''

distance = 345
spam score = 40
title = ''

distance = 366
spam score = 41
title = ''

distance = 366
spam score = 42
title = ''

distance = 368
spam score = 43
title = ''

distance = 378
spam score = 41
title = ''

distance = 378
spam score = 41
title = ''

distance = 392
spam score = 42
title = ''

distance = 428
spam score = 43
title = ''

distance = 446
spam score = 42
title = ''

distance = 467
spam score = 40
title = ''

distance = 467
spam score = 40
title = ''

distance = 471
spam score = 42
title = ''

distance = 471
spam score = 43
title = ''

distance = 517
spam score = 40
title = ''

distance = 517
spam score = 41
title = ''

distance = 519
spam score = 42
title = ''

distance = 519
spam score = 42
title = ''

distance = 552
spam score = 41
title = ''

distance = 582
spam score = 41
title = ''

distance = 591
spam score = 40
title = ''

distance = 604
spam score = 39
title = ''

distance = 616
spam score = 42
title = ''

distance = 668
spam score = 40
title = ''

distance = 669
spam score = 41
title = ''

distance = 669
spam score = 41
title = ''

distance = 713
spam score = 41
title = ''

distance = 716
spam score = 40
title = ''

distance = 758
spam score = 37
title = ''

distance = 758
spam score = 37
title = ''

distance = 758
spam score = 37
title = ''

distance = 758
spam score = 38
title = ''

distance = 758
spam score = 37
title = ''

distance = 758
spam score = 38
title = ''

distance = 758
spam score = 38
title = ''

distance = 791
spam score = 40
title = ''

distance = 821
spam score = 40
title = ''

distance = 1816
spam score = 39
title = ''

distance = 1892
spam score = 20
title = ''

distance = 12
spam score = 62
title = ''

distance = 12
spam score = 74
title = ''

distance = 12
spam score = 48
title = ''

distance = 12
spam score = 81
title = ''

distance = 12
spam score = 72
title = ''

distance = 12
spam score = 76
title = ''

distance = 12
spam score = 65
title = ''

distance = 12
spam score = 60
title = ''

distance = 12
spam score = 69
title = ''

distance = 12
spam score = 78
title = ''

distance = 12
spam score = 69
title = ''

distance = 12
spam score = 73
title = ''

distance = 12
spam score = 69
title = ''

distance = 12
spam score = 77
title = ''

distance = 48
spam score = 75
title = ''

distance = 48
spam score = 72
title = ''

distance = 48
spam score = 83
title = ''

distance = 48
spam score = 79
title = ''

distance = 48
spam score = 76
title = ''

distance = 48
spam score = 81
title = ''

distance = 48
spam score = 71
title = ''

distance = 48
spam score = 71
title = ''

distance = 48
spam score = 78
title = ''

distance = 48
spam score = 75
title = ''

distance = 48
spam score = 57
title = ''

distance = 1333
spam score = 56
title = ''

distance = 1609
spam score = 78
title = ''

distance = 1641
spam score = 59
title = ''

distance = 177
spam score = 57
title = 'magicpoint presentation foils'

distance = 177
spam score = 57
title = 'magicpoint presentation foils'

distance = 182
spam score = 59
title = 'magicpoint presentation foils'

distance = 187
spam score = 58
title = 'magicpoint presentation foils'

distance = 191
spam score = 59
title = 'magicpoint presentation foils'

distance = 193
spam score = 55
title = 'magicpoint presentation foils'

distance = 198
spam score = 59
title = 'magicpoint presentation foils'

distance = 199
spam score = 56
title = 'magicpoint presentation foils'

distance = 200
spam score = 56
title = 'magicpoint presentation foils'

distance = 200
spam score = 58
title = 'magicpoint presentation foils'

distance = 200
spam score = 56
title = 'magicpoint presentation foils'

distance = 207
spam score = 57
title = 'magicpoint presentation foils'

distance = 208
spam score = 58
title = 'magicpoint presentation foils'

distance = 208
spam score = 59
title = 'magicpoint presentation foils'

distance = 208
spam score = 57
title = 'magicpoint presentation foils'

distance = 208
spam score = 59
title = 'magicpoint presentation foils'

distance = 210
spam score = 57
title = 'magicpoint presentation foils'

distance = 211
spam score = 59
title = 'magicpoint presentation foils'

distance = 214
spam score = 59
title = 'magicpoint presentation foils'

distance = 214
spam score = 59
title = 'magicpoint presentation foils'

distance = 319
spam score = 56
title = 'magicpoint presentation foils'

distance = 319
spam score = 61
title = 'magicpoint presentation foils'

distance = 319
spam score = 61
title = 'magicpoint presentation foils'

distance = 319
spam score = 58
title = 'magicpoint presentation foils'

distance = 319
spam score = 56
title = 'magicpoint presentation foils'

distance = 320
spam score = 53
title = 'magicpoint presentation foils'

distance = 320
spam score = 56
title = 'magicpoint presentation foils'

distance = 320
spam score = 54
title = 'magicpoint presentation foils'

distance = 320
spam score = 56
title = 'magicpoint presentation foils'

distance = 320
spam score = 52
title = 'magicpoint presentation foils'

distance = 349
spam score = 56
title = 'magicpoint presentation foils'

distance = 349
spam score = 52
title = 'magicpoint presentation foils'

distance = 349
spam score = 59
title = 'magicpoint presentation foils'

distance = 349
spam score = 53
title = 'magicpoint presentation foils'

distance = 350
spam score = 54
title = 'magicpoint presentation foils'

distance = 350
spam score = 54
title = 'magicpoint presentation foils'

distance = 350
spam score = 57
title = 'magicpoint presentation foils'

distance = 350
spam score = 54
title = 'magicpoint presentation foils'

distance = 350
spam score = 54
title = 'magicpoint presentation foils'

distance = 350
spam score = 57
title = 'magicpoint presentation foils'

distance = 375
spam score = 56
title = 'magicpoint presentation foils'

distance = 375
spam score = 55
title = 'magicpoint presentation foils'

distance = 375
spam score = 53
title = 'magicpoint presentation foils'

distance = 375
spam score = 54
title = 'magicpoint presentation foils'

distance = 375
spam score = 55
title = 'magicpoint presentation foils'

distance = 376
spam score = 50
title = 'magicpoint presentation foils'

distance = 376
spam score = 51
title = 'magicpoint presentation foils'

distance = 376
spam score = 57
title = 'magicpoint presentation foils'

distance = 376
spam score = 54
title = 'magicpoint presentation foils'

distance = 376
spam score = 56
title = 'magicpoint presentation foils'

distance = 402
spam score = 58
title = 'magicpoint presentation foils'

distance = 402
spam score = 52
title = 'magicpoint presentation foils'

distance = 403
spam score = 55
title = 'magicpoint presentation foils'

distance = 403
spam score = 56
title = 'magicpoint presentation foils'

distance = 403
spam score = 53
title = 'magicpoint presentation foils'

distance = 403
spam score = 52
title = 'magicpoint presentation foils'

distance = 403
spam score = 55
title = 'magicpoint presentation foils'

distance = 403
spam score = 51
title = 'magicpoint presentation foils'

distance = 403
spam score = 57
title = 'magicpoint presentation foils'

distance = 404
spam score = 54
title = 'magicpoint presentation foils'

distance = 429
spam score = 56
title = 'magicpoint presentation foils'

distance = 429
spam score = 55
title = 'magicpoint presentation foils'

distance = 429
spam score = 54
title = 'magicpoint presentation foils'

distance = 429
spam score = 56
title = 'magicpoint presentation foils'

distance = 430
spam score = 57
title = 'magicpoint presentation foils'

distance = 430
spam score = 53
title = 'magicpoint presentation foils'

distance = 430
spam score = 54
title = 'magicpoint presentation foils'

distance = 430
spam score = 57
title = 'magicpoint presentation foils'

distance = 430
spam score = 56
title = 'magicpoint presentation foils'

distance = 430
spam score = 56
title = 'magicpoint presentation foils'

distance = 464
spam score = 53
title = 'magicpoint presentation foils'

distance = 464
spam score = 53
title = 'magicpoint presentation foils'

distance = 464
spam score = 57
title = 'magicpoint presentation foils'

distance = 464
spam score = 54
title = 'magicpoint presentation foils'

distance = 464
spam score = 55
title = 'magicpoint presentation foils'

distance = 464
spam score = 55
title = 'magicpoint presentation foils'

distance = 464
spam score = 57
title = 'magicpoint presentation foils'

distance = 464
spam score = 57
title = 'magicpoint presentation foils'

distance = 465
spam score = 55
title = 'magicpoint presentation foils'

distance = 465
spam score = 59
title = 'magicpoint presentation foils'

distance = 513
spam score = 58
title = 'magicpoint presentation foils'

distance = 514
spam score = 50
title = 'magicpoint presentation foils'

distance = 514
spam score = 51
title = 'magicpoint presentation foils'

distance = 514
spam score = 58
title = 'magicpoint presentation foils'

distance = 514
spam score = 57
title = 'magicpoint presentation foils'

distance = 515
spam score = 59
title = 'magicpoint presentation foils'

distance = 515
spam score = 58
title = 'magicpoint presentation foils'

distance = 515
spam score = 57
title = 'magicpoint presentation foils'

distance = 515
spam score = 58
title = 'magicpoint presentation foils'

distance = 515
spam score = 52
title = 'magicpoint presentation foils'

distance = 746
spam score = 55
title = 'magicpoint presentation foils'

distance = 748
spam score = 57
title = 'magicpoint presentation foils'

distance = 750
spam score = 57
title = 'magicpoint presentation foils'

distance = 750
spam score = 56
title = 'magicpoint presentation foils'

distance = 750
spam score = 56
title = 'magicpoint presentation foils'

distance = 766
spam score = 58
title = 'magicpoint presentation foils'

distance = 773
spam score = 55
title = 'magicpoint presentation foils'

distance = 785
spam score = 52
title = 'magicpoint presentation foils'

distance = 787
spam score = 56
title = 'magicpoint presentation foils'

distance = 787
spam score = 56
title = 'magicpoint presentation foils'

distance = 1629
spam score = 60
title = 'untitled document'

distance = 1660
spam score = 38
title = 'tchilkatzip2 delphi reference'

distance = 1661
spam score = 45
title = ''

distance = 1705
spam score = 44
title = 'chilkat c zip class reference'

distance = 1730
spam score = 9
title = 'iran do espirito santo ralph ueltzhoeffer text portrait biografie biography'

distance = 1773
spam score = 5
title = 'nsra midwest nats spf 01 page 1'

distance = 1801
spam score = 18
title = 'smw tv title history'

distance = 1822
spam score = 40
title = 'swt invitational'

distance = 1847
spam score = 37
title = 'high quality clip art hobbies leisure activities and more'

distance = 119
spam score = 58
title = 'hiclimbphotos'

distance = 138
spam score = 58
title = 'hiclimbphotos'

distance = 140
spam score = 57
title = 'hiclimbphotos'

distance = 140
spam score = 58
title = 'hiclimbphotos'

distance = 150
spam score = 59
title = 'hiclimbphotos'

distance = 152
spam score = 56
title = 'hiclimbphotos'

distance = 152
spam score = 56
title = 'hiclimbphotos'

distance = 154
spam score = 56
title = 'hiclimbphotos'

distance = 154
spam score = 54
title = 'hiclimbphotos'

distance = 156
spam score = 57
title = 'hiclimbphotos'

distance = 162
spam score = 58
title = 'hiclimbphotos'

distance = 164
spam score = 55
title = 'hiclimbphotos'

distance = 165
spam score = 59
title = 'hiclimbphotos'

distance = 173
spam score = 57
title = 'hiclimbphotos'

distance = 175
spam score = 56
title = 'hiclimbphotos'

distance = 175
spam score = 56
title = 'hiclimbphotos'

distance = 177
spam score = 50
title = 'hiclimbphotos'

distance = 179
spam score = 57
title = 'hiclimbphotos'

distance = 182
spam score = 57
title = 'hiclimbphotos'

distance = 183
spam score = 57
title = 'hiclimbphotos'

distance = 224
spam score = 57
title = 'hiclimbphotos'

distance = 225
spam score = 58
title = 'hiclimbphotos'

distance = 225
spam score = 57
title = 'hiclimbphotos'

distance = 225
spam score = 59
title = 'hiclimbphotos'

distance = 226
spam score = 55
title = 'hiclimbphotos'

distance = 226
spam score = 52
title = 'hiclimbphotos'

distance = 227
spam score = 52
title = 'hiclimbphotos'

distance = 228
spam score = 58
title = 'hiclimbphotos'

distance = 229
spam score = 52
title = 'hiclimbphotos'

distance = 229
spam score = 51
title = 'hiclimbphotos'

distance = 240
spam score = 55
title = 'hiclimbphotos'

distance = 240
spam score = 58
title = 'hiclimbphotos'

distance = 241
spam score = 58
title = 'hiclimbphotos'

distance = 241
spam score = 58
title = 'hiclimbphotos'

distance = 242
spam score = 59
title = 'hiclimbphotos'

distance = 243
spam score = 58
title = 'hiclimbphotos'

distance = 244
spam score = 54
title = 'hiclimbphotos'

distance = 245
spam score = 58
title = 'hiclimbphotos'

distance = 246
spam score = 53
title = 'hiclimbphotos'

distance = 246
spam score = 58
title = 'hiclimbphotos'

distance = 261
spam score = 57
title = 'hiclimbphotos'

distance = 261
spam score = 57
title = 'hiclimbphotos'

distance = 262
spam score = 51
title = 'hiclimbphotos'

distance = 267
spam score = 57
title = 'hiclimbphotos'

distance = 267
spam score = 57
title = 'hiclimbphotos'

distance = 268
spam score = 57
title = 'hiclimbphotos'

distance = 270
spam score = 59
title = 'hiclimbphotos'

distance = 270
spam score = 51
title = 'hiclimbphotos'

distance = 270
spam score = 52
title = 'hiclimbphotos'

distance = 271
spam score = 56
title = 'hiclimbphotos'

distance = 286
spam score = 53
title = 'hiclimbphotos'

distance = 287
spam score = 57
title = 'hiclimbphotos'

distance = 288
spam score = 52
title = 'hiclimbphotos'

distance = 288
spam score = 52
title = 'hiclimbphotos'

distance = 289
spam score = 55
title = 'hiclimbphotos'

distance = 290
spam score = 52
title = 'hiclimbphotos'

distance = 290
spam score = 50
title = 'hiclimbphotos'

distance = 290
spam score = 60
title = 'hiclimbphotos'

distance = 291
spam score = 53
title = 'hiclimbphotos'

distance = 291
spam score = 48
title = 'hiclimbphotos'

distance = 306
spam score = 51
title = 'hiclimbphotos'

distance = 307
spam score = 57
title = 'hiclimbphotos'

distance = 307
spam score = 57
title = 'hiclimbphotos'

distance = 308
spam score = 53
title = 'hiclimbphotos'

distance = 310
spam score = 56
title = 'hiclimbphotos'

distance = 310
spam score = 60
title = 'hiclimbphotos'

distance = 310
spam score = 58
title = 'hiclimbphotos'

distance = 310
spam score = 53
title = 'hiclimbphotos'

distance = 312
spam score = 57
title = 'hiclimbphotos'

distance = 312
spam score = 59
title = 'hiclimbphotos'

distance = 334
spam score = 52
title = 'hiclimbphotos'

distance = 335
spam score = 51
title = 'hiclimbphotos'

distance = 338
spam score = 57
title = 'hiclimbphotos'

distance = 339
spam score = 52
title = 'hiclimbphotos'

distance = 340
spam score = 53
title = 'hiclimbphotos'

distance = 343
spam score = 51
title = 'hiclimbphotos'

distance = 343
spam score = 52
title = 'hiclimbphotos'

distance = 344
spam score = 57
title = 'hiclimbphotos'

distance = 345
spam score = 61
title = 'hiclimbphotos'

distance = 347
spam score = 53
title = 'hiclimbphotos'

distance = 370
spam score = 53
title = 'hiclimbphotos'

distance = 370
spam score = 55
title = 'hiclimbphotos'

distance = 370
spam score = 55
title = 'hiclimbphotos'

distance = 375
spam score = 52
title = 'hiclimbphotos'

distance = 378
spam score = 54
title = 'hiclimbphotos'

distance = 381
spam score = 56
title = 'hiclimbphotos'

distance = 383
spam score = 48
title = 'hiclimbphotos'

distance = 385
spam score = 51
title = 'hiclimbphotos'

distance = 391
spam score = 53
title = 'hiclimbphotos'

distance = 394
spam score = 55
title = 'hiclimbphotos'

distance = 487
spam score = 55
title = 'hiclimbphotos'

distance = 490
spam score = 58
title = 'hiclimbphotos'

distance = 498
spam score = 59
title = 'hiclimbphotos'

distance = 505
spam score = 55
title = 'hiclimbphotos'

distance = 509
spam score = 57
title = 'hiclimbphotos'

distance = 513
spam score = 56
title = 'hiclimbphotos'

distance = 521
spam score = 50
title = 'hiclimbphotos'

distance = 560
spam score = 54
title = 'hiclimbphotos'

distance = 564
spam score = 54
title = 'hiclimbphotos'

distance = 608
spam score = 52
title = 'hiclimbphotos'

distance = 1691
spam score = 57
title = 'big feet tiny man'

distance = 1691
spam score = 31
title = ''

distance = 1721
spam score = 34
title = 'hwb apple communication slot connector offline'

distance = 1774
spam score = 53
title = 'sumspec image header wcs'

distance = 1805
spam score = 29
title = ''

distance = 1818
spam score = 33
title = ''

distance = 32
spam score = 50
title = 'alinea press'

distance = 32
spam score = 50
title = 'alinea press'

distance = 32
spam score = 50
title = 'alinea press'

distance = 32
spam score = 52
title = 'alinea press'

distance = 32
spam score = 51
title = 'alinea press'

distance = 32
spam score = 50
title = 'alinea press'

distance = 32
spam score = 50
title = 'alinea press'

distance = 32
spam score = 51
title = 'alinea press'

distance = 32
spam score = 51
title = 'alinea press'

distance = 32
spam score = 50
title = 'alinea press'

distance = 32
spam score = 48
title = 'alinea press'

distance = 32
spam score = 50
title = 'alinea press'

distance = 32
spam score = 51
title = 'alinea press'

distance = 32
spam score = 52
title = 'alinea press'

distance = 32
spam score = 49
title = 'alinea press'

distance = 32
spam score = 50
title = 'alinea press'

distance = 32
spam score = 50
title = 'alinea press'

distance = 32
spam score = 51
title = 'alinea press'

distance = 62
spam score = 52
title = 'alinea press'

distance = 62
spam score = 50
title = 'alinea press'

distance = 62
spam score = 49
title = 'alinea press'

distance = 62
spam score = 50
title = 'alinea press'

distance = 62
spam score = 50
title = 'alinea press'

distance = 62
spam score = 51
title = 'alinea press'

distance = 62
spam score = 51
title = 'alinea press'

distance = 62
spam score = 50
title = 'alinea press'

distance = 62
spam score = 50
title = 'alinea press'

distance = 62
spam score = 51
title = 'alinea press'

distance = 62
spam score = 49
title = 'alinea press'

distance = 98
spam score = 51
title = 'alinea press'

distance = 98
spam score = 52
title = 'alinea press'

distance = 98
spam score = 51
title = 'alinea press'

distance = 98
spam score = 52
title = 'alinea press'

distance = 98
spam score = 52
title = 'alinea press'

distance = 98
spam score = 52
title = 'alinea press'

distance = 98
spam score = 52
title = 'alinea press'

distance = 98
spam score = 52
title = 'alinea press'

distance = 98
spam score = 52
title = 'alinea press'

distance = 112
spam score = 52
title = 'alinea press'

distance = 112
spam score = 52
title = 'alinea press'

distance = 112
spam score = 52
title = 'alinea press'

distance = 112
spam score = 52
title = 'alinea press'

distance = 112
spam score = 52
title = 'alinea press'

distance = 112
spam score = 52
title = 'alinea press'

distance = 112
spam score = 52
title = 'alinea press'

distance = 112
spam score = 52
title = 'alinea press'

distance = 112
spam score = 53
title = 'alinea press'

distance = 121
spam score = 54
title = 'alinea press'

distance = 121
spam score = 55
title = 'alinea press'

distance = 121
spam score = 55
title = 'alinea press'

distance = 121
spam score = 55
title = 'alinea press'

distance = 121
spam score = 53
title = 'alinea press'

distance = 121
spam score = 55
title = 'alinea press'

distance = 121
spam score = 53
title = 'alinea press'

distance = 121
spam score = 54
title = 'alinea press'

distance = 121
spam score = 55
title = 'alinea press'

distance = 122
spam score = 51
title = 'alinea press'

distance = 122
spam score = 54
title = 'alinea press'

distance = 122
spam score = 53
title = 'alinea press'

distance = 122
spam score = 52
title = 'alinea press'

distance = 140
spam score = 54
title = 'alinea press'

distance = 140
spam score = 53
title = 'alinea press'

distance = 140
spam score = 53
title = 'alinea press'

distance = 140
spam score = 53
title = 'alinea press'

distance = 140
spam score = 53
title = 'alinea press'

distance = 140
spam score = 51
title = 'alinea press'

distance = 158
spam score = 51
title = 'alinea press'

distance = 158
spam score = 51
title = 'alinea press'

distance = 158
spam score = 49
title = 'alinea press'

distance = 158
spam score = 49
title = 'alinea press'

distance = 176
spam score = 56
title = 'alinea press'

distance = 176
spam score = 58
title = 'alinea press'

distance = 176
spam score = 58
title = 'alinea press'

distance = 179
spam score = 57
title = 'alinea press'

distance = 179
spam score = 58
title = 'alinea press'

distance = 179
spam score = 56
title = 'alinea press'

distance = 197
spam score = 57
title = 'alinea press'

distance = 197
spam score = 55
title = 'alinea press'

distance = 203
spam score = 56
title = 'alinea press'

distance = 203
spam score = 55
title = 'alinea press'

distance = 217
spam score = 52
title = 'alinea press'

distance = 217
spam score = 51
title = 'alinea press'

distance = 217
spam score = 51
title = 'alinea press'

distance = 240
spam score = 52
title = 'alinea press'

distance = 240
spam score = 53
title = 'alinea press'

distance = 240
spam score = 52
title = 'alinea press'

distance = 258
spam score = 63
title = 'alinea press'

distance = 296
spam score = 54
title = 'alinea press'

distance = 467
spam score = 56
title = 'untitled page'

distance = 482
spam score = 55
title = 'untitled page'

distance = 689
spam score = 44
title = 'alinea press'

distance = 737
spam score = 59
title = 'alinea restaurant'

distance = 737
spam score = 59
title = 'alinea restaurant'

distance = 738
spam score = 64
title = 'alinea restaurant'

distance = 745
spam score = 62
title = 'alinea contact'

distance = 764
spam score = 57
title = 'alinea image gallery'

distance = 1041
spam score = 58
title = 'alinea shop'

distance = 1041
spam score = 58
title = 'alinea shop'

distance = 1055
spam score = 51
title = 'alinea gift certificates'

distance = 1055
spam score = 53
title = 'alinea gift certificates'

distance = 1376
spam score = 10
title = 'c tips'

distance = 1485
spam score = 59
title = '22 ms windows specific services'

distance = 1495
spam score = 52
title = 'adding a toolbox to arctoolbox'

distance = 1599
spam score = 53
title = 'worst havana drought since communist revolution'

distance = 1737
spam score = 38
title = 'restkit hierarchy'

distance = 1737
spam score = 39
title = 'restkit hierarchy'

distance = 1782
spam score = 37
title = 'digion newsrelease 20060104'

distance = 178
spam score = 39
title = 'worldlii categories countries nepal law journals'

distance = 184
spam score = 32
title = 'worldlii categories countries nepal companies'

distance = 187
spam score = 33
title = 'worldlii categories countries pakistan companies'

distance = 187
spam score = 32
title = 'worldlii categories countries maldives companies'

distance = 192
spam score = 39
title = 'worldlii categories countries singapore law journals'

distance = 200
spam score = 38
title = 'worldlii categories countries surinam government'

distance = 210
spam score = 47
title = 'worldlii categories countries thailand law journals'

distance = 211
spam score = 38
title = 'worldlii categories countries singapore law reform'

distance = 215
spam score = 44
title = 'worldlii categories countries maldives government'

distance = 216
spam score = 37
title = 'worldlii categories countries maldives legislation'

distance = 220
spam score = 35
title = 'worldlii categories countries paraguay legislation'

distance = 221
spam score = 34
title = 'worldlii categories countries bangladesh companies'

distance = 231
spam score = 42
title = 'worldlii categories countries tokelau government'

distance = 232
spam score = 48
title = 'worldlii categories countries guam lawyers'

distance = 236
spam score = 44
title = 'worldlii categories countries nepal lawyers'

distance = 236
spam score = 39
title = 'worldlii categories countries surinam legislation'

distance = 237
spam score = 42
title = 'worldlii categories countries myanmar law journals'

distance = 242
spam score = 40
title = 'worldlii categories countries pakistan contracts'

distance = 243
spam score = 37
title = 'worldlii categories countries guam parliament'

distance = 243
spam score = 40
title = 'worldlii categories countries tonga constitution'

distance = 346
spam score = 31
title = 'worldlii categories countries bhutan contracts'

distance = 347
spam score = 33
title = 'worldlii categories countries chile law reform'

distance = 347
spam score = 39
title = 'worldlii categories subjects religion the law canon law legislation'

distance = 347
spam score = 41
title = 'worldlii categories countries norfolk island parliament'

distance = 347
spam score = 38
title = 'worldlii categories countries marshall islands legislation'

distance = 348
spam score = 37
title = 'worldlii categories countries colombia environment'

distance = 348
spam score = 66
title = 'worldlii categories countries australia lawyers legal services lawyers organisations'

distance = 348
spam score = 49
title = 'worldlii categories subjects religion the law canon law education'

distance = 349
spam score = 37
title = 'worldlii categories countries papua new guinea foreign investment'

distance = 350
spam score = 34
title = 'worldlii categories countries bangladesh anticorruption'

distance = 396
spam score = 25
title = 'worldlii categories countries united states of america by state nebraska'

distance = 396
spam score = 34
title = 'worldlii categories countries sri lanka parliament'

distance = 396
spam score = 30
title = 'worldlii categories countries france infrastructure energy'

distance = 397
spam score = 49
title = 'worldlii categories countries australia education students'

distance = 397
spam score = 41
title = 'worldlii categories countries uruguay legislation'

distance = 398
spam score = 27
title = 'worldlii categories countries ireland cyberspace domain names'

distance = 398
spam score = 29
title = 'worldlii categories countries france overseas departments territories reunion'

distance = 398
spam score = 35
title = 'worldlii categories countries el salvador anticorruption'

distance = 399
spam score = 27
title = 'worldlii categories countries hungary cyberspace ecommerce'

distance = 399
spam score = 35
title = 'worldlii categories countries germany cyberspace ecommerce'

distance = 432
spam score = 53
title = 'worldlii categories subjects islamic law introductions to islamic law'

distance = 432
spam score = 47
title = 'worldlii categories international treaties international agreements multinational collections historical documents'

distance = 432
spam score = 41
title = 'worldlii categories countries el salvador government'

distance = 433
spam score = 60
title = 'worldlii categories countries australia governments commonwealth parliament'

distance = 434
spam score = 31
title = 'worldlii categories countries russian federation criminal law computer crime'

distance = 435
spam score = 32
title = 'worldlii categories countries australia by subject aboriginals torres strait islanders legislation victoria'

distance = 437
spam score = 59
title = 'worldlii categories courts caselaw international courts tribunals international court of justice'

distance = 437
spam score = 37
title = 'worldlii categories countries sri lanka consumer protection'

distance = 437
spam score = 44
title = 'worldlii categories countries australia by subject aboriginals torres strait islanders legislation south australia'

distance = 439
spam score = 47
title = 'worldlii categories countries australia governments northern territory'

distance = 479
spam score = 45
title = 'worldlii categories countries lebanon cyberspace domain names'

distance = 479
spam score = 37
title = 'worldlii categories countries fiji women the law'

distance = 479
spam score = 24
title = 'worldlii categories countries united states of america by state district of columbia'

distance = 479
spam score = 53
title = 'worldlii categories countries south africa by province eastern cape'

distance = 480
spam score = 36
title = 'worldlii categories countries tokelau constitution'

distance = 480
spam score = 31
title = 'worldlii categories countries tokelau other indexes'

distance = 480
spam score = 42
title = 'worldlii categories countries ecuador introductions to ecuadorian law'

distance = 481
spam score = 26
title = 'worldlii categories countries united states of america by state south dakota'

distance = 481
spam score = 67
title = 'worldlii categories countries united states of america courts caselaw federal courts supreme court'

distance = 481
spam score = 41
title = 'worldlii categories countries romania cyberspace domain names'

distance = 506
spam score = 32
title = 'worldlii categories countries honduras cyberspace'

distance = 506
spam score = 31
title = 'worldlii categories countries nicaragua citizenship migration'

distance = 507
spam score = 41
title = 'worldlii categories countries chile courts caselaw'

distance = 507
spam score = 31
title = 'worldlii categories countries fiji cyberspace'

distance = 507
spam score = 34
title = 'worldlii categories countries peru banking finance'

distance = 507
spam score = 53
title = 'worldlii categories countries australia lawyers legal services legal aid aboriginal legal aid services'

distance = 507
spam score = 31
title = 'worldlii categories countries cote divoire cyberspace domain names'

distance = 508
spam score = 39
title = 'worldlii categories countries tokelau courts caselaw'

distance = 508
spam score = 32
title = 'worldlii categories countries serbia montenegro montenegro banking finance'

distance = 508
spam score = 62
title = 'worldlii categories courts caselaw international courts tribunals court of justice of the andean community'

distance = 534
spam score = 37
title = 'worldlii categories countries sri lanka family law'

distance = 534
spam score = 51
title = 'worldlii categories subjects privacy intergovernment organisations'

distance = 535
spam score = 35
title = 'worldlii categories countries peru industrial relations labor law'

distance = 535
spam score = 30
title = 'worldlii categories countries el salvador international trade'

distance = 535
spam score = 32
title = 'worldlii categories countries pitcairn islands cyberspace'

distance = 535
spam score = 31
title = 'worldlii categories countries nicaragua banking finance'

distance = 535
spam score = 32
title = 'worldlii categories countries bangladesh banking finance'

distance = 536
spam score = 35
title = 'worldlii categories countries fiji social welfare services'

distance = 537
spam score = 46
title = 'worldlii categories countries bangladesh courts caselaw'

distance = 537
spam score = 44
title = 'worldlii categories countries costa rica treaties international agreements'

distance = 583
spam score = 31
title = 'worldlii categories subjects islamic law law libraries'

distance = 584
spam score = 33
title = 'worldlii categories countries costa rica consumer protection'

distance = 584
spam score = 33
title = 'worldlii categories countries bangladesh industrial relations labor law'

distance = 585
spam score = 26
title = 'worldlii categories countries russian federation capital markets securities'

distance = 586
spam score = 28
title = 'worldlii categories countries bolivia intellectual property'

distance = 587
spam score = 54
title = 'worldlii categories international treaties international agreements'

distance = 588
spam score = 41
title = 'worldlii categories countries chile taxation revenue customs'

distance = 588
spam score = 36
title = 'worldlii categories countries cook islands constitution'

distance = 589
spam score = 37
title = 'worldlii categories countries australia courts caselaw commonwealth defence force discipline appeal tribunal'

distance = 590
spam score = 37
title = 'worldlii categories countries sri lanka taxation revenue customs'

distance = 677
spam score = 31
title = 'worldlii categories countries china intergovernment organisations'

distance = 677
spam score = 39
title = 'worldlii categories countries solomon islands intergovernment organisations'

distance = 678
spam score = 31
title = 'worldlii categories countries afghanistan introduction to afghan law'

distance = 681
spam score = 48
title = 'worldlii categories countries chile legislation'

distance = 682
spam score = 48
title = 'worldlii categories countries bangladesh legislation'

distance = 685
spam score = 28
title = 'worldlii categories countries ecuador other indexes'

distance = 686
spam score = 37
title = 'worldlii categories countries afghanistan other indexes'

distance = 687
spam score = 36
title = 'worldlii categories international intergovernment organisations world trade organization wto other indexes'

distance = 688
spam score = 33
title = 'worldlii categories countries belarus capital markets securities'

distance = 690
spam score = 30
title = 'worldlii categories countries belize other indexes'

distance = 1007
spam score = 37
title = 'worldlii categories countries ecuador foreign investment'

distance = 1017
spam score = 25
title = 'worldlii categories countries bolivia intergovernment organisations'

distance = 1030
spam score = 30
title = 'worldlii categories countries honduras intergovernment organisations'

distance = 1055
spam score = 35
title = 'worldlii categories countries belize intergovernment organisations'

distance = 1060
spam score = 78
title = 'worldlii categories countries new zealand courts caselaw tribunals commissions other authorities'

distance = 1079
spam score = 28
title = 'worldlii categories countries peru intergovernment organisations'

distance = 1080
spam score = 31
title = 'worldlii categories countries costa rica intergovernment organisations'

distance = 1161
spam score = 46
title = 'worldlii categories countries australia legislation elections'

distance = 219
spam score = 47
title = 'the current time in mexico mexico'

distance = 248
spam score = 48
title = 'the current time in oaxaca mexico'

distance = 258
spam score = 51
title = 'the current time in georgia utc0400'

distance = 259
spam score = 50
title = 'the current time in tamaulipas mexico'

distance = 261
spam score = 48
title = 'the current time in durango mexico'

distance = 262
spam score = 48
title = 'the current time in tabasco mexico'

distance = 262
spam score = 53
title = 'the current time in honduras utc0600'

distance = 263
spam score = 50
title = 'the current time in aguascalientes mexico'

distance = 265
spam score = 49
title = 'the current time in veracruz mexico'

distance = 266
spam score = 54
title = 'the current time in cuba utc0400'

distance = 268
spam score = 51
title = 'the current time in philippines utc0800'

distance = 268
spam score = 50
title = 'the current time in guerrero mexico'

distance = 269
spam score = 46
title = 'the current time in jalisco mexico'

distance = 269
spam score = 53
title = 'the current time in coahuila mexico'

distance = 269
spam score = 53
title = 'the current time in guatemala utc0600'

distance = 270
spam score = 51
title = 'the current time in qatar utc0300'

distance = 270
spam score = 47
title = 'the current time in puebla mexico'

distance = 271
spam score = 44
title = 'the current time in michoac mexico'

distance = 271
spam score = 50
title = 'the current time in chiapas mexico'

distance = 272
spam score = 49
title = 'the current time in jamaica utc0500'

distance = 343
spam score = 34
title = 'the current time in lafayette louisiana usa'

distance = 343
spam score = 38
title = 'the current time in franklin tennessee usa'

distance = 343
spam score = 46
title = 'the current time in paris france'

distance = 344
spam score = 40
title = 'the current time in cincinnati ohio usa'

distance = 344
spam score = 47
title = 'the current time in el salvador utc0600'

distance = 345
spam score = 48
title = 'the current time in hungary utc0200'

distance = 346
spam score = 44
title = 'the current time in rostock germany'

distance = 346
spam score = 48
title = 'the current time in mongolia utc0800'

distance = 346
spam score = 51
title = 'the current time in croatia utc0200'

distance = 346
spam score = 34
title = 'the current time in pittsburgh pennsylvania usa'

distance = 360
spam score = 34
title = 'the current time in orange california usa'

distance = 360
spam score = 33
title = 'the current time in itabuna bahia brazil'

distance = 361
spam score = 32
title = 'the current time in bethlehem pennsylvania usa'

distance = 361
spam score = 42
title = 'the current time in oshawa ontario canada'

distance = 361
spam score = 38
title = 'the current time in hammond indiana usa'

distance = 361
spam score = 38
title = 'the current time in germantown maryland usa'

distance = 361
spam score = 44
title = 'the current time in nice france'

distance = 361
spam score = 45
title = 'the current time in barcelona spain'

distance = 362
spam score = 46
title = 'the current time in munich germany'

distance = 362
spam score = 44
title = 'the current time in peterborough ontario canada'

distance = 369
spam score = 44
title = 'the current time in mainz germany'

distance = 369
spam score = 46
title = 'the current time in breda netherlands'

distance = 370
spam score = 43
title = 'the current time in halle germany'

distance = 370
spam score = 45
title = 'the current time in saarbrucken germany'

distance = 370
spam score = 45
title = 'the current time in munchengladbach germany'

distance = 370
spam score = 51
title = 'the current time in france utc0200'

distance = 370
spam score = 53
title = 'the current time in espirito santo brazil'

distance = 370
spam score = 36
title = 'the current time in santa cruz bolivia'

distance = 370
spam score = 44
title = 'the current time in erfurt germany'

distance = 371
spam score = 49
title = 'the current time in cayman islands utc0500'

distance = 378
spam score = 49
title = 'the current time in virgin islands utc0400'

distance = 378
spam score = 45
title = 'the current time in amstelveen netherlands'

distance = 379
spam score = 40
title = 'the current time in cholula puebla mexico'

distance = 379
spam score = 41
title = 'the current time in tonal jalisco mexico'

distance = 379
spam score = 40
title = 'the current time in hartford connecticut usa'

distance = 379
spam score = 44
title = 'the current time in amersfoort netherlands'

distance = 379
spam score = 45
title = 'the current time in arnhem netherlands'

distance = 379
spam score = 46
title = 'the current time in hilversum netherlands'

distance = 379
spam score = 34
title = 'the current time in hayward california usa'

distance = 380
spam score = 38
title = 'the current time in navi mumbai india'

distance = 395
spam score = 51
title = 'the current time in northern territory australia'

distance = 396
spam score = 48
title = 'the current time in cyprus utc0300'

distance = 396
spam score = 39
title = 'the current time in dallas texas usa'

distance = 397
spam score = 47
title = 'the current time in finland utc0300'

distance = 397
spam score = 38
title = 'the current time in cheektowaga new york usa'

distance = 397
spam score = 54
title = 'the current time in clipperton island utc0800'

distance = 397
spam score = 41
title = 'the current time in windsor ontario canada'

distance = 397
spam score = 50
title = 'the current time in midway islands utc1100'

distance = 398
spam score = 34
title = 'the current time in visalia california usa'

distance = 398
spam score = 33
title = 'the current time in glendale california usa'

distance = 414
spam score = 37
title = 'the current time in serra espirito santo brazil'

distance = 414
spam score = 30
title = 'the current time in everett washington usa'

distance = 414
spam score = 34
title = 'the current time in sunnyvale california usa'

distance = 414
spam score = 38
title = 'the current time in belfast united kingdom'

distance = 414
spam score = 55
title = 'the current time in syria utc0200'

distance = 415
spam score = 37
title = 'the current time in los reyes mexico mexico'

distance = 415
spam score = 32
title = 'the current time in tacoma washington usa'

distance = 416
spam score = 48
title = 'the current time in latvia utc0300'

distance = 416
spam score = 36
title = 'the current time in hoffman estates illinois usa'

distance = 416
spam score = 37
title = 'the current time in meridian idaho usa'

distance = 455
spam score = 36
title = 'the current time in santos sao paulo brazil'

distance = 456
spam score = 45
title = 'the current time in bosnia and herzegovina utc0200'

distance = 457
spam score = 47
title = 'the current time in palmyra atoll utc01400'

distance = 458
spam score = 49
title = 'the current time in british virgin islands utc0400'

distance = 458
spam score = 34
title = 'the current time in sao luas maranhao brazil'

distance = 458
spam score = 39
title = 'the current time in des plaines illinois usa'

distance = 459
spam score = 34
title = 'the current time in henderson nevada usa'

distance = 459
spam score = 53
title = 'the current time in rio grande do sul brazil'

distance = 460
spam score = 29
title = 'the current time in seattle washington usa'

distance = 460
spam score = 39
title = 'the current time in diadema sao paulo brazil'

distance = 528
spam score = 31
title = 'the current time in north las vegas nevada usa'

distance = 529
spam score = 34
title = 'the current time in pouso alegre minas gerais brazil'

distance = 533
spam score = 44
title = 'the current time in north carolina united states of america'

distance = 535
spam score = 38
title = 'the current time in sao bernardo do campo sao paulo brazil'

distance = 537
spam score = 34
title = 'the current time in natal rio grande do norte brazil'

distance = 537
spam score = 44
title = 'the current time in saintjeansurrichelieu quebec canada'

distance = 539
spam score = 49
title = 'the current time in st johns newfoundland and labrador canada'

distance = 540
spam score = 31
title = 'the current time in winstonsalem north carolina usa'

distance = 541
spam score = 37
title = 'the current time in east los angeles california usa'

distance = 541
spam score = 47
title = 'the current time in prince george british columbia canada'

distance = 1413
spam score = 21
title = 'countries in australasia and their time zones'

distance = 1670
spam score = 28
title = 'interactive power electronics seminar ipes'

distance = 1739
spam score = 53
title = 'interface toslibftspglobaltime'

distance = 98
spam score = 30
title = 'one'

distance = 134
spam score = 43
title = 'b52'

distance = 155
spam score = 46
title = 'beyond'

distance = 172
spam score = 40
title = 'us3'

distance = 175
spam score = 41
title = 'tarkan'

distance = 175
spam score = 45
title = 'pidm'

distance = 180
spam score = 33
title = 'motion'

distance = 186
spam score = 32
title = 'billing b'

distance = 186
spam score = 35
title = 'lw jo'

distance = 187
spam score = 34
title = 'judds'

distance = 191
spam score = 35
title = 'archies'

distance = 193
spam score = 34
title = 'apache'

distance = 194
spam score = 38
title = 'nylons'

distance = 194
spam score = 33
title = 'bates'

distance = 196
spam score = 35
title = 'ffrr'

distance = 197
spam score = 33
title = 'slade'

distance = 198
spam score = 42
title = 'bananarama'

distance = 201
spam score = 31
title = 'other ones'

distance = 202
spam score = 37
title = 'may'

distance = 203
spam score = 38
title = 'enigma'

distance = 307
spam score = 34
title = 'talking heads'

distance = 307
spam score = 32
title = 'lynne shelby'

distance = 307
spam score = 44
title = 'boyzone'

distance = 308
spam score = 41
title = 'mouskouri nana'

distance = 308
spam score = 36
title = 'escalante soler y'

distance = 308
spam score = 47
title = 'bro sis'

distance = 308
spam score = 37
title = 'peterson clive'

distance = 308
spam score = 36
title = 'bolling claude'

distance = 309
spam score = 31
title = 'los martineli'

distance = 309
spam score = 50
title = '8 12 souvenirs'

distance = 334
spam score = 32
title = 'shearing george'

distance = 334
spam score = 35
title = 'delgado roberto'

distance = 334
spam score = 38
title = 'negros angelitos'

distance = 334
spam score = 32
title = 'wolf kaiser'

distance = 334
spam score = 35
title = 'roth david lee'

distance = 334
spam score = 35
title = 'boswell eve'

distance = 334
spam score = 44
title = 'gomes ruben'

distance = 335
spam score = 44
title = 'taylor james'

distance = 335
spam score = 39
title = 'mfp'

distance = 335
spam score = 44
title = 'dj babbitt'

distance = 361
spam score = 44
title = 'quinteto pirincho'

distance = 361
spam score = 37
title = 'interscopemca'

distance = 361
spam score = 31
title = 'ned nelson'

distance = 362
spam score = 44
title = 'blue brothers'

distance = 362
spam score = 36
title = 'equals'

distance = 362
spam score = 33
title = 'vives carlos'

distance = 362
spam score = 43
title = 'da vila martino'

distance = 362
spam score = 35
title = 'orquesta laronda'

distance = 362
spam score = 36
title = 'robbins marty'

distance = 362
spam score = 34
title = 'lane cleo'

distance = 392
spam score = 47
title = 'buble michael'

distance = 393
spam score = 36
title = 'tavares'

distance = 393
spam score = 33
title = 'santa esmeralda'

distance = 393
spam score = 36
title = 'ray susan'

distance = 393
spam score = 46
title = 'chaves enrico'

distance = 394
spam score = 47
title = 'garden of secrets'

distance = 394
spam score = 33
title = 'rumba tres'

distance = 394
spam score = 47
title = 'forester sisters'

distance = 394
spam score = 42
title = 'abdul paula'

distance = 394
spam score = 33
title = 'osvaldo'

distance = 444
spam score = 35
title = 'nice little pinguins'

distance = 445
spam score = 33
title = 'fania all stars'

distance = 445
spam score = 45
title = 'cash johnny'

distance = 446
spam score = 33
title = 'cugat xavier'

distance = 446
spam score = 29
title = 'millie'

distance = 446
spam score = 45
title = 'panlague leonardo'

distance = 446
spam score = 44
title = 'intermede communications'

distance = 447
spam score = 32
title = 'cuba joe'

distance = 447
spam score = 35
title = 'charleston'

distance = 448
spam score = 37
title = 'liberty'

distance = 552
spam score = 32
title = 'on the 6 lopez jennifer'

distance = 553
spam score = 44
title = 'royal crown revue'

distance = 554
spam score = 34
title = 'pwl'

distance = 554
spam score = 42
title = 'fore lewis hueythe news'

distance = 554
spam score = 35
title = 'mitchel guy'

distance = 554
spam score = 39
title = 'lambada brazil various'

distance = 555
spam score = 36
title = 'guerra juan luis'

distance = 557
spam score = 42
title = 'austin patti'

distance = 557
spam score = 38
title = 'rocket'

distance = 558
spam score = 43
title = 'busch dirk'

distance = 645
spam score = 33
title = 'make way for the indian apache'

distance = 645
spam score = 38
title = 'german open dancing wolf kaiser'

distance = 648
spam score = 43
title = 'anthology charles ray'

distance = 649
spam score = 38
title = 'vagabond heart stewart rod'

distance = 649
spam score = 37
title = 'julia fordham fordham julia'

distance = 650
spam score = 48
title = 'crescent city maulers'

distance = 650
spam score = 35
title = 'jive bunny and the mastermixers mastermixers'

distance = 650
spam score = 45
title = 'davis jr sammy'

distance = 650
spam score = 40
title = 'latein collection tauber werner'

distance = 651
spam score = 30
title = 'best of johnny mathis mathis johnny'

distance = 743
spam score = 43
title = 'chamberlain richard'

distance = 743
spam score = 42
title = 'paso doble non strict'

distance = 744
spam score = 33
title = 'new york new york sinatra frank'

distance = 746
spam score = 40
title = 'mantovani'

distance = 747
spam score = 41
title = 'wild cool and swingin 2 various'

distance = 748
spam score = 32
title = 'nice n easy sinatra frank'

distance = 749
spam score = 31
title = 'stony end streisand barbra'

distance = 749
spam score = 33
title = 'healer hooker john lee'

distance = 749
spam score = 41
title = 'count basie'

distance = 749
spam score = 36
title = 'with john denver placido domingo'

distance = 1223
spam score = 36
title = 'silver strings autumn leaves london starlight orchestra'

distance = 1256
spam score = 38
title = 'trippin the light fantastic london starlight orchestra'

distance = 1268
spam score = 23
title = 'bluestime magic dickgeils jay'

distance = 1383
spam score = 43
title = 'friedmann vio'

distance = 1411
spam score = 36
title = 'uss pavlic apd70'

distance = 253
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 256
spam score = 47
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 260
spam score = 47
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 270
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 273
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 282
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 284
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 287
spam score = 48
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 291
spam score = 49
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 296
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 304
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 304
spam score = 54
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 306
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 308
spam score = 54
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 310
spam score = 48
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 310
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 310
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 311
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 313
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 314
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 348
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 351
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 351
spam score = 54
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 352
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 353
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 354
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 354
spam score = 49
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 356
spam score = 49
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 356
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 356
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 369
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 369
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 371
spam score = 54
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 371
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 371
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 371
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 372
spam score = 47
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 373
spam score = 46
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 375
spam score = 49
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 377
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 393
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 395
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 396
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 397
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 400
spam score = 48
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 401
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 401
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 401
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 404
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 405
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 431
spam score = 49
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 431
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 431
spam score = 46
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 439
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 440
spam score = 55
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 442
spam score = 54
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 443
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 445
spam score = 54
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 446
spam score = 55
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 448
spam score = 45
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 473
spam score = 49
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 473
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 476
spam score = 49
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 477
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 479
spam score = 56
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 479
spam score = 46
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 484
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 485
spam score = 56
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 488
spam score = 48
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 492
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 529
spam score = 57
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 532
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 533
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 538
spam score = 55
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 539
spam score = 56
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 544
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 544
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 548
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 549
spam score = 56
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 551
spam score = 49
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 599
spam score = 54
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 599
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 600
spam score = 48
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 606
spam score = 54
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 607
spam score = 55
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 612
spam score = 50
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 622
spam score = 55
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 629
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 630
spam score = 55
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 630
spam score = 56
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 743
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 749
spam score = 45
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 758
spam score = 52
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 760
spam score = 54
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 763
spam score = 53
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 778
spam score = 45
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 782
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 796
spam score = 56
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 801
spam score = 55
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 805
spam score = 51
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 1107
spam score = 48
title = 'erebuni corp spoilers ground effects wings aerodynamics auto accessories spoiler ground effect groundeffect groundeffects wing aerodynamic auto accessory'

distance = 1
spam score = 76
title = ''

distance = 10
spam score = 79
title = ''

distance = 13
spam score = 77
title = ''

distance = 45
spam score = 69
title = ''

distance = 45
spam score = 70
title = ''

distance = 50
spam score = 76
title = ''

distance = 86
spam score = 76
title = ''

distance = 92
spam score = 81
title = ''

distance = 131
spam score = 67
title = ''

distance = 244
spam score = 67
title = ''

distance = 1678
spam score = 89
title = ''

distance = 290
spam score = 32
title = ''

distance = 294
spam score = 35
title = ''

distance = 295
spam score = 33
title = ''

distance = 299
spam score = 31
title = ''

distance = 309
spam score = 35
title = ''

distance = 312
spam score = 30
title = ''

distance = 313
spam score = 31
title = ''

distance = 335
spam score = 30
title = ''

distance = 337
spam score = 39
title = ''

distance = 337
spam score = 34
title = ''

distance = 338
spam score = 35
title = ''

distance = 341
spam score = 32
title = ''

distance = 351
spam score = 36
title = ''

distance = 354
spam score = 34
title = ''

distance = 355
spam score = 27
title = ''

distance = 355
spam score = 31
title = ''

distance = 359
spam score = 33
title = ''

distance = 360
spam score = 33
title = ''

distance = 360
spam score = 34
title = ''

distance = 361
spam score = 30
title = ''

distance = 363
spam score = 32
title = ''

distance = 366
spam score = 30
title = ''

distance = 369
spam score = 34
title = ''

distance = 370
spam score = 30
title = ''

distance = 372
spam score = 31
title = ''

distance = 380
spam score = 30
title = ''

distance = 380
spam score = 51
title = ''

distance = 381
spam score = 36
title = ''

distance = 382
spam score = 31
title = ''

distance = 386
spam score = 31
title = ''

distance = 387
spam score = 35
title = ''

distance = 388
spam score = 40
title = ''

distance = 391
spam score = 26
title = ''

distance = 395
spam score = 34
title = ''

distance = 398
spam score = 50
title = ''

distance = 399
spam score = 28
title = ''

distance = 403
spam score = 27
title = ''

distance = 404
spam score = 27
title = ''

distance = 405
spam score = 50
title = ''

distance = 406
spam score = 28
title = ''

distance = 408
spam score = 27
title = ''

distance = 408
spam score = 29
title = ''

distance = 410
spam score = 52
title = ''

distance = 412
spam score = 30
title = ''

distance = 414
spam score = 18
title = ''

distance = 415
spam score = 45
title = ''

distance = 418
spam score = 37
title = ''

distance = 418
spam score = 33
title = ''

distance = 419
spam score = 47
title = ''

distance = 419
spam score = 34
title = ''

distance = 422
spam score = 19
title = ''

distance = 423
spam score = 31
title = ''

distance = 427
spam score = 51
title = ''

distance = 431
spam score = 48
title = ''

distance = 435
spam score = 28
title = ''

distance = 442
spam score = 32
title = ''

distance = 443
spam score = 33
title = ''

distance = 449
spam score = 33
title = ''

distance = 449
spam score = 30
title = ''

distance = 453
spam score = 33
title = ''

distance = 453
spam score = 27
title = ''

distance = 455
spam score = 30
title = ''

distance = 460
spam score = 52
title = ''

distance = 461
spam score = 29
title = ''

distance = 466
spam score = 34
title = ''

distance = 467
spam score = 32
title = ''

distance = 469
spam score = 28
title = ''

distance = 478
spam score = 40
title = ''

distance = 481
spam score = 33
title = ''

distance = 493
spam score = 36
title = ''

distance = 494
spam score = 34
title = ''

distance = 495
spam score = 34
title = ''

distance = 496
spam score = 31
title = ''

distance = 497
spam score = 34
title = ''

distance = 504
spam score = 34
title = ''

distance = 505
spam score = 46
title = ''

distance = 515
spam score = 37
title = ''

distance = 519
spam score = 32
title = ''

distance = 530
spam score = 40
title = ''

distance = 534
spam score = 31
title = ''

distance = 538
spam score = 34
title = ''

distance = 545
spam score = 33
title = ''

distance = 551
spam score = 42
title = ''

distance = 552
spam score = 28
title = ''

distance = 557
spam score = 24
title = ''

distance = 558
spam score = 44
title = ''

distance = 577
spam score = 33
title = ''

distance = 588
spam score = 29
title = ''

distance = 608
spam score = 32
title = ''

distance = 621
spam score = 39
title = ''

distance = 626
spam score = 35
title = ''

distance = 637
spam score = 30
title = ''

distance = 675
spam score = 33
title = ''

distance = 682
spam score = 32
title = ''

distance = 698
spam score = 38
title = ''

distance = 824
spam score = 30
title = ''

distance = 1412
spam score = 22
title = ''

distance = 1517
spam score = 38
title = ''

distance = 1586
spam score = 91
title = ''

distance = 134
spam score = 52
title = ''

distance = 141
spam score = 52
title = ''

distance = 159
spam score = 56
title = ''

distance = 160
spam score = 52
title = ''

distance = 166
spam score = 55
title = ''

distance = 169
spam score = 51
title = ''

distance = 181
spam score = 54
title = ''

distance = 195
spam score = 52
title = ''

distance = 207
spam score = 57
title = ''

distance = 222
spam score = 55
title = ''

distance = 225
spam score = 51
title = ''

distance = 239
spam score = 59
title = ''

distance = 244
spam score = 56
title = ''

distance = 245
spam score = 58
title = ''

distance = 250
spam score = 58
title = ''

distance = 258
spam score = 58
title = ''

distance = 263
spam score = 54
title = ''

distance = 266
spam score = 57
title = ''

distance = 293
spam score = 49
title = ''

distance = 1124
spam score = 52
title = ''

distance = 1139
spam score = 53
title = ''

distance = 1154
spam score = 53
title = ''

distance = 1206
spam score = 54
title = ''

distance = 24
spam score = 66
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 24
spam score = 66
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 24
spam score = 66
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 24
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 24
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 24
spam score = 65
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 24
spam score = 66
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 24
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 41
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 41
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 41
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 42
spam score = 69
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 42
spam score = 69
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 42
spam score = 69
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 42
spam score = 69
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 42
spam score = 68
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 42
spam score = 68
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 42
spam score = 69
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 46
spam score = 70
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 46
spam score = 71
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 93
spam score = 67
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 93
spam score = 68
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 93
spam score = 67
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 93
spam score = 67
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 93
spam score = 67
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 93
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 94
spam score = 70
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 95
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 96
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 97
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 116
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 116
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 116
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 117
spam score = 68
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 119
spam score = 66
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 122
spam score = 68
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 123
spam score = 72
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 123
spam score = 68
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 123
spam score = 66
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 124
spam score = 66
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 140
spam score = 67
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 143
spam score = 65
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 143
spam score = 64
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 144
spam score = 65
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 147
spam score = 69
title = 'stretch and company stretch the balloon dude balloon hats'

distance = 147
spam score = 69
title = 'stretch and company stretch the balloon dude balloon hats'

distance = 150
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 153
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 154
spam score = 67
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 154
spam score = 65
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 185
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 190
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 190
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 192
spam score = 69
title = 'stretch and company stretch the balloon dude balloon hats'

distance = 196
spam score = 68
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 197
spam score = 67
title = 'stretch and company stretch the balloon dude balloon twisting'

distance = 197
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 198
spam score = 69
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 199
spam score = 68
title = 'stretch and company stretch the balloon dude balloon hats'

distance = 200
spam score = 67
title = 'stretch and company stretch the balloon dude balloon artist'

distance = 248
spam score = 71
title = 'stretch and company balloon dawg balloon twisting'

distance = 249
spam score = 69
title = 'stretch and company balloon dawg balloon twisting'

distance = 250
spam score = 70
title = 'stretch and company balloon dawg balloon twisting'

distance = 251
spam score = 69
title = 'stretch and company balloon dawg balloon twisting'

distance = 259
spam score = 70
title = 'stretch and company balloon dawg balloon twisting'

distance = 266
spam score = 69
title = 'stretch and company balloon dawg balloon twisting'

distance = 272
spam score = 70
title = 'stretch and company balloon dawg balloon twisting'

distance = 284
spam score = 70
title = 'stretch and company balloon dawg balloon twisting'

distance = 291
spam score = 70
title = 'stretch and company balloon dawg balloon twisting'

distance = 303
spam score = 70
title = 'stretch and company balloon dawg balloon twisting'

distance = 345
spam score = 69
title = 'stretch the balloon dude balloon twisting animals flowers and bouquest deliveries'

distance = 378
spam score = 71
title = 'stretch the balloon dude balloon twisting animals flowers and bouquest deliveries'

distance = 379
spam score = 71
title = 'stretch the balloon dude balloon twisting animals flowers and bouquest deliveries'

distance = 379
spam score = 70
title = 'stretch the balloon dude balloon twisting animals flowers and bouquest deliveries'

distance = 380
spam score = 71
title = 'stretch the balloon dude balloon twisting animals flowers and bouquest deliveries'

distance = 381
spam score = 68
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 381
spam score = 67
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 381
spam score = 67
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 381
spam score = 67
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 381
spam score = 67
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 406
spam score = 68
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 406
spam score = 68
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 406
spam score = 68
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 406
spam score = 68
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 406
spam score = 68
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 410
spam score = 71
title = 'stretch the balloon dude balloon twisting animals flowers and bouquest deliveries'

distance = 412
spam score = 67
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 420
spam score = 67
title = 'stretch and company twistoloon balloon twisting delivery art by stretch'

distance = 422
spam score = 71
title = 'stretch the balloon dude balloon twisting animals flowers and bouquest deliveries'

distance = 423
spam score = 71
title = 'stretch the balloon dude balloon twisting animals flowers and bouquest deliveries'

distance = 672
spam score = 68
title = 'stretch and company safari sean face and body painting'

distance = 673
spam score = 67
title = 'stretch and company safari sean face and body painting'

distance = 692
spam score = 67
title = 'stretch and company safari sean face and body painting'

distance = 699
spam score = 68
title = 'stretch and company safari sean face and body painting'

distance = 708
spam score = 67
title = 'stretch and company safari sean face and body painting'

distance = 712
spam score = 67
title = 'stretch and company safari sean face and body painting'

distance = 958
spam score = 71
title = 'stretch and company the many faces of sean face and body painting'

distance = 1027
spam score = 65
title = 'stretch and company stretch the balloon dude balloon twisting artist'

distance = 1106
spam score = 51
title = 'stretch and company stretchs twisted safari'

distance = 1114
spam score = 55
title = 'stretch and company twisted party buddies'

distance = 1693
spam score = 17
title = 'le theacute226tre en anglais romeo and juliet dossier peacutedagogique act two scene one good night'

distance = 1768
spam score = 31
title = 'merrell jungle moc mens'

distance = 1773
spam score = 55
title = ''

distance = 1814
spam score = 56
title = ''

distance = 1851
spam score = 18
title = 'central league homer facts 1995'

distance = 224
spam score = 46
title = ''

distance = 287
spam score = 44
title = ''

distance = 290
spam score = 43
title = ''

distance = 296
spam score = 45
title = ''

distance = 297
spam score = 45
title = ''

distance = 299
spam score = 43
title = ''

distance = 315
spam score = 48
title = ''

distance = 327
spam score = 45
title = ''

distance = 337
spam score = 49
title = ''

distance = 339
spam score = 42
title = ''

distance = 340
spam score = 47
title = ''

distance = 346
spam score = 44
title = ''

distance = 358
spam score = 44
title = ''

distance = 365
spam score = 47
title = ''

distance = 371
spam score = 47
title = ''

distance = 374
spam score = 45
title = ''

distance = 378
spam score = 46
title = ''

distance = 395
spam score = 46
title = ''

distance = 398
spam score = 51
title = ''

distance = 401
spam score = 47
title = ''

distance = 403
spam score = 45
title = ''

distance = 403
spam score = 36
title = ''

distance = 432
spam score = 44
title = ''

distance = 437
spam score = 50
title = ''

distance = 458
spam score = 48
title = ''

distance = 468
spam score = 46
title = ''

distance = 535
spam score = 48
title = ''

distance = 547
spam score = 47
title = ''

distance = 549
spam score = 44
title = ''

distance = 657
spam score = 45
title = ''

distance = 662
spam score = 48
title = ''

distance = 668
spam score = 44
title = ''

distance = 794
spam score = 40
title = ''

distance = 911
spam score = 24
title = ''

distance = 1568
spam score = 44
title = ''

distance = 227
spam score = 64
title = ''

distance = 243
spam score = 67
title = ''

distance = 256
spam score = 67
title = ''

distance = 257
spam score = 69
title = ''

distance = 261
spam score = 67
title = ''

distance = 266
spam score = 62
title = ''

distance = 275
spam score = 68
title = ''

distance = 276
spam score = 65
title = ''

distance = 283
spam score = 64
title = ''

distance = 288
spam score = 66
title = ''

distance = 325
spam score = 65
title = ''

distance = 326
spam score = 62
title = ''

distance = 410
spam score = 64
title = ''

distance = 509
spam score = 58
title = ''

distance = 563
spam score = 59
title = ''

distance = 1654
spam score = 53
title = ''

distance = 139
spam score = 34
title = ''

distance = 144
spam score = 33
title = ''

distance = 146
spam score = 33
title = ''

distance = 150
spam score = 32
title = ''

distance = 165
spam score = 38
title = ''

distance = 166
spam score = 37
title = ''

distance = 167
spam score = 26
title = ''

distance = 170
spam score = 32
title = ''

distance = 171
spam score = 36
title = ''

distance = 174
spam score = 31
title = ''

distance = 177
spam score = 30
title = ''

distance = 178
spam score = 32
title = ''

distance = 191
spam score = 33
title = ''

distance = 192
spam score = 34
title = ''

distance = 194
spam score = 34
title = ''

distance = 199
spam score = 34
title = ''

distance = 202
spam score = 33
title = ''

distance = 202
spam score = 36
title = ''

distance = 203
spam score = 36
title = ''

distance = 205
spam score = 39
title = ''

distance = 212
spam score = 35
title = ''

distance = 216
spam score = 35
title = ''

distance = 217
spam score = 33
title = ''

distance = 218
spam score = 34
title = ''

distance = 224
spam score = 32
title = ''

distance = 230
spam score = 32
title = ''

distance = 236
spam score = 31
title = ''

distance = 243
spam score = 35
title = ''

distance = 245
spam score = 34
title = ''

distance = 247
spam score = 34
title = ''

distance = 252
spam score = 32
title = ''

distance = 254
spam score = 33
title = ''

distance = 258
spam score = 36
title = ''

distance = 258
spam score = 32
title = ''

distance = 259
spam score = 36
title = ''

distance = 268
spam score = 36
title = ''

distance = 269
spam score = 32
title = ''

distance = 350
spam score = 37
title = ''

distance = 391
spam score = 36
title = ''

distance = 392
spam score = 40
title = ''

distance = 418
spam score = 42
title = ''

distance = 419
spam score = 36
title = ''

distance = 448
spam score = 43
title = ''

distance = 477
spam score = 36
title = ''

distance = 479
spam score = 32
title = ''

distance = 509
spam score = 38
title = ''

distance = 518
spam score = 36
title = ''

distance = 532
spam score = 40
title = ''

distance = 551
spam score = 38
title = ''

distance = 577
spam score = 40
title = ''

distance = 583
spam score = 32
title = ''

distance = 590
spam score = 33
title = ''

distance = 602
spam score = 32
title = ''

distance = 609
spam score = 36
title = ''

distance = 629
spam score = 46
title = ''

distance = 630
spam score = 34
title = ''

distance = 635
spam score = 40
title = ''

distance = 683
spam score = 37
title = ''

distance = 695
spam score = 48
title = ''

distance = 701
spam score = 42
title = ''

distance = 701
spam score = 45
title = ''

distance = 719
spam score = 37
title = ''

distance = 733
spam score = 41
title = ''

distance = 761
spam score = 34
title = ''

distance = 786
spam score = 33
title = ''

distance = 893
spam score = 36
title = ''

distance = 913
spam score = 37
title = ''

distance = 980
spam score = 42
title = ''

distance = 1067
spam score = 39
title = ''

distance = 1151
spam score = 39
title = ''

distance = 1156
spam score = 26
title = ''

distance = 1623
spam score = 93
title = ''

distance = 152
spam score = 30
title = 'width property'

distance = 152
spam score = 37
title = 'height property'

distance = 160
spam score = 39
title = 'height property'

distance = 163
spam score = 30
title = 'width property'

distance = 171
spam score = 30
title = 'readonly property'

distance = 180
spam score = 33
title = 'id property'

distance = 182
spam score = 30
title = 'readonly property'

distance = 189
spam score = 35
title = 'clientid property'

distance = 189
spam score = 34
title = 'showdecreasebutton property'

distance = 192
spam score = 29
title = 'showpreviewmode property'

distance = 195
spam score = 37
title = 'showdecreasebutton property'

distance = 197
spam score = 35
title = 'clientid property'

distance = 197
spam score = 28
title = 'toggleborder property'

distance = 197
spam score = 29
title = 'borderstyle property'

distance = 199
spam score = 39
title = 'editorbodyclass property'

distance = 200
spam score = 31
title = 'showpreviewmode property'

distance = 202
spam score = 35
title = 'showcodeviewtoolbar property'

distance = 202
spam score = 30
title = 'toggleborder property'

distance = 205
spam score = 29
title = 'showtagselector property'

distance = 206
spam score = 31
title = 'downlevelrows property'

distance = 207
spam score = 31
title = 'showhtmlmode property'

distance = 210
spam score = 31
title = 'showtagselector property'

distance = 210
spam score = 35
title = 'showtoolbar property'

distance = 211
spam score = 35
title = 'showcodeviewtoolbar property'

distance = 211
spam score = 39
title = 'customculture property'

distance = 213
spam score = 34
title = 'showenlargebutton property'

distance = 213
spam score = 34
title = 'bordercolor property'

distance = 214
spam score = 31
title = 'borderstyle property'

distance = 214
spam score = 33
title = 'showhtmlmode property'

distance = 214
spam score = 40
title = 'editorbodyclass property'

distance = 214
spam score = 32
title = 'downlevelrows property'

distance = 217
spam score = 38
title = 'editorbodyid property'

distance = 218
spam score = 35
title = 'tabindex property'

distance = 220
spam score = 41
title = 'customculture property'

distance = 220
spam score = 34
title = 'showenlargebutton property'

distance = 220
spam score = 36
title = 'tabindex property'

distance = 222
spam score = 38
title = 'showtoolbar property'

distance = 222
spam score = 34
title = 'templateitemlist property'

distance = 223
spam score = 41
title = 'editorbodyid property'

distance = 223
spam score = 31
title = 'borderwidth property'

distance = 224
spam score = 33
title = 'downlevelcolumns property'

distance = 224
spam score = 36
title = 'editorbodystyle property'

distance = 227
spam score = 25
title = 'editordraw method'

distance = 228
spam score = 35
title = 'downlevelcolumns property'

distance = 228
spam score = 35
title = 'templateitemlist property'

distance = 231
spam score = 37
title = 'editorbodystyle property'

distance = 232
spam score = 32
title = 'xhtmloutput property'

distance = 234
spam score = 26
title = 'editordraw method'

distance = 238
spam score = 31
title = 'borderwidth property'

distance = 238
spam score = 34
title = 'contextmenumode property'

distance = 239
spam score = 34
title = 'xhtmloutput property'

distance = 241
spam score = 35
title = 'contextmenumode property'

distance = 256
spam score = 33
title = 'showbottombar property'

distance = 260
spam score = 36
title = 'fullpage property'

distance = 267
spam score = 34
title = 'showbottombar property'

distance = 271
spam score = 32
title = 'autoparseclasses property'

distance = 273
spam score = 37
title = 'fullpage property'

distance = 275
spam score = 33
title = 'autoparseclasses property'

distance = 279
spam score = 32
title = 'savefile method'

distance = 282
spam score = 30
title = 'loadhtml method'

distance = 284
spam score = 33
title = 'savefile method'

distance = 291
spam score = 30
title = 'loadhtml method'

distance = 291
spam score = 38
title = 'tabspaces'

distance = 291
spam score = 35
title = 'tabspaces'

distance = 293
spam score = 36
title = 'filespath property'

distance = 298
spam score = 28
title = 'securitypolicyfile property'

distance = 303
spam score = 29
title = 'securitypolicyfile property'

distance = 303
spam score = 34
title = 'maxtextlength property'

distance = 307
spam score = 35
title = 'maxhtmllength property'

distance = 309
spam score = 31
title = 'editorgetstring method'

distance = 312
spam score = 35
title = 'maxtextlength property'

distance = 314
spam score = 37
title = 'maxhtmllength property'

distance = 318
spam score = 33
title = 'editorgetstring method'

distance = 339
spam score = 33
title = 'disableitemlist property'

distance = 376
spam score = 23
title = 'alloweditserversidecode property'

distance = 376
spam score = 24
title = 'alloweditserversidecode property'

distance = 412
spam score = 35
title = 'removetbodytag property'

distance = 412
spam score = 43
title = 'disableclasslist property'

distance = 420
spam score = 36
title = 'removetbodytag property'

distance = 439
spam score = 42
title = 'usesimpleampersand property'

distance = 491
spam score = 47
title = 'subsequent property'

distance = 772
spam score = 34
title = 'image insertion and automatic upload'

distance = 775
spam score = 35
title = 'image insertion and automatic upload'

distance = 837
spam score = 43
title = 'support html code indentation and tags appear in lower case'

distance = 841
spam score = 63
title = 'asian'

distance = 841
spam score = 43
title = 'adding a flash to a page'

distance = 844
spam score = 40
title = 'unlimited levels of the undoredo feature'

distance = 844
spam score = 68
title = 'versions'

distance = 848
spam score = 40
title = 'unlimited levels of the undoredo feature'

distance = 866
spam score = 69
title = 'display'

distance = 883
spam score = 68
title = 'designer'

distance = 903
spam score = 70
title = 'transparency'

distance = 909
spam score = 70
title = 'image'

distance = 925
spam score = 69
title = 'keys are to small'

distance = 926
spam score = 71
title = 'unknown characters displayed'

distance = 933
spam score = 73
title = 'keyboard list menu'

distance = 935
spam score = 69
title = 'ctrlaltdel'

distance = 938
spam score = 67
title = 'idle'

distance = 939
spam score = 66
title = 'startup'

distance = 952
spam score = 76
title = 'navigation'

distance = 978
spam score = 58
title = 'abc'

distance = 982
spam score = 73
title = 'minimize keyboards'

distance = 996
spam score = 59
title = 'languages'

distance = 1017
spam score = 68
title = 'tweaks'

distance = 1091
spam score = 66
title = 'typing extended characters not present in the current keyboard layout'

distance = 1173
spam score = 75
title = 'keep the shift ctrl alt or altgr pressed'

distance = 1402
spam score = 46
title = 'cuteeditor'

distance = 1402
spam score = 46
title = 'cuteeditor'

distance = 5
spam score = 0
title = 'b v'

distance = 5
spam score = 0
title = 'e38 5 25 8'

distance = 87
spam score = 0
title = 'e vs1 platinum 1'

distance = 88
spam score = 0
title = 'evening purse'

distance = 88
spam score = 0
title = 'bardcontinuum'

distance = 88
spam score = 0
title = 'evening purses'

distance = 89
spam score = 0
title = 'benchmarkin'

distance = 89
spam score = 0
title = 'enviracaire'

distance = 90
spam score = 0
title = 'emoticons'

distance = 92
spam score = 0
title = 'explorer 7 0'

distance = 93
spam score = 0
title = 'ester c'

distance = 93
spam score = 0
title = 'escort'

distance = 93
spam score = 0
title = 'entertainment news'

distance = 93
spam score = 0
title = 'entertainment'

distance = 94
spam score = 0
title = 'e baypokermachine'

distance = 94
spam score = 0
title = 'early'

distance = 94
spam score = 0
title = 'elitezww32 exe'

distance = 94
spam score = 0
title = 'egt inc'

distance = 95
spam score = 0
title = 'enlightenment'

distance = 95
spam score = 0
title = 'becton'

distance = 204
spam score = 0
title = 'email etiquette'

distance = 204
spam score = 0
title = 'exceptional hand painted'

distance = 204
spam score = 0
title = 'evil queen from'

distance = 205
spam score = 0
title = 'eria unidentified'

distance = 205
spam score = 0
title = 'belfort 2 teacups'

distance = 205
spam score = 0
title = 'einfachheit trend'

distance = 205
spam score = 0
title = 'behringer mx2442 mx2442a 24'

distance = 206
spam score = 0
title = 'elephant collectible'

distance = 206
spam score = 0
title = 'electric candle'

distance = 206
spam score = 0
title = 'executive desk'

distance = 268
spam score = 0
title = 'bratz costume doll'

distance = 269
spam score = 0
title = 'emt classes in washington'

distance = 269
spam score = 0
title = 'barber beauty school'

distance = 269
spam score = 0
title = 'exquisite limoges porcelain'

distance = 269
spam score = 0
title = 'backpack mini purse'

distance = 269
spam score = 0
title = 'baby boy name'

distance = 270
spam score = 0
title = 'elliptical exercise equipment'

distance = 270
spam score = 0
title = 'book limoges vase'

distance = 270
spam score = 0
title = 'biology college ranking'

distance = 270
spam score = 0
title = 'early elite works'

distance = 280
spam score = 0
title = 'excellent minnie mouse'

distance = 280
spam score = 0
title = 'bathroom floorplans design'

distance = 281
spam score = 0
title = 'elegant old pouyat'

distance = 281
spam score = 0
title = 'exercise equipment treadmill'

distance = 281
spam score = 0
title = 'enterprise alabama gynecologist'

distance = 281
spam score = 0
title = 'br garbsen technologies'

distance = 281
spam score = 0
title = 'email directory of buddhist'

distance = 281
spam score = 0
title = 'bath body workscom'

distance = 281
spam score = 0
title = 'bionaire air cleaner'

distance = 281
spam score = 0
title = 'bouillon cup saucer'

distance = 294
spam score = 0
title = 'bob hair cuts'

distance = 294
spam score = 0
title = 'elegant crystal cross'

distance = 294
spam score = 0
title = 'breakfast nooks and booths'

distance = 295
spam score = 0
title = 'butterfly chair covers'

distance = 295
spam score = 0
title = 'excellent large hp'

distance = 295
spam score = 0
title = 'black river falls'

distance = 295
spam score = 0
title = 'experion credit bureau'

distance = 296
spam score = 0
title = 'beach palm tree'

distance = 296
spam score = 0
title = 'ecko outer wear'

distance = 296
spam score = 0
title = 'elegant limoges rose'

distance = 332
spam score = 0
title = 'east hampton double dresser'

distance = 332
spam score = 0
title = 'bernardaud limoges'

distance = 333
spam score = 0
title = 'baume et mercier 18k'

distance = 333
spam score = 0
title = 'bootable sony vaio external'

distance = 333
spam score = 0
title = 'best digital camera rating'

distance = 333
spam score = 0
title = 'example of a cover letter for a job'

distance = 334
spam score = 0
title = 'bataan under seige'

distance = 334
spam score = 0
title = 'bc businesses sale'

distance = 335
spam score = 0
title = 'budapest pension asterope pool'

distance = 335
spam score = 0
title = 'bourgeois acoustic'

distance = 370
spam score = 0
title = 'brand sony vaio notebook'

distance = 370
spam score = 0
title = 'evil queen hair chop'

distance = 370
spam score = 0
title = 'experian credit report agency'

distance = 371
spam score = 0
title = 'eternity platinum diamond cz'

distance = 371
spam score = 0
title = 'banquet tables for sale'

distance = 371
spam score = 0
title = 'eastern freeway trading company'

distance = 371
spam score = 0
title = 'exquisite lladro goose landing'

distance = 372
spam score = 0
title = 'breeder contract dog'

distance = 372
spam score = 0
title = 'book nada yellow'

distance = 372
spam score = 0
title = 'birth child photo video'

distance = 401
spam score = 0
title = 'boston house opera seating'

distance = 401
spam score = 0
title = 'building knowledge and mark'

distance = 401
spam score = 0
title = 'blakeman henderson limoges'

distance = 402
spam score = 0
title = 'bulldog stud service'

distance = 402
spam score = 0
title = 'electronic tool kit'

distance = 402
spam score = 0
title = 'baby frogs swarovski'

distance = 402
spam score = 0
title = 'best parttime law schools'

distance = 402
spam score = 0
title = 'blank picture shirt t'

distance = 402
spam score = 0
title = 'boxes folding manufacturers'

distance = 403
spam score = 0
title = 'bawo dotter elite'

distance = 485
spam score = 0
title = 'bam margera signed skateboard'

distance = 486
spam score = 0
title = 'boss roland dr670 drum'

distance = 486
spam score = 0
title = 'brand sony vaio notebooks'

distance = 486
spam score = 0
title = 'burke county nc government'

distance = 486
spam score = 0
title = 'biology science fair project'

distance = 487
spam score = 0
title = 'blue mountain foods uk'

distance = 488
spam score = 0
title = 'broken sony clie peg'

distance = 488
spam score = 0
title = 'birthday invitation card print'

distance = 489
spam score = 0
title = 'buy discount fertilizers time'

distance = 490
spam score = 0
title = 'bobble head donald duck'

distance = 1736
spam score = 46
title = 'psalm 81 psalmyn ghavid 1905'

distance = 1736
spam score = 53
title = 'taste our fine cheses munster great cheese from alsace fromagerie siffert freres sa'

distance = 1737
spam score = 68
title = 'ebuddiesorg'

distance = 1737
spam score = 68
title = 'ebuddiesorg'

distance = 1747
spam score = 6
title = 'unsharp cartilagines polycarp ceramiaceae unapprehensiveness nonconfirmation amphivasal'

distance = 1766
spam score = 23
title = 'kuwait cricket association'

distance = 1801
spam score = 1
title = 'definition of epiphanichtml by click4everything'

distance = 1862
spam score = 16
title = 'kickadee hill'

distance = 196
spam score = 55
title = 'leaders amp luminaries'

distance = 201
spam score = 43
title = ''

distance = 201
spam score = 43
title = ''

distance = 201
spam score = 45
title = ''

distance = 201
spam score = 44
title = ''

distance = 201
spam score = 45
title = ''

distance = 201
spam score = 44
title = ''

distance = 201
spam score = 44
title = ''

distance = 201
spam score = 44
title = ''

distance = 201
spam score = 44
title = ''

distance = 201
spam score = 43
title = ''

distance = 201
spam score = 44
title = ''

distance = 201
spam score = 44
title = ''

distance = 201
spam score = 42
title = ''

distance = 201
spam score = 42
title = ''

distance = 201
spam score = 41
title = ''

distance = 201
spam score = 44
title = ''

distance = 201
spam score = 44
title = ''

distance = 201
spam score = 43
title = ''

distance = 201
spam score = 44
title = ''

distance = 391
spam score = 55
title = 'adobe web photo gallery'

distance = 391
spam score = 34
title = ''

distance = 391
spam score = 47
title = 'zakim bridge north tower'

distance = 391
spam score = 58
title = 'robert godin clinic at mmmis 2007'

distance = 391
spam score = 48
title = 'trieste italy'

distance = 392
spam score = 41
title = 'middle wallop'

distance = 392
spam score = 56
title = 'templates'

distance = 392
spam score = 42
title = 'middle wallop'

distance = 392
spam score = 56
title = '2010 camp yamhill mens retreat'

distance = 392
spam score = 42
title = 'middle wallop'

distance = 416
spam score = 54
title = '2010 camp yamhill mens retreat'

distance = 416
spam score = 56
title = '2010 camp yamhill mens retreat'

distance = 416
spam score = 54
title = '2010 camp yamhill mens retreat'

distance = 416
spam score = 53
title = '2010 camp yamhill mens retreat'

distance = 416
spam score = 55
title = '2010 camp yamhill mens retreat'

distance = 416
spam score = 55
title = 'templates'

distance = 416
spam score = 54
title = '2010 camp yamhill mens retreat'

distance = 416
spam score = 55
title = '2010 camp yamhill mens retreat'

distance = 416
spam score = 55
title = 'templates'

distance = 417
spam score = 51
title = 'ajs freelancer guide service'

distance = 443
spam score = 60
title = 'quotwhere peace livesquot book signing by debbie robins'

distance = 443
spam score = 45
title = 'adobe web photo gallery'

distance = 443
spam score = 55
title = 'adobe web photo gallery'

distance = 443
spam score = 63
title = 'adobe web photo gallery'

distance = 443
spam score = 54
title = 'waipa world investment conference 2007 opening highlevel segment'

distance = 443
spam score = 54
title = '03 wcbf in mito japan'

distance = 443
spam score = 42
title = 'middle wallop'

distance = 443
spam score = 41
title = 'middle wallop'

distance = 443
spam score = 56
title = '03 wcbf in mito japan'

distance = 443
spam score = 56
title = 'vamperina and manila folder opening reception'

distance = 482
spam score = 43
title = 'gigha photo gallery'

distance = 482
spam score = 56
title = 'biras creek resort april 2007'

distance = 482
spam score = 36
title = ''

distance = 482
spam score = 57
title = 'adobe web photo gallery'

distance = 482
spam score = 49
title = 'the near family gallery east coast college visits'

distance = 482
spam score = 48
title = 'adobe web photo gallery'

distance = 482
spam score = 59
title = 'adobe web photo gallery'

distance = 483
spam score = 49
title = 'adobe web photo gallery'

distance = 483
spam score = 50
title = 'adobe web photo gallery'

distance = 483
spam score = 57
title = 'biras creek resort april 2007'

distance = 524
spam score = 44
title = 'peticoats for indian sarees in a variety of colors'

distance = 524
spam score = 63
title = 'adobe web photo gallery'

distance = 524
spam score = 44
title = 'peticoats for indian sarees in a variety of colors'

distance = 524
spam score = 54
title = 'kamps halloweendance'

distance = 524
spam score = 61
title = 'nlw church planters institutes'

distance = 524
spam score = 53
title = 'jagatsinghpur district odisha declared smoke free'

distance = 524
spam score = 56
title = 'pennsic war xxxvi'

distance = 524
spam score = 58
title = 'pennsic war xxxvi'

distance = 524
spam score = 48
title = 'the near family gallery general bali pictures'

distance = 524
spam score = 52
title = 'the near family gallery hallstatt'

distance = 551
spam score = 57
title = 'scandinavian callook classic 2007 gardermoen raceway'

distance = 551
spam score = 51
title = 'eagle science camp 2010session i'

distance = 551
spam score = 50
title = 'eagle science camp 2010session i'

distance = 551
spam score = 51
title = 'eagle science camp 2010session i'

distance = 551
spam score = 50
title = 'eagle science camp 2010session i'

distance = 551
spam score = 51
title = 'eagle science camp 2010session i'

distance = 551
spam score = 40
title = '2011 hunt photos'

distance = 551
spam score = 51
title = 'eagle science camp 2010session i'

distance = 551
spam score = 51
title = 'eagle science camp 2010session i'

distance = 551
spam score = 50
title = 'eagle science camp 2010session i'

distance = 598
spam score = 32
title = '2010 mid america drag racing saturday'

distance = 598
spam score = 32
title = '2010 mid america drag racing saturday'

distance = 598
spam score = 32
title = '2010 mid america drag racing saturday'

distance = 598
spam score = 32
title = '2010 mid america drag racing saturday'

distance = 598
spam score = 32
title = '2010 mid america drag racing saturday'

distance = 598
spam score = 32
title = '2010 mid america drag racing saturday'

distance = 598
spam score = 33
title = '2010 mid america drag racing saturday'

distance = 598
spam score = 33
title = '2010 mid america drag racing saturday'

distance = 598
spam score = 33
title = '2010 mid america drag racing saturday'

distance = 598
spam score = 33
title = '2010 mid america drag racing saturday'

distance = 676
spam score = 62
title = 'triumphant technology and trombones'

distance = 676
spam score = 44
title = 'carter caves 2006 folks photo gallery'

distance = 676
spam score = 44
title = 'carter caves 2006 folks photo gallery'

distance = 677
spam score = 38
title = 'martin luther king day celebration january 20 2003'

distance = 677
spam score = 41
title = 'carter caves 2006 jams photo gallery'

distance = 677
spam score = 39
title = 'martin luther king day celebration january 20 2003'

distance = 677
spam score = 44
title = 'carter caves 2006 folks photo gallery'

distance = 677
spam score = 41
title = 'martin luther king day celebration january 20 2003'

distance = 677
spam score = 40
title = 'martin luther king day celebration january 20 2003'

distance = 677
spam score = 40
title = 'martin luther king day celebration january 20 2003'

distance = 1864
spam score = 20
title = ''

distance = 1866
spam score = 59
title = 'gorau chwarae cyd chwarae'

distance = 283
spam score = 74
title = 'gregory lind gallery'

distance = 283
spam score = 75
title = 'gregory lind gallery'

distance = 283
spam score = 75
title = 'gregory lind gallery'

distance = 283
spam score = 75
title = 'gregory lind gallery'

distance = 287
spam score = 75
title = 'gregory lind gallery'

distance = 287
spam score = 74
title = 'gregory lind gallery'

distance = 287
spam score = 75
title = 'gregory lind gallery'

distance = 287
spam score = 75
title = 'gregory lind gallery'

distance = 287
spam score = 75
title = 'gregory lind gallery'

distance = 287
spam score = 74
title = 'gregory lind gallery'

distance = 297
spam score = 69
title = 'gregory lind gallery'

distance = 297
spam score = 69
title = 'gregory lind gallery'

distance = 297
spam score = 69
title = 'gregory lind gallery'

distance = 297
spam score = 68
title = 'gregory lind gallery'

distance = 304
spam score = 75
title = 'gregory lind gallery'

distance = 313
spam score = 73
title = 'gregory lind gallery'

distance = 315
spam score = 74
title = 'gregory lind gallery'

distance = 315
spam score = 75
title = 'gregory lind gallery'

distance = 316
spam score = 75
title = 'gregory lind gallery'

distance = 316
spam score = 76
title = 'gregory lind gallery'

distance = 362
spam score = 71
title = 'gregory lind gallery'

distance = 367
spam score = 69
title = 'gregory lind gallery'

distance = 377
spam score = 74
title = 'gregory lind gallery'

distance = 379
spam score = 79
title = 'gregory lind gallery'

distance = 379
spam score = 79
title = 'gregory lind gallery'

distance = 379
spam score = 80
title = 'gregory lind gallery'

distance = 379
spam score = 79
title = 'gregory lind gallery'

distance = 379
spam score = 80
title = 'gregory lind gallery'

distance = 380
spam score = 75
title = 'gregory lind gallery'

distance = 380
spam score = 73
title = 'gregory lind gallery'

distance = 398
spam score = 73
title = 'gregory lind gallery'

distance = 400
spam score = 69
title = 'gregory lind gallery'

distance = 402
spam score = 74
title = 'gregory lind gallery'

distance = 403
spam score = 70
title = 'gregory lind gallery'

distance = 404
spam score = 80
title = 'gregory lind gallery'

distance = 405
spam score = 84
title = 'gregory lind gallery'

distance = 410
spam score = 78
title = 'gregory lind gallery'

distance = 415
spam score = 80
title = 'gregory lind gallery'

distance = 421
spam score = 77
title = 'gregory lind gallery'

distance = 424
spam score = 65
title = 'gregory lind gallery'

distance = 455
spam score = 78
title = 'gregory lind gallery'

distance = 455
spam score = 67
title = 'gregory lind gallery'

distance = 460
spam score = 66
title = 'gregory lind gallery'

distance = 463
spam score = 67
title = 'gregory lind gallery'

distance = 463
spam score = 67
title = 'gregory lind gallery'

distance = 465
spam score = 74
title = 'gregory lind gallery'

distance = 466
spam score = 84
title = 'gregory lind gallery'

distance = 466
spam score = 84
title = 'gregory lind gallery'

distance = 468
spam score = 84
title = 'gregory lind gallery'

distance = 469
spam score = 66
title = 'gregory lind gallery'

distance = 480
spam score = 68
title = 'gregory lind gallery'

distance = 481
spam score = 66
title = 'gregory lind gallery'

distance = 482
spam score = 73
title = 'gregory lind gallery'

distance = 486
spam score = 66
title = 'gregory lind gallery'

distance = 486
spam score = 75
title = 'gregory lind gallery'

distance = 487
spam score = 74
title = 'gregory lind gallery'

distance = 489
spam score = 74
title = 'gregory lind gallery'

distance = 493
spam score = 67
title = 'gregory lind gallery'

distance = 494
spam score = 68
title = 'gregory lind gallery'

distance = 497
spam score = 70
title = 'gregory lind gallery'

distance = 518
spam score = 77
title = 'gregory lind gallery'

distance = 522
spam score = 83
title = 'gregory lind gallery'

distance = 527
spam score = 83
title = 'gregory lind gallery'

distance = 531
spam score = 69
title = 'gregory lind gallery'

distance = 531
spam score = 83
title = 'gregory lind gallery'

distance = 533
spam score = 83
title = 'gregory lind gallery'

distance = 534
spam score = 83
title = 'gregory lind gallery'

distance = 547
spam score = 82
title = 'gregory lind gallery'

distance = 547
spam score = 68
title = 'gregory lind gallery'

distance = 554
spam score = 71
title = 'gregory lind gallery'

distance = 575
spam score = 79
title = 'gregory lind gallery'

distance = 575
spam score = 69
title = 'gregory lind gallery'

distance = 575
spam score = 68
title = 'gregory lind gallery'

distance = 577
spam score = 69
title = 'gregory lind gallery'

distance = 578
spam score = 76
title = 'gregory lind gallery'

distance = 578
spam score = 75
title = 'gregory lind gallery'

distance = 582
spam score = 83
title = 'gregory lind gallery'

distance = 582
spam score = 83
title = 'gregory lind gallery'

distance = 589
spam score = 67
title = 'gregory lind gallery'

distance = 590
spam score = 83
title = 'gregory lind gallery'

distance = 630
spam score = 72
title = 'gregory lind gallery'

distance = 639
spam score = 66
title = 'gregory lind gallery'

distance = 640
spam score = 85
title = 'gregory lind gallery'

distance = 642
spam score = 84
title = 'gregory lind gallery'

distance = 643
spam score = 85
title = 'gregory lind gallery'

distance = 645
spam score = 74
title = 'gregory lind gallery'

distance = 648
spam score = 84
title = 'gregory lind gallery'

distance = 653
spam score = 66
title = 'gregory lind gallery'

distance = 661
spam score = 76
title = 'gregory lind gallery'

distance = 663
spam score = 84
title = 'gregory lind gallery'

distance = 711
spam score = 74
title = 'gregory lind gallery'

distance = 712
spam score = 67
title = 'gregory lind gallery'

distance = 715
spam score = 72
title = 'gregory lind gallery'

distance = 722
spam score = 82
title = 'gregory lind gallery'

distance = 723
spam score = 67
title = 'gregory lind gallery'

distance = 730
spam score = 79
title = 'gregory lind gallery'

distance = 734
spam score = 67
title = 'gregory lind gallery'

distance = 740
spam score = 77
title = 'gregory lind gallery'

distance = 755
spam score = 82
title = 'gregory lind gallery'

distance = 767
spam score = 74
title = 'gregory lind gallery'

distance = 343
spam score = 72
title = ''

distance = 357
spam score = 60
title = ''

distance = 423
spam score = 70
title = ''

distance = 488
spam score = 73
title = ''

distance = 594
spam score = 56
title = ''

distance = 710
spam score = 63
title = ''

distance = 747
spam score = 57
title = ''

distance = 148
spam score = 78
title = 'london 2010'

distance = 148
spam score = 78
title = 'london 2010'

distance = 148
spam score = 77
title = 'london 2010'

distance = 148
spam score = 78
title = 'london 2010'

distance = 148
spam score = 78
title = 'london 2010'

distance = 165
spam score = 78
title = 'stonehenge 2010'

distance = 165
spam score = 79
title = 'stonehenge 2010'

distance = 165
spam score = 79
title = 'stonehenge 2010'

distance = 165
spam score = 79
title = 'stonehenge 2010'

distance = 165
spam score = 78
title = 'stonehenge 2010'

distance = 165
spam score = 79
title = 'stonehenge 2010'

distance = 165
spam score = 79
title = 'stonehenge 2010'

distance = 165
spam score = 79
title = 'stonehenge 2010'

distance = 165
spam score = 78
title = 'stonehenge 2010'

distance = 165
spam score = 78
title = 'stonehenge 2010'

distance = 165
spam score = 79
title = 'stonehenge 2010'

distance = 165
spam score = 79
title = 'stonehenge 2010'

distance = 165
spam score = 79
title = 'stonehenge 2010'

distance = 165
spam score = 78
title = 'stonehenge 2010'

distance = 172
spam score = 78
title = 'notredame2010'

distance = 306
spam score = 80
title = 'germany 2007'

distance = 306
spam score = 79
title = 'london 2010'

distance = 307
spam score = 81
title = 'london 2010'

distance = 307
spam score = 80
title = 'arecibo puerto rico 2004'

distance = 308
spam score = 78
title = 'notredame2010'

distance = 309
spam score = 78
title = 'london 2010'

distance = 310
spam score = 80
title = ''

distance = 310
spam score = 75
title = 'germany 2007'

distance = 311
spam score = 76
title = 'germany 2007'

distance = 311
spam score = 78
title = 'austria 2007'

distance = 342
spam score = 77
title = 'zurich 2010'

distance = 343
spam score = 76
title = 'austria 2007'

distance = 344
spam score = 81
title = 'europe 1997 france'

distance = 344
spam score = 76
title = 'england 2006'

distance = 344
spam score = 78
title = 'london 2010'

distance = 345
spam score = 78
title = 'zurich 2010'

distance = 346
spam score = 79
title = 'iceland 2010'

distance = 346
spam score = 77
title = 'zurich 2010'

distance = 346
spam score = 83
title = 'europe 1997 alps'

distance = 346
spam score = 78
title = 'iceland 2010'

distance = 387
spam score = 80
title = ''

distance = 388
spam score = 81
title = 'europe 1997 alps'

distance = 388
spam score = 79
title = 'london 2010'

distance = 389
spam score = 77
title = 'austria 2007'

distance = 390
spam score = 78
title = 'paris 2010'

distance = 390
spam score = 78
title = 'arecibo puerto rico 2004'

distance = 390
spam score = 76
title = 'germany 2007'

distance = 391
spam score = 79
title = 'germany 2007'

distance = 392
spam score = 81
title = 'europe 1997 france'

distance = 395
spam score = 82
title = 'paris 2010'

distance = 450
spam score = 80
title = 'scotland honeymoon 1995'

distance = 450
spam score = 78
title = 'amsterdam 2008'

distance = 453
spam score = 79
title = 'paris 2010'

distance = 454
spam score = 81
title = 'europe 1997 france'

distance = 454
spam score = 79
title = 'zurich 2010'

distance = 460
spam score = 77
title = 'amsterdam 2008'

distance = 460
spam score = 81
title = 'europe 1997 grenoble'

distance = 461
spam score = 81
title = 'goteborg sweden 2002'

distance = 462
spam score = 79
title = 'arecibo puerto rico 2004'

distance = 464
spam score = 80
title = 'europe 1997 france'

distance = 532
spam score = 79
title = 'arecibo puerto rico 2004'

distance = 534
spam score = 82
title = 'europe 1997 lac leman'

distance = 535
spam score = 80
title = 'arecibo puerto rico 2004'

distance = 535
spam score = 78
title = 'paris 2010'

distance = 536
spam score = 77
title = 'amsterdam 2008'

distance = 538
spam score = 80
title = 'machu picchu peru 2000'

distance = 538
spam score = 82
title = 'europe 1997 lac leman'

distance = 539
spam score = 77
title = 'arecibo puerto rico 2004'

distance = 540
spam score = 78
title = 'oslo 2002'

distance = 540
spam score = 81
title = 'amsterdam 2008'

distance = 616
spam score = 81
title = 'oslo 2002'

distance = 616
spam score = 80
title = 'dublin 1999'

distance = 617
spam score = 82
title = 'bavaria 1999'

distance = 619
spam score = 81
title = 'dublin 1999'

distance = 620
spam score = 81
title = 'dublin 1999'

distance = 621
spam score = 80
title = 'dublin 1999'

distance = 623
spam score = 79
title = 'amsterdam 2008'

distance = 624
spam score = 80
title = 'peloponnese 1999'

distance = 626
spam score = 81
title = 'peloponnese 1999'

distance = 626
spam score = 83
title = 'peloponnese 1999'

distance = 677
spam score = 80
title = 'corfu kerkira greece 1999'

distance = 679
spam score = 82
title = 'munich 1999'

distance = 679
spam score = 81
title = 'corfu kerkira greece 1999'

distance = 679
spam score = 82
title = 'europe 1996 france'

distance = 679
spam score = 81
title = 'bavaria 1999'

distance = 681
spam score = 80
title = 'corfu kerkira greece 1999'

distance = 683
spam score = 79
title = 'bavaria 1999'

distance = 683
spam score = 82
title = 'corfu kerkira greece 1999'

distance = 685
spam score = 81
title = 'machu picchu peru 2000'

distance = 686
spam score = 80
title = 'bavaria 1999'

distance = 762
spam score = 81
title = 'regensburg 1999'

distance = 762
spam score = 82
title = 'corfu kerkira greece 1999'

distance = 763
spam score = 81
title = 'mainland greece delphi and athens'

distance = 764
spam score = 81
title = 'bavaria 1999'

distance = 767
spam score = 78
title = 'regensburg 1999'

distance = 769
spam score = 84
title = 'regensburg 1999'

distance = 769
spam score = 81
title = 'mainland greece delphi and athens'

distance = 770
spam score = 77
title = 'peloponnese 1999'

distance = 772
spam score = 81
title = 'mainland greece delphi and athens'

distance = 777
spam score = 81
title = 'mainland greece delphi and athens'

distance = 1150
spam score = 61
title = 'wren photo album kyoto 2004'

distance = 1169
spam score = 62
title = 'chapternbsp2nbsppreparing a new partition'

distance = 1191
spam score = 61
title = ''

distance = 1226
spam score = 56
title = ''

distance = 1240
spam score = 55
title = ''

distance = 1292
spam score = 62
title = ''

distance = 1858
spam score = 33
title = '20052006 shadden series'

distance = 1872
spam score = 36
title = ''

distance = 333
spam score = 0
title = ''

distance = 333
spam score = 0
title = ''

distance = 341
spam score = 0
title = ''

distance = 388
spam score = 0
title = ''

distance = 545
spam score = 1
title = ''

distance = 556
spam score = 1
title = ''

distance = 567
spam score = 1
title = ''

distance = 583
spam score = 1
title = ''

distance = 584
spam score = 1
title = ''

distance = 592
spam score = 0
title = ''

distance = 639
spam score = 1
title = ''

distance = 864
spam score = 0
title = ''

distance = 150
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah the kremlin hookah'

distance = 157
spam score = 11
title = 'blowoscom smoke hookah be happy buy hookah 5 hookah filters package'

distance = 174
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah the 20 inch cleopatra hookah'

distance = 193
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah white traditional shemagh'

distance = 222
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah yellow traditional shemagh'

distance = 223
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah arab scarf shemaghsquare design'

distance = 240
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghburgundy'

distance = 251
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah alhelal charcoals for small hookahs12 pcs'

distance = 252
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghdeep purple'

distance = 254
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah coconara charcoal 84 piece box'

distance = 261
spam score = 5
title = 'blowoscom smoke hookah be happy buy hookah a complete authentic arabic kaffiyeh set'

distance = 263
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah large velvet and silver hookah hose'

distance = 266
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghsilver star'

distance = 278
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghpurple star'

distance = 289
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghthe red skulls'

distance = 289
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghpurple hearts'

distance = 291
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghblack burgundy'

distance = 292
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghyellow smiley'

distance = 292
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghthe black skulls'

distance = 300
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghnavy blue stars'

distance = 425
spam score = 4
title = 'blowoscom smoke hookah be happy buy hookah the al waha package'

distance = 426
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah the triple hose package'

distance = 427
spam score = 11
title = 'blowoscom smoke hookah be happy buy hookah pumpkinglass base'

distance = 433
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah cleaning brush'

distance = 435
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah hookah tongs'

distance = 435
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah red white traditional shemaghthe premium arab scarf'

distance = 446
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah white black traditional shemagh'

distance = 452
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah must have accessory kit'

distance = 458
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah akhla charcoal 40mm'

distance = 458
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah the ultimate tobacco shisha package'

distance = 470
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah the rotating hookah package'

distance = 470
spam score = 11
title = 'blowoscom smoke hookah be happy buy hookah the modern syrian hose'

distance = 470
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghred white'

distance = 470
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghred black'

distance = 472
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah synthetic leather hookah hose'

distance = 472
spam score = 5
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghgreen black'

distance = 473
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah 1hose large sahara hookah stem'

distance = 473
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghbrown black'

distance = 473
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghbrown cream'

distance = 480
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah simple clay bowl'

distance = 490
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah 2hose large sahara hookah stem'

distance = 491
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghblue white'

distance = 493
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah 1hose medium sahara hookah stem'

distance = 493
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghblue black'

distance = 493
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghgreen white'

distance = 493
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghlight yellow black'

distance = 496
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghturquoise black hearts'

distance = 501
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghblack grey'

distance = 502
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemagholive black'

distance = 504
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghorange black'

distance = 509
spam score = 7
title = 'blowoscom hookah shop hookah guide find sahara hookahs on sale smoke hookah be happy'

distance = 511
spam score = 11
title = 'blowoscom smoke hookah be happy buy hookah the cobra hose'

distance = 513
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghyellow sunflowers black'

distance = 514
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghthe black white stars'

distance = 514
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghlight olive black'

distance = 515
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah grommets'

distance = 516
spam score = 6
title = 'blowoscom hookah shop hookah guide find hookah pipes on sale smoke hookah be happy'

distance = 517
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah al waha charcoal coal holder'

distance = 523
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah cotton arab scarf shemaghpurple white'

distance = 523
spam score = 7
title = 'blowoscom hookah shop hookah guide find mini hookahs on sale smoke hookah be happy'

distance = 534
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah 2hose small silver genie hookah stem'

distance = 539
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah mini keffiyehgreen white'

distance = 543
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah 1hose small silver genie hookah stem'

distance = 550
spam score = 11
title = 'blowoscom smoke hookah be happy buy hookah the 31 inch silver diamond hookah'

distance = 557
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah the milky glass baseblack'

distance = 559
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah the poker charcoal 1 pcs'

distance = 560
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah hutnatural charcoal 1kg'

distance = 561
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah 1hose small black genie hookah stem'

distance = 564
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah the mega cobra hose'

distance = 565
spam score = 6
title = 'blowoscom smoke hookah be happy buy hookah 2hose small black genie hookah stem'

distance = 582
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah the new beginners package'

distance = 582
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah soex quicklite charcoals'

distance = 585
spam score = 5
title = 'blowoscom smoke hookah be happy buy hookah the discount package'

distance = 586
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah coconara charcoal 16 piece box'

distance = 589
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah double blown swirl pyrex hookah bowl'

distance = 593
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah 5 rolls of alhelal charcoals'

distance = 594
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah the royal shiek hose'

distance = 595
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah shisha molasses afzal 5gr carton'

distance = 601
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah shisha nakhla molasses 175gr box'

distance = 603
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah hookah foil 1 pcs'

distance = 617
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah the alwaha 15 flavor package'

distance = 622
spam score = 5
title = 'blowoscom smoke hookah be happy buy hookah delilah hookah'

distance = 624
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah gypsy hookah'

distance = 629
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah the clay bowls package'

distance = 629
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah shisha molasses saet safa 2gr box'

distance = 632
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah 22 inch 1hose persian hookah stem'

distance = 636
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah exotica square finger natural hookah charcoal box'

distance = 637
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah hookah tree tshirtnavy blue'

distance = 638
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah large clay bowl'

distance = 644
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah shisha molasses alfakher 25gr box'

distance = 663
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah the fiesta package'

distance = 664
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah sinbad hookah'

distance = 679
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah dragon round hookah'

distance = 684
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah the special egyptian fifi hose'

distance = 684
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah 3 boxes of incenserose'

distance = 689
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah dragon bell hookah'

distance = 696
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah sultan hookah'

distance = 698
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah male type clay bowl'

distance = 698
spam score = 11
title = 'blowoscom smoke hookah be happy buy hookah anubis hookah'

distance = 699
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah 3 boxes of incensejasmine'

distance = 733
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah sphinx hookah'

distance = 736
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah exotica square finger natural hookah charcoal 3 pack'

distance = 756
spam score = 7
title = 'blowoscom smoke hookah be happy buy hookah nakhla mizo 5gr box'

distance = 799
spam score = 9
title = 'blowoscom smoke hookah be happy buy hookah soex herbal hookah molasses 1 flavors mix'

distance = 802
spam score = 8
title = 'blowoscom smoke hookah be happy buy hookah shisha molasses alfakher 5gr carton'

distance = 815
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah soex shisha molasses herbal 5gr box'

distance = 849
spam score = 10
title = 'blowoscom smoke hookah be happy buy hookah soex shisha molasses herbal 5gr carton'

distance = 905
spam score = 7
title = 'blowoscom hookah shop hookah guide find modern hookahs on sale smoke hookah be happy'

distance = 1477
spam score = 9
title = 'blowoscom hookah shop hookah guide find arab scarfs on sale smoke hookah be happy'

distance = 111
spam score = 43
title = 'antique wedding band'

distance = 118
spam score = 41
title = 'antique wedding band'

distance = 118
spam score = 41
title = 'antique wedding band'

distance = 124
spam score = 41
title = 'antique wedding band or stack ring'

distance = 124
spam score = 40
title = 'antique wedding band or stack ring'

distance = 124
spam score = 39
title = 'antique wedding band or stack ring'

distance = 124
spam score = 40
title = 'antique wedding band or stack ring'

distance = 124
spam score = 40
title = 'antique wedding band or stack ring'

distance = 124
spam score = 42
title = 'antique wedding band or stack ring'

distance = 124
spam score = 41
title = 'antique wedding band or stack ring'

distance = 124
spam score = 42
title = 'antique wedding band or stack ring'

distance = 127
spam score = 38
title = 'antique wedding band or stack ring'

distance = 127
spam score = 39
title = 'antique wedding band or stack ring'

distance = 128
spam score = 40
title = 'antique wedding band or stack ring'

distance = 128
spam score = 40
title = 'antique wedding band or stack ring'

distance = 128
spam score = 39
title = 'antique wedding band or stack ring'

distance = 128
spam score = 40
title = 'antique wedding band or stack ring'

distance = 130
spam score = 39
title = 'antique wedding band or stack ring'

distance = 130
spam score = 43
title = 'antique wedding band or stack ring'

distance = 131
spam score = 41
title = 'antique wedding band or stack ring'

distance = 138
spam score = 41
title = 'antique wedding band or stack ring'

distance = 139
spam score = 39
title = 'antique wedding band or stack ring'

distance = 140
spam score = 39
title = 'antique wedding band or stack ring'

distance = 140
spam score = 42
title = 'antique wedding band'

distance = 141
spam score = 40
title = 'antique wedding band or stack ring'

distance = 142
spam score = 46
title = 'antique wedding band'

distance = 142
spam score = 45
title = 'antique wedding band'

distance = 142
spam score = 45
title = 'antique wedding band'

distance = 142
spam score = 46
title = 'antique wedding band'

distance = 144
spam score = 40
title = 'antique wedding band or stack ring'

distance = 147
spam score = 44
title = 'antique wedding band'

distance = 149
spam score = 44
title = 'antique wedding band'

distance = 150
spam score = 41
title = 'antique wedding band or stack ring'

distance = 152
spam score = 44
title = 'antique wedding band'

distance = 154
spam score = 42
title = 'antique wedding band or stack ring'

distance = 154
spam score = 43
title = 'antique wedding band or stack ring'

distance = 154
spam score = 47
title = 'antique wedding band'

distance = 155
spam score = 41
title = 'antique wedding band or stack ring'

distance = 156
spam score = 41
title = 'antique wedding band or stack ring'

distance = 157
spam score = 41
title = 'antique wedding band or stack ring'

distance = 163
spam score = 47
title = 'antique wedding band'

distance = 167
spam score = 40
title = 'antique wedding band or stack ring'

distance = 167
spam score = 38
title = 'antique wedding band or stack ring'

distance = 175
spam score = 40
title = 'antique wedding band or stack ring'

distance = 185
spam score = 42
title = 'antique wedding band'

distance = 186
spam score = 40
title = 'antique wedding band or stack ring'

distance = 323
spam score = 36
title = 'antique pearl ring'

distance = 370
spam score = 34
title = 'vintage gold ring'

distance = 382
spam score = 35
title = 'vintage gold ring'

distance = 411
spam score = 34
title = 'estate jade ring'

distance = 438
spam score = 31
title = 'antique opal ring'

distance = 438
spam score = 26
title = 'antique pearl ring'

distance = 449
spam score = 27
title = 'vintage gold ring'

distance = 454
spam score = 34
title = 'antique pearl ring'

distance = 456
spam score = 27
title = 'vintage gold ring'

distance = 456
spam score = 27
title = 'vintage gold ring'

distance = 457
spam score = 39
title = 'mens antique signet ring'

distance = 462
spam score = 26
title = 'antique cameo ring estate antique jewelry'

distance = 485
spam score = 38
title = 'antique pearl cufflinks estate'

distance = 490
spam score = 32
title = 'vintage black star ring'

distance = 511
spam score = 38
title = 'antique sapphire cufflinks vintage'

distance = 562
spam score = 42
title = 'antique ruby ring rose bouquet'

distance = 565
spam score = 22
title = 'heart charm'

distance = 593
spam score = 41
title = 'vintage swank cufflinks'

distance = 593
spam score = 39
title = 'vintage swank cufflinks'

distance = 593
spam score = 39
title = 'vintage swank cufflinks'

distance = 593
spam score = 39
title = 'vintage swank cufflinks'

distance = 593
spam score = 37
title = 'vintage swank cufflinks'

distance = 593
spam score = 37
title = 'vintage swank cufflinks'

distance = 593
spam score = 23
title = 'antique vintage saxophone charm'

distance = 599
spam score = 40
title = 'vintage swank cufflinks'

distance = 600
spam score = 40
title = 'vintage swank cufflinks'

distance = 601
spam score = 39
title = 'vintage swank cufflinks'

distance = 601
spam score = 37
title = 'vintage swank cufflinks'

distance = 602
spam score = 38
title = 'vintage swank cufflinks'

distance = 603
spam score = 38
title = 'vintage swank cufflinks'

distance = 603
spam score = 38
title = 'vintage swank cufflinks'

distance = 603
spam score = 41
title = 'vintage compact'

distance = 607
spam score = 40
title = 'vintage swank cufflinks'

distance = 607
spam score = 39
title = 'vintage swank cufflinks'

distance = 616
spam score = 39
title = 'vintage swank cufflinks'

distance = 618
spam score = 42
title = 'vintage compact'

distance = 620
spam score = 39
title = 'vintage compact'

distance = 622
spam score = 40
title = 'vintage swank cufflinks'

distance = 625
spam score = 23
title = 'antique vintage four leaf clover charm'

distance = 627
spam score = 41
title = 'vintage compact'

distance = 628
spam score = 10
title = 'antique wedding bands'

distance = 642
spam score = 10
title = 'antique wedding bands'

distance = 650
spam score = 9
title = 'antique wedding bands'

distance = 653
spam score = 12
title = 'antique wedding bands'

distance = 731
spam score = 38
title = 'vintage sports compact'

distance = 781
spam score = 13
title = 'antique cufflinks estate vintage'

distance = 815
spam score = 23
title = 'antique earrings estate'

distance = 873
spam score = 15
title = 'vintage compacts'

distance = 1114
spam score = 56
title = 'antique style engagement rings wedding bands white gold platinum'

distance = 1119
spam score = 59
title = 'mens diamond engagement wedding ring'

distance = 1126
spam score = 57
title = 'antique wedding band white gold'

distance = 1129
spam score = 57
title = 'antique wedding band white gold'

distance = 1129
spam score = 57
title = 'antique wedding band white gold'

distance = 1131
spam score = 55
title = 'antique wedding band white gold'

distance = 1170
spam score = 55
title = 'antique wedding band white gold'

distance = 1200
spam score = 51
title = 'antique style engagement rings wedding bands white gold platinum'

distance = 1213
spam score = 55
title = 'antique style engagement rings wedding bands white gold platinum'

distance = 1626
spam score = 91
title = 'rings and jewels'

distance = 94
spam score = 39
title = ''

distance = 164
spam score = 37
title = ''

distance = 180
spam score = 40
title = ''

distance = 194
spam score = 35
title = ''

distance = 207
spam score = 40
title = ''

distance = 217
spam score = 40
title = ''

distance = 236
spam score = 44
title = ''

distance = 236
spam score = 43
title = ''

distance = 252
spam score = 43
title = ''

distance = 269
spam score = 43
title = ''

distance = 307
spam score = 41
title = ''

distance = 323
spam score = 42
title = ''

distance = 332
spam score = 37
title = ''

distance = 342
spam score = 42
title = ''

distance = 361
spam score = 36
title = ''

distance = 387
spam score = 45
title = ''

distance = 409
spam score = 45
title = ''

distance = 427
spam score = 41
title = ''

distance = 429
spam score = 45
title = ''

distance = 445
spam score = 40
title = ''

distance = 445
spam score = 41
title = ''

distance = 445
spam score = 41
title = ''

distance = 445
spam score = 41
title = ''

distance = 445
spam score = 40
title = ''

distance = 447
spam score = 44
title = ''

distance = 450
spam score = 41
title = ''

distance = 453
spam score = 44
title = ''

distance = 453
spam score = 39
title = ''

distance = 455
spam score = 43
title = ''

distance = 456
spam score = 40
title = ''

distance = 457
spam score = 43
title = ''

distance = 459
spam score = 42
title = ''

distance = 460
spam score = 42
title = ''

distance = 461
spam score = 39
title = ''

distance = 462
spam score = 39
title = ''

distance = 463
spam score = 44
title = ''

distance = 468
spam score = 41
title = ''

distance = 469
spam score = 44
title = ''

distance = 471
spam score = 42
title = ''

distance = 478
spam score = 39
title = ''

distance = 480
spam score = 44
title = ''

distance = 480
spam score = 42
title = ''

distance = 485
spam score = 41
title = ''

distance = 486
spam score = 42
title = ''

distance = 487
spam score = 39
title = ''

distance = 491
spam score = 45
title = ''

distance = 492
spam score = 41
title = ''

distance = 498
spam score = 44
title = ''

distance = 498
spam score = 40
title = ''

distance = 501
spam score = 46
title = ''

distance = 502
spam score = 44
title = ''

distance = 503
spam score = 45
title = ''

distance = 504
spam score = 45
title = ''

distance = 504
spam score = 42
title = ''

distance = 507
spam score = 44
title = ''

distance = 508
spam score = 45
title = ''

distance = 508
spam score = 44
title = ''

distance = 508
spam score = 45
title = ''

distance = 521
spam score = 44
title = ''

distance = 522
spam score = 44
title = ''

distance = 528
spam score = 45
title = ''

distance = 539
spam score = 39
title = ''

distance = 542
spam score = 45
title = ''

distance = 553
spam score = 48
title = ''

distance = 563
spam score = 45
title = ''

distance = 614
spam score = 41
title = ''

distance = 623
spam score = 44
title = ''

distance = 623
spam score = 42
title = ''

distance = 628
spam score = 38
title = ''

distance = 636
spam score = 41
title = ''

distance = 636
spam score = 42
title = ''

distance = 643
spam score = 43
title = ''

distance = 677
spam score = 42
title = ''

distance = 698
spam score = 44
title = ''

distance = 716
spam score = 36
title = ''

distance = 719
spam score = 38
title = ''

distance = 729
spam score = 42
title = ''

distance = 733
spam score = 40
title = ''

distance = 765
spam score = 38
title = ''

distance = 766
spam score = 40
title = ''

distance = 768
spam score = 39
title = ''

distance = 789
spam score = 43
title = ''

distance = 793
spam score = 45
title = ''

distance = 802
spam score = 44
title = ''

distance = 886
spam score = 45
title = ''

distance = 922
spam score = 36
title = ''

distance = 1003
spam score = 19
title = ''

distance = 1643
spam score = 47
title = ''

distance = 243
spam score = 26
title = 'bob dunsires piping photo for tuesday'

distance = 256
spam score = 24
title = 'bob dunsires piping photo for tuesday'

distance = 283
spam score = 24
title = 'bob dunsires piping photo for wednesday'

distance = 292
spam score = 25
title = 'bob dunsires piping photo for wednesday'

distance = 298
spam score = 28
title = 'bob dunsires piping photo for saturday'

distance = 304
spam score = 22
title = 'bob dunsires piping photo for friday'

distance = 318
spam score = 25
title = 'bob dunsires piping photo for tuesday'

distance = 319
spam score = 26
title = 'bob dunsires piping photo for sunday'

distance = 322
spam score = 22
title = 'bob dunsires piping photo for friday'

distance = 326
spam score = 23
title = 'bob dunsires piping photo for wednesday'

distance = 326
spam score = 23
title = 'bob dunsires piping photo of the day'

distance = 326
spam score = 20
title = 'bob dunsires piping photo for thursday'

distance = 329
spam score = 23
title = 'bob dunsires piping photo for monday'

distance = 330
spam score = 21
title = 'bob dunsires piping photo of the day'

distance = 330
spam score = 25
title = 'bob dunsires piping photo for tuesday'

distance = 330
spam score = 22
title = 'bob dunsires piping photo of the day'

distance = 335
spam score = 24
title = 'bob dunsires piping photo for tuesday'

distance = 336
spam score = 26
title = 'bob dunsires piping photo for tuesday'

distance = 342
spam score = 24
title = 'bob dunsires piping photo for friday'

distance = 345
spam score = 21
title = 'bob dunsires piping photo of the day'

distance = 387
spam score = 21
title = 'bob dunsires piping photo of the day'

distance = 389
spam score = 23
title = 'bob dunsires piping photo for tuesday'

distance = 390
spam score = 22
title = 'bob dunsires piping photo of the day'

distance = 390
spam score = 24
title = 'bob dunsires piping photo of the day'

distance = 391
spam score = 24
title = 'bob dunsires piping photo for thursday'

distance = 391
spam score = 26
title = 'bob dunsires piping photo for thursday'

distance = 392
spam score = 19
title = 'bob dunsires piping photo for monday'

distance = 393
spam score = 21
title = 'bob dunsires piping photo of the day'

distance = 393
spam score = 22
title = 'bob dunsires piping photo for monday'

distance = 394
spam score = 21
title = 'bob dunsires piping photo of the day'

distance = 411
spam score = 23
title = 'bob dunsires piping photo of the day'

distance = 412
spam score = 20
title = 'bob dunsires piping photo for wednesday'

distance = 412
spam score = 23
title = 'bob dunsires piping photo for tuesday'

distance = 414
spam score = 22
title = 'bob dunsires piping photo for wednesday'

distance = 414
spam score = 25
title = 'bob dunsires piping photo of the day'

distance = 417
spam score = 24
title = 'bob dunsires piping photo of the day'

distance = 417
spam score = 23
title = 'bob dunsires piping photo for monday'

distance = 417
spam score = 29
title = 'bob dunsires piping photo for saturday'

distance = 418
spam score = 23
title = 'bob dunsires piping photo for wednesday'

distance = 423
spam score = 22
title = 'bob dunsires piping photo for wednesday'

distance = 445
spam score = 23
title = 'bob dunsires piping photo of the day'

distance = 446
spam score = 27
title = 'bob dunsires piping photo of the day'

distance = 449
spam score = 25
title = 'bob dunsires piping photo for thursday'

distance = 449
spam score = 31
title = 'bob dunsires piping photo for saturday'

distance = 450
spam score = 25
title = 'bob dunsires piping photo for friday'

distance = 450
spam score = 22
title = 'bob dunsires piping photo of the day'

distance = 452
spam score = 37
title = 'bob dunsires piping photo for saturday'

distance = 452
spam score = 25
title = 'bob dunsires piping photo of the day'

distance = 453
spam score = 26
title = 'bob dunsires piping photo for wednesday'

distance = 453
spam score = 27
title = 'bob dunsires piping photo of the day'

distance = 470
spam score = 34
title = 'bob dunsires piping photo for friday'

distance = 470
spam score = 23
title = 'bob dunsires piping photo for thursday'

distance = 471
spam score = 32
title = 'bob dunsires piping photo for sunday'

distance = 475
spam score = 25
title = 'bob dunsires piping photo for monday'

distance = 477
spam score = 23
title = 'bob dunsires piping photo for friday'

distance = 485
spam score = 22
title = 'bob dunsires piping photo for friday'

distance = 485
spam score = 29
title = 'bob dunsires piping photo for tuesday'

distance = 486
spam score = 31
title = 'bob dunsires piping photo for tuesday'

distance = 487
spam score = 21
title = 'bob dunsires piping photo for wednesday'

distance = 487
spam score = 23
title = 'bob dunsires piping photo of the day'

distance = 505
spam score = 28
title = 'bob dunsires piping photo for tuesday'

distance = 505
spam score = 27
title = 'bob dunsires piping photo of the day'

distance = 505
spam score = 26
title = 'bob dunsires piping photo for monday'

distance = 507
spam score = 24
title = 'bob dunsires piping photo of the day'

distance = 509
spam score = 23
title = 'bob dunsires piping photo of the day'

distance = 509
spam score = 24
title = 'bob dunsires piping photo of the day'

distance = 511
spam score = 27
title = 'bob dunsires piping photo for saturday'

distance = 512
spam score = 25
title = 'bob dunsires piping photo of the day'

distance = 516
spam score = 26
title = 'bob dunsires piping photo for sunday'

distance = 516
spam score = 21
title = 'bob dunsires piping photo for sunday'

distance = 543
spam score = 21
title = 'bob dunsires piping photo for saturday'

distance = 545
spam score = 20
title = 'bob dunsires piping photo for tuesday'

distance = 546
spam score = 27
title = 'bob dunsires piping photo of the day'

distance = 547
spam score = 21
title = 'bob dunsires piping photo for tuesday'

distance = 550
spam score = 27
title = 'bob dunsires piping photo for monday'

distance = 554
spam score = 29
title = 'bob dunsires piping photo for monday'

distance = 559
spam score = 25
title = 'bob dunsires piping photo for thursday'

distance = 560
spam score = 24
title = 'bob dunsires piping photo of the day'

distance = 562
spam score = 28
title = 'bob dunsires piping photo for wednesday'

distance = 566
spam score = 22
title = 'bob dunsires piping photo of the day'

distance = 597
spam score = 21
title = 'bob dunsires piping photo for wednesday'

distance = 599
spam score = 22
title = 'bob dunsires piping photo of the day'

distance = 604
spam score = 25
title = 'bob dunsires piping photo for monday'

distance = 607
spam score = 29
title = 'bob dunsires piping photo of the day'

distance = 611
spam score = 22
title = 'bob dunsires piping photo of the day'

distance = 612
spam score = 25
title = 'bob dunsires piping photo for wednesday'

distance = 620
spam score = 28
title = 'bob dunsires piping photo for saturday'

distance = 622
spam score = 27
title = 'bob dunsires piping photo for monday'

distance = 625
spam score = 18
title = 'bob dunsires piping photo for friday'

distance = 628
spam score = 22
title = 'bob dunsires piping photo of the day'

distance = 690
spam score = 19
title = 'bob dunsires piping photo of the day'

distance = 694
spam score = 24
title = 'bob dunsires piping photo for wednesday'

distance = 696
spam score = 22
title = 'bob dunsires piping photo for thursday'

distance = 702
spam score = 31
title = 'bob dunsires piping photo for tuesday'

distance = 708
spam score = 29
title = 'bob dunsires piping photo for sunday'

distance = 729
spam score = 23
title = 'bob dunsires piping photo of the day'

distance = 730
spam score = 33
title = 'bob dunsires piping photo for sunday'

distance = 740
spam score = 32
title = 'bob dunsires piping photo of the day'

distance = 742
spam score = 24
title = 'bob dunsires piping photo of the day'

distance = 747
spam score = 26
title = 'bob dunsires piping photo for sunday'

distance = 1852
spam score = 73
title = 'greyshanked douc pygathrix cinerea'

distance = 324
spam score = 56
title = 'qcad application framework scriptshelpaboutaboutjs file reference'

distance = 342
spam score = 53
title = 'qcad application framework srcguirlockedfilecpp file reference'

distance = 347
spam score = 53
title = 'qcad application framework srccorerfileexportercpp file reference'

distance = 349
spam score = 58
title = 'qcad application framework srccorercolorcodesh file reference'

distance = 352
spam score = 54
title = 'qcad application framework srcentityrsoliddatacpp file reference'

distance = 355
spam score = 52
title = 'qcad application framework srcsnaprsnapdistancecpp file reference'

distance = 355
spam score = 54
title = 'qcad application framework srcsnaprsnapcentercpp file reference'

distance = 357
spam score = 54
title = 'qcad application framework scriptssnapsnapjs file reference'

distance = 360
spam score = 54
title = 'qcad application framework srcsnaprsnapmiddlecpp file reference'

distance = 363
spam score = 55
title = 'qcad application framework srcentityrdimordinateentitycpp file reference'

distance = 365
spam score = 54
title = 'qcad application framework scriptsmapjs file reference'

distance = 367
spam score = 55
title = 'qcad application framework scriptstoolstoolsjs file reference'

distance = 368
spam score = 53
title = 'qcad application framework srcsnaprsnapendcpp file reference'

distance = 370
spam score = 55
title = 'qcad application framework srccorerfileimportercpp file reference'

distance = 370
spam score = 54
title = 'qcad application framework srcentityrdimordinatedatacpp file reference'

distance = 371
spam score = 54
title = 'qcad application framework srcsnaprsnaponentitycpp file reference'

distance = 372
spam score = 55
title = 'qcad application framework srccorerselectionlisteneradaptercpp file reference'

distance = 372
spam score = 54
title = 'qcad application framework srcentityrleaderdatacpp file reference'

distance = 373
spam score = 54
title = 'qcad application framework srccorersingletoncpp file reference'

distance = 373
spam score = 53
title = 'qcad application framework srccorerobjectcpp file reference'

distance = 391
spam score = 55
title = 'qcad application framework scriptsdrawdrawjs file reference'

distance = 391
spam score = 53
title = 'qcad application framework srcentityrdimdiametricentitycpp file reference'

distance = 391
spam score = 55
title = 'qcad application framework srcsnaprsnapfreecpp file reference'

distance = 393
spam score = 54
title = 'qcad application framework srcentityrarcdatacpp file reference'

distance = 393
spam score = 53
title = 'qcad application framework scriptsfilesvgexportsvgexportjs file reference'

distance = 395
spam score = 52
title = 'qcad application framework srcentityrsolidentitycpp file reference'

distance = 395
spam score = 52
title = 'qcad application framework srccorerlinetypepatterncpp file reference'

distance = 395
spam score = 53
title = 'qcad application framework scriptsfilesvgexportassvgexportasjs file reference'

distance = 396
spam score = 53
title = 'qcad application framework scriptsfilesvgimportsvgimportjs file reference'

distance = 397
spam score = 53
title = 'qcad application framework scriptsmodifyalignalignjs file reference'

distance = 401
spam score = 54
title = 'qcad application framework scriptsmodifytobacktobackjs file reference'

distance = 402
spam score = 53
title = 'qcad application framework scriptsmodifystretchstretchjs file reference'

distance = 406
spam score = 54
title = 'qcad application framework scriptsdiffjs file reference'

distance = 409
spam score = 57
title = 'qcad application framework scriptsconnectionjs file reference'

distance = 413
spam score = 53
title = 'qcad application framework scriptsmodifybreakoutbreakoutjs file reference'

distance = 414
spam score = 56
title = 'qcad application framework scriptseditabstractpreferencesjs file reference'

distance = 416
spam score = 59
title = 'qcad application framework scriptsdrawarcarc3parc3pjs file reference'

distance = 416
spam score = 55
title = 'qcad application framework scriptspreferencesshortcutsshortcutsjs file reference'

distance = 418
spam score = 54
title = 'qcad application framework scriptsviewzoomoutzoomoutjs file reference'

distance = 423
spam score = 51
title = 'qcad application framework scriptseditcutwithreferencecutwithreferencejs file reference'

distance = 434
spam score = 54
title = 'qcad application framework scriptswindowcloseallclosealljs file reference'

distance = 434
spam score = 56
title = 'qcad application framework scriptseditcutcutjs file reference'

distance = 437
spam score = 54
title = 'qcad application framework scriptssnapsnapreferencesnapreferencejs file reference'

distance = 437
spam score = 56
title = 'qcad application framework scriptsmodifyscalescalejs file reference'

distance = 439
spam score = 53
title = 'qcad application framework scriptssnapsnapautosnapautojs file reference'

distance = 440
spam score = 57
title = 'qcad application framework scriptsdrawarcarcjs file reference'

distance = 440
spam score = 52
title = 'qcad application framework srciodwgrdwgexporterfactorycpp file reference'

distance = 441
spam score = 61
title = 'qcad application framework srciodwgstdafxh file reference'

distance = 441
spam score = 53
title = 'qcad application framework scriptsselectselectlayerselectlayerjs file reference'

distance = 443
spam score = 54
title = 'qcad application framework scriptssnapsnapgridsnapgridjs file reference'

distance = 447
spam score = 52
title = 'qcad application framework scriptsmodifyrotate2rotate2js file reference'

distance = 447
spam score = 59
title = 'qcad application framework srcsnaprsnaponentityh file reference'

distance = 447
spam score = 56
title = 'qcad application framework scriptsblockcreateblockcreateblockjs file reference'

distance = 448
spam score = 52
title = 'qcad application framework scriptsmodifyzerolengthdetectionzerolengthdetectionjs file reference'

distance = 450
spam score = 55
title = 'qcad application framework scriptswindowfullscreenfullscreenjs file reference'

distance = 450
spam score = 54
title = 'qcad application framework scriptsmodifysplitintoequalpartssplitintoequalpartsjs file reference'

distance = 450
spam score = 53
title = 'qcad application framework srcpluginsqtrmathlineeditplugincpp file reference'

distance = 450
spam score = 54
title = 'qcad application framework scriptssnapsnaponentitysnaponentityjs file reference'

distance = 451
spam score = 54
title = 'qcad application framework scriptsviewaddviewaddviewjs file reference'

distance = 451
spam score = 62
title = 'qcad application framework srccorerfocuslistenerh file reference'

distance = 460
spam score = 52
title = 'qcad application framework scriptsmodifyexplodetextexplodetextjs file reference'

distance = 461
spam score = 56
title = 'qcad application framework scriptsnavigationdefaultnavigationdefaultnavigationjs file reference'

distance = 462
spam score = 53
title = 'qcad application framework scriptsdrawhatchhatchjs file reference'

distance = 464
spam score = 54
title = 'qcad application framework scriptsblockshowallblocksshowallblocksjs file reference'

distance = 466
spam score = 52
title = 'qcad application framework scriptsviewautozoomautozoomjs file reference'

distance = 466
spam score = 56
title = 'qcad application framework scriptsmodifydividedividejs file reference'

distance = 466
spam score = 55
title = 'qcad application framework scriptssnapsnapperpendicularsnapperpendicularjs file reference'

distance = 467
spam score = 55
title = 'qcad application framework scriptswidgetsselectiondisplayselectiondisplayjs file reference'

distance = 467
spam score = 51
title = 'qcad application framework srcentityrsplineentitycpp file reference'

distance = 468
spam score = 54
title = 'qcad application framework scriptsmodifytrimbothtrimbothjs file reference'

distance = 472
spam score = 53
title = 'qcad application framework srcpluginsqtrtexteditplugincpp file reference'

distance = 473
spam score = 62
title = 'qcad application framework srccorermousecoordinatelistenerh file reference'

distance = 474
spam score = 52
title = 'qcad application framework scriptsfileprintpreviewpagegraphicsitemjs file reference'

distance = 475
spam score = 52
title = 'qcad application framework scriptsviewpanzoompanzoomjs file reference'

distance = 476
spam score = 54
title = 'qcad application framework scriptsblockeditmaindrawingeditmaindrawingjs file reference'

distance = 479
spam score = 54
title = 'qcad application framework scriptstoolslibrarybrowserrdfjs file reference'

distance = 479
spam score = 55
title = 'qcad application framework scriptsdrawarcarcconcentricthrougharcconcentricthroughjs file reference'

distance = 482
spam score = 55
title = 'qcad application framework scriptstoolslibrarybrowsertagbrowserjs file reference'

distance = 487
spam score = 54
title = 'qcad application framework srcpluginsqtrmdichildqtplugincpp file reference'

distance = 488
spam score = 59
title = 'qcad application framework srcpluginsqtrmdichildqtpluginh file reference'

distance = 508
spam score = 55
title = 'qcad application framework scriptseditredoredojs file reference'

distance = 508
spam score = 54
title = 'qcad application framework scriptsmodifytranslaterotatetranslaterotatejs file reference'

distance = 514
spam score = 54
title = 'qcad application framework scriptstoolslibrarybrowsereditmetadataeditmetadatajs file reference'

distance = 515
spam score = 56
title = 'qcad application framework scriptsmodifytrimtrimjs file reference'

distance = 518
spam score = 54
title = 'qcad application framework scriptstoolslibrarybrowserdbitemjs file reference'

distance = 524
spam score = 59
title = 'qcad application framework scriptsdrawpointpointnppointnpjs file reference'

distance = 539
spam score = 55
title = 'qcad application framework scriptstoolslibrarybrowserlistvieweventhandlerjs file reference'

distance = 544
spam score = 54
title = 'qcad application framework scriptstoolslibrarybrowserfiltersdatetimefilterjs file reference'

distance = 547
spam score = 57
title = 'qcad application framework scriptsmodifymodifycornerjs file reference'

distance = 554
spam score = 57
title = 'qcad application framework overviews'

distance = 749
spam score = 58
title = 'qcad application framework block tools'

distance = 750
spam score = 59
title = 'qcad application framework example scripts'

distance = 768
spam score = 62
title = 'qcad application framework help tools'

distance = 816
spam score = 58
title = 'qcad application framework measuring information tools'

distance = 839
spam score = 56
title = 'qcad application framework gui module'

distance = 990
spam score = 47
title = 'awesomium file list'

distance = 1083
spam score = 47
title = 'awesomium data structures'

distance = 1089
spam score = 52
title = 'cplm localstubsc file reference'

distance = 1089
spam score = 52
title = 'cplm localstubsc file reference'

distance = 1091
spam score = 55
title = 'awesomium file list'

distance = 137
spam score = 63
title = ''

distance = 141
spam score = 54
title = '1000287'

distance = 141
spam score = 54
title = '1000296'

distance = 141
spam score = 54
title = '1000289'

distance = 141
spam score = 54
title = '1000292'

distance = 141
spam score = 55
title = '1000267'

distance = 143
spam score = 61
title = 'p1010078'

distance = 143
spam score = 63
title = 'p1010048'

distance = 143
spam score = 64
title = 'p1010030'

distance = 143
spam score = 59
title = 'p1010069'

distance = 143
spam score = 59
title = 'p1010061'

distance = 143
spam score = 60
title = 'p1010047'

distance = 143
spam score = 63
title = 'p1010036'

distance = 143
spam score = 62
title = 'p1010016'

distance = 143
spam score = 62
title = 'p1010013'

distance = 143
spam score = 63
title = 'p1010028'

distance = 143
spam score = 63
title = 'p1010032'

distance = 143
spam score = 62
title = 'p1010019'

distance = 143
spam score = 61
title = 'p1010014'

distance = 143
spam score = 63
title = 'p1010012'

distance = 276
spam score = 61
title = ''

distance = 276
spam score = 54
title = ''

distance = 277
spam score = 54
title = ''

distance = 277
spam score = 58
title = ''

distance = 278
spam score = 55
title = ''

distance = 278
spam score = 55
title = ''

distance = 279
spam score = 57
title = ''

distance = 279
spam score = 62
title = 'dsc0149'

distance = 279
spam score = 54
title = ''

distance = 280
spam score = 56
title = ''

distance = 325
spam score = 54
title = ''

distance = 325
spam score = 66
title = 'img8604'

distance = 326
spam score = 58
title = 'img0850'

distance = 326
spam score = 59
title = '1000361jpg'

distance = 326
spam score = 59
title = '1000362jpg'

distance = 326
spam score = 57
title = 'img0846'

distance = 326
spam score = 60
title = '1000358jpg'

distance = 326
spam score = 60
title = '1000360jpg'

distance = 326
spam score = 61
title = '1000359jpg'

distance = 326
spam score = 60
title = '1000368jpg'

distance = 400
spam score = 60
title = 'dscn1090jpg'

distance = 400
spam score = 59
title = 'dscn1102jpg'

distance = 400
spam score = 59
title = 'dscn0589jpg'

distance = 400
spam score = 59
title = 'dscn1100jpg'

distance = 400
spam score = 60
title = 'dscn0907jpg'

distance = 400
spam score = 55
title = 'arfconfla06ws197'

distance = 400
spam score = 60
title = 'dscn0601jpg'

distance = 400
spam score = 58
title = 'dscn0620jpg'

distance = 400
spam score = 59
title = 'dscn0621jpg'

distance = 400
spam score = 59
title = 'dscn0908jpg'

distance = 411
spam score = 63
title = 'the line forms'

distance = 411
spam score = 60
title = 'image18jpg'

distance = 411
spam score = 60
title = 'a mysterious luchador'

distance = 411
spam score = 61
title = 'image04jpg'

distance = 411
spam score = 62
title = 'image02jpg'

distance = 411
spam score = 63
title = 'image01jpg'

distance = 411
spam score = 63
title = 'image24jpg'

distance = 411
spam score = 59
title = 'image19jpg'

distance = 412
spam score = 60
title = 'img3903jpg'

distance = 412
spam score = 59
title = 'pdr0009jpg'

distance = 447
spam score = 56
title = 'wid 08 137'

distance = 447
spam score = 55
title = 'wid 08 114'

distance = 447
spam score = 56
title = 'wid 08 021'

distance = 447
spam score = 55
title = 'wid 08 060'

distance = 447
spam score = 57
title = 'wid 08 001'

distance = 447
spam score = 55
title = 'wid 08 023'

distance = 447
spam score = 55
title = 'wid 08 109'

distance = 447
spam score = 56
title = 'wid 08 110'

distance = 447
spam score = 55
title = 'wid 08 094'

distance = 447
spam score = 56
title = 'wid 08 133'

distance = 537
spam score = 24
title = 'france photo album lynn johannajpg'

distance = 537
spam score = 59
title = 'italy landscape'

distance = 537
spam score = 62
title = 'free gifts for jetpack supporters'

distance = 538
spam score = 62
title = 'top view of the space ranger'

distance = 539
spam score = 41
title = 'global castor conference 2011'

distance = 539
spam score = 61
title = 'farmers market 21 may 2009'

distance = 539
spam score = 52
title = 'chicken islands in halong bay'

distance = 540
spam score = 62
title = ''

distance = 540
spam score = 63
title = 'merrill heading out to merimax'

distance = 540
spam score = 60
title = ''

distance = 674
spam score = 58
title = 'f1000016'

distance = 674
spam score = 60
title = 'f1000020'

distance = 674
spam score = 61
title = 'f1000021'

distance = 674
spam score = 60
title = 'f1000019'

distance = 674
spam score = 60
title = 'f1000004'

distance = 674
spam score = 61
title = 'f1000001'

distance = 674
spam score = 59
title = 'f1000018'

distance = 674
spam score = 61
title = 'f1000013'

distance = 674
spam score = 60
title = 'f1000015'

distance = 674
spam score = 60
title = 'f1000005'

distance = 850
spam score = 56
title = '12th annual suncoast chapter regional'

distance = 850
spam score = 59
title = 'wooden drascombe longboat cruiser lucy locket'

distance = 850
spam score = 57
title = 'bonsai tree'

distance = 851
spam score = 51
title = 'photo gallery'

distance = 852
spam score = 41
title = 'gettysburg photo album'

distance = 852
spam score = 60
title = 'gujarat groundnut crop survey 2011 8th to 10th oct 2011'

distance = 852
spam score = 61
title = 'les diplmes'

distance = 852
spam score = 30
title = 'untitled web journal img2945'

distance = 852
spam score = 62
title = 'mon petit doigt me dit que'

distance = 853
spam score = 56
title = 'photo gallery'

distance = 1735
spam score = 62
title = 'zanzer tem'

distance = 1748
spam score = 18
title = 'musiksternde stichwort payback'

distance = 1755
spam score = 49
title = 'maurice andre trumpet competition'

distance = 1808
spam score = 43
title = 'jr'

distance = 1816
spam score = 42
title = 'jr blythe'

distance = 319
spam score = 20
title = 'majestic athletic new york mets authentic home jersey majestic athletic authentic product'

distance = 320
spam score = 20
title = 'majestic athletic oakland athletics customized authentic home jersey majestic athletic authentic product'

distance = 322
spam score = 20
title = 'majestic athletic oakland athletics customized authentic road jersey majestic athletic authentic product'

distance = 323
spam score = 18
title = 'majestic athletic new york mets 2004 authentic collection tshirt majestic athletic authentic product'

distance = 326
spam score = 17
title = 'majestic athletic oakland athletics 2004 authentic collection tshirt majestic athletic authentic product'

distance = 327
spam score = 18
title = 'majestic athletic new york mets authentic road jersey majestic athletic authentic product'

distance = 327
spam score = 19
title = 'majestic athletic houston astros customized authentic home jersey majestic athletic authentic product'

distance = 330
spam score = 17
title = 'majestic athletic oakland athletics authentic home jersey majestic athletic authentic product'

distance = 330
spam score = 17
title = 'majestic athletic new york yankees 2004 authentic collection tshirt majestic athletic authentic product'

distance = 331
spam score = 19
title = 'majestic athletic houston astros 2004 authentic collection tshirt majestic athletic authentic product'

distance = 333
spam score = 15
title = 'majestic athletic seattle mariners 2004 authentic collection tshirt majestic athletic authentic product'

distance = 334
spam score = 19
title = 'majestic athletic minnesota twins 2004 authentic collection tshirt majestic athletic authentic product'

distance = 335
spam score = 18
title = 'majestic athletic oakland athletics authentic alternate jersey majestic athletic authentic product'

distance = 336
spam score = 20
title = 'majestic athletic houston astros customized authentic alternate jersey majestic athletic authentic product'

distance = 336
spam score = 18
title = 'texas rangers authentic home jersey majestic athletic authentic product'

distance = 338
spam score = 19
title = 'majestic athletic pittsburgh pirates 2004 authentic collection tshirt majestic athletic authentic product'

distance = 338
spam score = 18
title = 'majestic athletic chicago cubs customized authentic home jersey majestic athletic authentic product'

distance = 342
spam score = 18
title = 'majestic athletic houston astros authentic road jersey majestic athletic authentic product'

distance = 343
spam score = 17
title = 'majestic athletic new york mets authentic alternate road jersey majestic athletic authentic product'

distance = 344
spam score = 18
title = 'anaheim angels authentic home jersey majestic athletic authentic product'

distance = 455
spam score = 18
title = 'majestic athletic houston astros jeff bagwell batting practice jersey majestic athletic authentic product'

distance = 456
spam score = 16
title = 'majestic athletic washington capitals youth buttonfront jerseys majestic athletic authentic product'

distance = 456
spam score = 19
title = 'authentic street signs chicago cubs neon sign authentic street signs authentic product'

distance = 456
spam score = 13
title = 'majestic athletic phillies mike schimdt home cooperstown replica jersey majestic athletic authentic product'

distance = 457
spam score = 16
title = 'majestic athletic anaheim angels 2004 authentic collection premiere jacket majestic athletic authentic product'

distance = 457
spam score = 19
title = 'majestic athletic st louis cardinals scott rolen replica home jersey majestic athletic authentic product'

distance = 457
spam score = 18
title = 'philadelphia phillies 1275 round clock mlb sporty k9 authentic product'

distance = 457
spam score = 18
title = 'gfg chicago cubs wood baseball gfg authentic product'

distance = 457
spam score = 18
title = 'authentic street signs new york yankees paul oneill street sign authentic street signs authentic product'

distance = 457
spam score = 17
title = 'majestic athletic los angeles dodgers authentic batting practice jersey majestic athletic authentic product'

distance = 495
spam score = 18
title = 'majestic athletic philadelphia phillies 2004 authentic collection tshirt majestic athletic authentic product'

distance = 495
spam score = 19
title = 'majestic athletic san francisco giants womens replica jersey majestic athletic authentic product'

distance = 495
spam score = 17
title = 'majestic athletic chicago blackhawks youth buttonfront jersey majestic athletic authentic product'

distance = 495
spam score = 16
title = 'majestic athletic anaheim angels authentic collection womens tank majestic athletic authentic product'

distance = 495
spam score = 18
title = 'anaheim angels authentic road jersey majestic athletic authentic product'

distance = 495
spam score = 17
title = 'majestic athletic tampa bay devil rays buttonfront jersey majestic athletic authentic product'

distance = 495
spam score = 17
title = 'majestic athletic montreal canadiens youth buttonfront jersey majestic athletic authentic product'

distance = 496
spam score = 13
title = 'sporty k9 kansas city royals 2002 yearbook mlb sporty k9 authentic product'

distance = 496
spam score = 15
title = 'steiner philadelphia phillies greats dynasty collage steiner authentic product'

distance = 496
spam score = 16
title = 'majestic athletic minnesota twins home replica jersey majestic athletic authentic product'

distance = 520
spam score = 15
title = 'steiner new york yankees babe ruth 60th home run framed 16 x 20 picture steiner authentic product'

distance = 520
spam score = 18
title = 'majestic athletic chicago cubs home replica jersey majestic athletic authentic product'

distance = 520
spam score = 17
title = 'majestic athletic chicago white sox authentic home jersey majestic athletic authentic product'

distance = 521
spam score = 14
title = 'steiner bobby thompson nlcs home run framed 16 x 20 picture steiner authentic product'

distance = 521
spam score = 18
title = 'gfg new york mets wood baseball gfg authentic product'

distance = 521
spam score = 16
title = 'upper deck new york yankees jason giambi 2003 bobble head sports images authentic product'

distance = 521
spam score = 15
title = 'majestic athletic texas rangers customized replica home jersey majestic athletic authentic product'

distance = 521
spam score = 15
title = 'new york yankees howler miniature car fleer authentic product'

distance = 521
spam score = 20
title = 'majestic athletic arizona diamondbacks womens replica jersey majestic athletic authentic product'

distance = 521
spam score = 17
title = 'pez san diego padres giant pez dispenser sports images authentic product'

distance = 550
spam score = 16
title = 'toon art chicago cubs mark prior limited edition toon collectible toon art authentic product'

distance = 550
spam score = 17
title = 'gfg philadelphia phillies wood baseball gfg authentic product'

distance = 550
spam score = 17
title = 'majestic athletic colorado rockies youth custom tshirt majestic athletic authentic product'

distance = 550
spam score = 14
title = 'milwaukee brewers sport duffle bag mlb haddad accessories authentic product'

distance = 550
spam score = 16
title = 'majestic athletic detroit tigers youth custom tshirt majestic athletic authentic product'

distance = 551
spam score = 18
title = 'upper deck cincinnati reds ken griffey jr 2003 piece of the action sports images authentic product'

distance = 551
spam score = 17
title = 'antigua pittsburgh pirates mens classic polo antigua authentic product'

distance = 551
spam score = 20
title = 'sportfx ny yankees mini jersey 2 packs sports images authentic product'

distance = 551
spam score = 17
title = 'majestic athletic texas rangers youth replica home jersey majestic athletic authentic product'

distance = 552
spam score = 16
title = 'schutt minnesota twins official mlb fullsize base schutt authentic product'

distance = 578
spam score = 17
title = 'toon art cleveland indians bob feller limited edition toon collectible toon art authentic product'

distance = 578
spam score = 19
title = 'authentic street signs philadelphia phillies jim thome street sign authentic street signs authentic product'

distance = 578
spam score = 15
title = 'upper deck cincinnati reds ken griffey jr 2003 bobble head sports images authentic product'

distance = 578
spam score = 15
title = 'fotoball new york yankees glow in the dark baseball mlb football usa authentic product'

distance = 578
spam score = 17
title = 'toon art pittsburgh pirates roberto clemente limited edition toon collectible toon art authentic product'

distance = 579
spam score = 18
title = 'winning streak minnesota twins pennant winning streak sports authentic product'

distance = 579
spam score = 17
title = 'mcarthur sports new york yankees action mascot punching puppet mcarthur sports authentic product'

distance = 579
spam score = 18
title = 'majestic athletic montreal expos authentic batting practice jersey majestic athletic authentic product'

distance = 579
spam score = 15
title = 'toon art seattle mariners ichiro suzuki limited edition toon collectible toon art authentic product'

distance = 579
spam score = 13
title = 'coopersburg sports new york mets mo vaughn 34 player bat cooperburg sports authentic product'

distance = 604
spam score = 16
title = 'toon art los angeles dodgers kazuhisa ishii limited edition toon collectible toon art authentic product'

distance = 604
spam score = 17
title = 'gridworks kansas city royals engraved wood baseball gridworks inc authentic product'

distance = 604
spam score = 13
title = 'texas rangers sport duffle bag mlb haddad accessories authentic product'

distance = 604
spam score = 15
title = 'nfl red label buffalo bills customized buttonfront jersey majestic athletic authentic product'

distance = 604
spam score = 14
title = 'highland mint san francisco giants barry bonds bronze medallion photo mint highland mint authentic product'

distance = 604
spam score = 13
title = 'coopersburg sports new york yankees hideki matsui player bat cooperburg sports authentic product'

distance = 604
spam score = 17
title = 'winning streak sports detroit tigers team pennant winning streak sports authentic product'

distance = 604
spam score = 12
title = 'coopersburg sports anaheim angels troy glaus 34 player bat cooperburg sports authentic product'

distance = 604
spam score = 15
title = 'usaopoly seattle mariners monopoly board game usaolopy authentic product'

distance = 604
spam score = 15
title = 'majestic athletic dallas stars tackle twill sweatshirt majestic athletic authentic product'

distance = 632
spam score = 14
title = 'majestic athletic chicago white sox authentic collection womens tshirt majestic athletic authentic product'

distance = 633
spam score = 19
title = 'majestic athletic atlanta braves youth 2004 authentic premiere jacket majestic athletic authentic product'

distance = 633
spam score = 15
title = 'usaopoly boston red sox monopoly board game usaolopy authentic product'

distance = 634
spam score = 14
title = 'coopersburg sports los angeles dodgers stackable stars nesting dolls cooperburg sports authentic product'

distance = 634
spam score = 14
title = 'coopersburg sports baltimore orioles cal ripken jr 34 player bat cooperburg sports authentic product'

distance = 634
spam score = 15
title = 'majestic athletic calgary flames tackle twill sweatshirt majestic athletic authentic product'

distance = 634
spam score = 21
title = 'majestic athletic chicago cubs sammy sosa youth replica home jersey majestic athletic authentic product'

distance = 634
spam score = 16
title = 'majestic athletic cincinnati reds youth tackle twill replica home jersey majestic athletic authentic product'

distance = 634
spam score = 20
title = 'majestic athletic new york yankees hideki matsui youth replica home jersey majestic athletic authentic product'

distance = 635
spam score = 16
title = 'toon art seattle mariners limited edition lithograph featuring betty boop toon art authentic product'

distance = 685
spam score = 18
title = 'antigua tampa bay devil rays grandstand fleece pullover antigua authentic product'

distance = 687
spam score = 13
title = 'coopersburg sports boston red sox trot nixon 34 player bat cooperburg sports authentic product'

distance = 687
spam score = 15
title = 'majestic athletic detroit tigers customized youth replica home jersey majestic athletic authentic product'

distance = 688
spam score = 16
title = 'toon art florida marlins limited edition lithograph featuring betty boop toon art authentic product'

distance = 688
spam score = 13
title = 'antigua new york mets windward jacket antigua authentic product'

distance = 688
spam score = 14
title = 'antigua st louis blues goalie hooded sweatshirt antigua authentic product'

distance = 688
spam score = 17
title = 'toon art new york mets limited edition lithograph featuring betty boop toon art authentic product'

distance = 689
spam score = 20
title = 'nfl red label cincinnatti bengals customized longsleeve tee majestic athletic authentic product'

distance = 690
spam score = 19
title = 'majestic athletics boston bruins customized longsleeve tshirt majestic athletic authentic product'

distance = 690
spam score = 18
title = 'antigua ottawa senators womens dash tank top antigua authentic product'

distance = 1076
spam score = 17
title = 'toronto blue jays golf club headcovers mlb coopersburg associates authentic product'

distance = 1157
spam score = 17
title = 'highland mint chicago cubs sammy sosa silver medallion photo mint highland mint authentic product'

distance = 1221
spam score = 13
title = 'sporty k9 los angeles dodgers satin dog jacket mlb sporty k9 authentic product'

distance = 1870
spam score = 10
title = 'surname finder phenicie to phifling'

distance = 269
spam score = 68
title = 'mesquite boogie 2008'

distance = 269
spam score = 68
title = 'mesquite boogie 2008'

distance = 269
spam score = 68
title = 'mesquite boogie 2008'

distance = 269
spam score = 68
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 68
title = 'mesquite boogie 2008'

distance = 269
spam score = 68
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 69
title = 'mesquite boogie 2008'

distance = 269
spam score = 68
title = 'mesquite boogie 2008'

distance = 481
spam score = 62
title = 'world record photos'

distance = 481
spam score = 62
title = 'world record photos'

distance = 481
spam score = 63
title = 'world record photos'

distance = 481
spam score = 63
title = 'world record photos'

distance = 481
spam score = 62
title = 'world record photos'

distance = 481
spam score = 63
title = 'world record photos'

distance = 481
spam score = 64
title = 'world record photos'

distance = 481
spam score = 64
title = 'world record photos'

distance = 481
spam score = 62
title = 'world record photos'

distance = 481
spam score = 62
title = 'world record photos'

distance = 481
spam score = 62
title = 'world record photos'

distance = 481
spam score = 63
title = 'world record photos'

distance = 481
spam score = 62
title = 'world record photos'

distance = 501
spam score = 62
title = 'dropzonecom boogie'

distance = 501
spam score = 60
title = 'dropzonecom boogie'

distance = 517
spam score = 62
title = 'dropzonecom boogie'

distance = 517
spam score = 61
title = 'dropzonecom boogie'

distance = 517
spam score = 62
title = 'dropzonecom boogie'

distance = 517
spam score = 62
title = 'dropzonecom boogie'

distance = 517
spam score = 62
title = 'dropzonecom boogie'

distance = 517
spam score = 61
title = 'dropzonecom boogie'

distance = 517
spam score = 62
title = 'dropzonecom boogie'

distance = 517
spam score = 61
title = 'dropzonecom boogie'

distance = 517
spam score = 62
title = 'dropzonecom boogie'

distance = 517
spam score = 61
title = 'dropzonecom boogie'

distance = 517
spam score = 63
title = 'dropzonecom boogie'

distance = 517
spam score = 62
title = 'dropzonecom boogie'

distance = 517
spam score = 62
title = 'dropzonecom boogie'

distance = 517
spam score = 63
title = 'dropzonecom boogie'

distance = 517
spam score = 62
title = 'dropzonecom boogie'

distance = 529
spam score = 65
title = 'mesquite boogie 2008'

distance = 533
spam score = 62
title = 'dropzonecom boogie'

distance = 534
spam score = 62
title = 'dropzonecom boogie'

distance = 539
spam score = 61
title = 'mesquite 2008'

distance = 546
spam score = 30
title = 'mesquite 2008'

distance = 570
spam score = 62
title = 'mesquite 2008'

distance = 570
spam score = 62
title = 'mesquite 2008'

distance = 570
spam score = 62
title = 'mesquite 2008'

distance = 570
spam score = 62
title = 'mesquite 2008'

distance = 570
spam score = 62
title = 'mesquite 2008'

distance = 570
spam score = 61
title = 'mesquite 2008'

distance = 570
spam score = 60
title = 'mesquite 2008'

distance = 570
spam score = 60
title = 'mesquite 2008'

distance = 570
spam score = 62
title = 'mesquite 2008'

distance = 570
spam score = 62
title = 'mesquite 2008'

distance = 570
spam score = 61
title = 'mesquite 2008'

distance = 570
spam score = 61
title = 'mesquite 2008'

distance = 570
spam score = 61
title = 'mesquite 2008'

distance = 570
spam score = 62
title = 'mesquite 2008'

distance = 577
spam score = 62
title = 'dropzonecom boogie'

distance = 595
spam score = 53
title = 'valentines day boogie eloy arizona'

distance = 595
spam score = 52
title = 'valentines day boogie eloy arizona'

distance = 595
spam score = 53
title = 'valentines day boogie eloy arizona'

distance = 595
spam score = 53
title = 'valentines day boogie eloy arizona'

distance = 595
spam score = 52
title = 'valentines day boogie eloy arizona'

distance = 595
spam score = 52
title = 'valentines day boogie eloy arizona'

distance = 595
spam score = 52
title = 'valentines day boogie eloy arizona'

distance = 595
spam score = 53
title = 'valentines day boogie eloy arizona'

distance = 595
spam score = 51
title = 'valentines day boogie eloy arizona'

distance = 595
spam score = 51
title = 'valentines day boogie eloy arizona'

distance = 596
spam score = 62
title = 'tiffanis first skydive in mesquite'

distance = 596
spam score = 64
title = 'tiffanis first skydive in mesquite'

distance = 596
spam score = 63
title = 'tiffanis first skydive in mesquite'

distance = 596
spam score = 63
title = 'tiffanis first skydive in mesquite'

distance = 596
spam score = 62
title = 'tiffanis first skydive in mesquite'

distance = 596
spam score = 63
title = 'tiffanis first skydive in mesquite'

distance = 596
spam score = 63
title = 'tiffanis first skydive in mesquite'

distance = 596
spam score = 64
title = 'tiffanis first skydive in mesquite'

distance = 596
spam score = 64
title = 'tiffanis first skydive in mesquite'

distance = 618
spam score = 59
title = 'dropzonecom boogie'

distance = 631
spam score = 63
title = 'douglas spotted eagle'

distance = 631
spam score = 63
title = 'douglas spotted eagle'

distance = 631
spam score = 62
title = 'douglas spotted eagle'

distance = 631
spam score = 62
title = 'douglas spotted eagle'

distance = 631
spam score = 63
title = 'douglas spotted eagle'

distance = 671
spam score = 54
title = 'valentines day boogie eloy arizona'

distance = 671
spam score = 56
title = 'valentines day boogie eloy arizona'

distance = 671
spam score = 54
title = 'valentines day boogie eloy arizona'

distance = 671
spam score = 55
title = 'valentines day boogie eloy arizona'

distance = 678
spam score = 65
title = 'tiffanis first skydive in mesquite'

distance = 923
spam score = 60
title = 'santa clara basketball team photo day october 31 2011'

distance = 988
spam score = 53
title = 'santa clara basketball team photo day october 31 2011'

distance = 1759
spam score = 4
title = ''

distance = 152
spam score = 44
title = '120035htm'

distance = 152
spam score = 46
title = '1200416htm'

distance = 152
spam score = 48
title = '120059htm'

distance = 178
spam score = 44
title = '120028htm'

distance = 178
spam score = 45
title = '1200014htm'

distance = 178
spam score = 47
title = '1199630htm'

distance = 178
spam score = 43
title = '1200123htm'

distance = 182
spam score = 48
title = '1199923htm'

distance = 190
spam score = 49
title = '1200313htm'

distance = 190
spam score = 51
title = '1200514htm'

distance = 190
spam score = 51
title = '1200614htm'

distance = 200
spam score = 51
title = '1200530htm'

distance = 200
spam score = 50
title = '1200326htm'

distance = 200
spam score = 52
title = '1200622htm'

distance = 200
spam score = 52
title = '1200434htm'

distance = 206
spam score = 50
title = '1200618htm'

distance = 206
spam score = 51
title = '1199415htm'

distance = 206
spam score = 49
title = '1200431htm'

distance = 207
spam score = 46
title = '120043htm'

distance = 209
spam score = 52
title = '119945htm'

distance = 289
spam score = 51
title = '119936htm'

distance = 290
spam score = 50
title = '119972htm'

distance = 290
spam score = 47
title = '1199834htm'

distance = 291
spam score = 48
title = '1200814htm'

distance = 291
spam score = 48
title = '1199528htm'

distance = 291
spam score = 49
title = '1199717htm'

distance = 291
spam score = 46
title = '1200714htm'

distance = 292
spam score = 51
title = '1199715htm'

distance = 294
spam score = 53
title = '119991htm'

distance = 294
spam score = 52
title = '119964htm'

distance = 331
spam score = 51
title = '1200821htm'

distance = 331
spam score = 50
title = '1200923htm'

distance = 331
spam score = 51
title = '1199321htm'

distance = 331
spam score = 50
title = '1201023htm'

distance = 333
spam score = 51
title = '1198715htm'

distance = 334
spam score = 48
title = '1198727htm'

distance = 336
spam score = 45
title = '1199535htm'

distance = 339
spam score = 50
title = '120042htm'

distance = 342
spam score = 51
title = '119885htm'

distance = 344
spam score = 51
title = '1200623htm'

distance = 380
spam score = 50
title = '120007htm'

distance = 380
spam score = 50
title = '1200842htm'

distance = 380
spam score = 48
title = '1200028htm'

distance = 381
spam score = 48
title = '1199322htm'

distance = 381
spam score = 45
title = '1200815ahtm'

distance = 381
spam score = 51
title = '1200421htm'

distance = 382
spam score = 49
title = '1200840htm'

distance = 383
spam score = 51
title = '1201010htm'

distance = 384
spam score = 48
title = '1200027htm'

distance = 384
spam score = 48
title = '1200828htm'

distance = 414
spam score = 48
title = '1200912htm'

distance = 414
spam score = 52
title = '1198736htm'

distance = 415
spam score = 46
title = '1201015htm'

distance = 415
spam score = 50
title = '1200919htm'

distance = 415
spam score = 50
title = '120078htm'

distance = 415
spam score = 53
title = '1200624htm'

distance = 416
spam score = 49
title = '1200844htm'

distance = 417
spam score = 53
title = '1200515ahtm'

distance = 417
spam score = 47
title = '1200931htm'

distance = 420
spam score = 49
title = '1199832htm'

distance = 456
spam score = 49
title = '120039ahtm'

distance = 456
spam score = 50
title = '120057htm'

distance = 457
spam score = 48
title = '1200921ahtm'

distance = 457
spam score = 47
title = '1200739htm'

distance = 457
spam score = 52
title = '1200727htm'

distance = 459
spam score = 50
title = '1200122htm'

distance = 459
spam score = 48
title = '1200741htm'

distance = 460
spam score = 53
title = '1200941htm'

distance = 461
spam score = 46
title = '1201012htm'

distance = 463
spam score = 47
title = '119983htm'

distance = 524
spam score = 49
title = '119955htm'

distance = 525
spam score = 52
title = '1199720htm'

distance = 527
spam score = 52
title = '120113htm'

distance = 527
spam score = 50
title = '1199722htm'

distance = 527
spam score = 51
title = '1199831htm'

distance = 528
spam score = 51
title = '1199721htm'

distance = 528
spam score = 47
title = '1200915htm'

distance = 528
spam score = 50
title = '1199123htm'

distance = 530
spam score = 49
title = '1200833htm'

distance = 530
spam score = 48
title = '120083ahtm'

distance = 626
spam score = 56
title = '1199925htm'

distance = 629
spam score = 52
title = '1200134htm'

distance = 631
spam score = 52
title = '1200511htm'

distance = 633
spam score = 47
title = '1200736htm'

distance = 633
spam score = 48
title = '1200824htm'

distance = 634
spam score = 47
title = '1200033htm'

distance = 634
spam score = 51
title = '1199921htm'

distance = 642
spam score = 48
title = '1200038htm'

distance = 643
spam score = 57
title = '120064ahtm'

distance = 650
spam score = 49
title = '1200750htm'

distance = 925
spam score = 54
title = '405111htm'

distance = 926
spam score = 56
title = '4451019htm'

distance = 927
spam score = 51
title = '40510711htm'

distance = 933
spam score = 51
title = '4052511htm'

distance = 934
spam score = 50
title = '2302052htm'

distance = 935
spam score = 56
title = '601536htm'

distance = 938
spam score = 53
title = '405315htm'

distance = 938
spam score = 54
title = '405116htm'

distance = 945
spam score = 57
title = '601511htm'

distance = 947
spam score = 52
title = '24515214htm'

distance = 1770
spam score = 22
title = 'wwwcs3 tour dates'

distance = 1844
spam score = 54
title = 'gscvs rev 8991 trunkurwfonts'

distance = 227
spam score = 53
title = 'trinity university texas tx college scholarships find money for college financial aid for students and admission'

distance = 228
spam score = 54
title = 'university of texas system texas tx college scholarships find money for college financial aid for students and admission'

distance = 231
spam score = 55
title = 'university of north texas texas tx college scholarships find money for college financial aid for students and admission'

distance = 232
spam score = 54
title = 'university of texas austin texas tx college scholarships find money for college financial aid for students and admission'

distance = 233
spam score = 54
title = 'university of texas tyler texas tx college scholarships find money for college financial aid for students and admission'

distance = 235
spam score = 51
title = 'rice university texas tx college scholarships find money for college financial aid for students and admission'

distance = 237
spam score = 52
title = 'ambassador university texas tx college scholarships find money for college financial aid for students and admission'

distance = 237
spam score = 51
title = 'texas college texas tx college scholarships find money for college financial aid for students and admission'

distance = 238
spam score = 53
title = 'southwestern university texas tx college scholarships find money for college financial aid for students and admission'

distance = 239
spam score = 53
title = 'university of dallas texas tx college scholarships find money for college financial aid for students and admission'

distance = 241
spam score = 54
title = 'texas tech university texas tx college scholarships find money for college financial aid for students and admission'

distance = 241
spam score = 53
title = 'texas womans university texas tx college scholarships find money for college financial aid for students and admission'

distance = 241
spam score = 53
title = 'university of texas dallas texas tx college scholarships find money for college financial aid for students and admission'

distance = 243
spam score = 53
title = 'central texas college texas tx college scholarships find money for college financial aid for students and admission'

distance = 249
spam score = 53
title = 'letourneau university texas tx college scholarships find money for college financial aid for students and admission'

distance = 251
spam score = 54
title = 'university of texas brownsville texas tx college scholarships find money for college financial aid for students and admission'

distance = 252
spam score = 53
title = 'western texas college texas tx college scholarships find money for college financial aid for students and admission'

distance = 254
spam score = 54
title = 'amberton university texas tx college scholarships find money for college financial aid for students and admission'

distance = 256
spam score = 53
title = 'university of texas arlington texas tx college scholarships find money for college financial aid for students and admission'

distance = 256
spam score = 52
title = 'mcmurry university texas tx college scholarships find money for college financial aid for students and admission'

distance = 409
spam score = 53
title = 'fisk university tennessee tn college scholarships find money for college financial aid for students and admission'

distance = 410
spam score = 52
title = 'medaille college new york ny college scholarships find money for college financial aid for students and admission'

distance = 410
spam score = 52
title = 'mcintosh college new hampshire nh college scholarships find money for college financial aid for students and admission'

distance = 410
spam score = 52
title = 'rockhurst university missouri mo college scholarships find money for college financial aid for students and admission'

distance = 410
spam score = 52
title = 'boston college massachusetts ma college scholarships find money for college financial aid for students and admission'

distance = 410
spam score = 53
title = 'endicott college massachusetts ma college scholarships find money for college financial aid for students and admission'

distance = 410
spam score = 54
title = 'university of new mexico valencia new mexico nm college scholarships find money for college financial aid for students and admission'

distance = 410
spam score = 55
title = 'new england college new hampshire nh college scholarships find money for college financial aid for students and admission'

distance = 410
spam score = 51
title = 'william woods university missouri mo college scholarships find money for college financial aid for students and admission'

distance = 411
spam score = 54
title = 'art institute of dallas texas tx college scholarships find money for college financial aid for students and admission'

distance = 445
spam score = 51
title = 'illinois college illinois il college scholarships find money for college financial aid for students and admission'

distance = 445
spam score = 53
title = 'dallas county community college district texas tx college scholarships find money for college financial aid for students and admission'

distance = 446
spam score = 52
title = 'platt college missouri mo college scholarships find money for college financial aid for students and admission'

distance = 446
spam score = 54
title = 'union university tennessee tn college scholarships find money for college financial aid for students and admission'

distance = 446
spam score = 57
title = 'bristol community college massachusetts ma college scholarships find money for college financial aid for students and admission'

distance = 446
spam score = 54
title = 'george mason university virginia va college scholarships find money for college financial aid for students and admission'

distance = 446
spam score = 52
title = 'christendom college virginia va college scholarships find money for college financial aid for students and admission'

distance = 447
spam score = 53
title = 'campbellsville university kentucky ky college scholarships find money for college financial aid for students and admission'

distance = 447
spam score = 55
title = 'new mexico state university do a ana new mexico nm college scholarships find money for college financial aid for students and admission'

distance = 447
spam score = 57
title = 'claflin university amp college scholarships find money for college financial aid for students and admission'

distance = 465
spam score = 52
title = 'lamar state college port arthur texas tx college scholarships find money for college financial aid for students and admission'

distance = 465
spam score = 51
title = 'university of illinois chicago illinois il college scholarships find money for college financial aid for students and admission'

distance = 466
spam score = 54
title = 'erskine college amp college scholarships find money for college financial aid for students and admission'

distance = 466
spam score = 52
title = 'university of sarasota florida fl college scholarships find money for college financial aid for students and admission'

distance = 466
spam score = 51
title = 'stetson university florida fl college scholarships find money for college financial aid for students and admission'

distance = 466
spam score = 57
title = 'winthrop university amp college scholarships find money for college financial aid for students and admission'

distance = 466
spam score = 53
title = 'college at fredonia suny new york ny college scholarships find money for college financial aid for students and admission'

distance = 467
spam score = 56
title = 'university of alaska southeast alaska ak student loans amp college scholarships find money for college financial aid for students and admission'

distance = 467
spam score = 52
title = 'indiana university purdue university at columbus pu indiana in college scholarships find money for college financial aid for students and admission'

distance = 467
spam score = 54
title = 'webb institute new york ny college scholarships find money for college financial aid for students and admission'

distance = 494
spam score = 53
title = 'morehead state university kentucky ky college scholarships find money for college financial aid for students and admission'

distance = 495
spam score = 53
title = 'northern illinois university illinois il college scholarships find money for college financial aid for students and admission'

distance = 495
spam score = 54
title = 'quinsigamond community college massachusetts ma college scholarships find money for college financial aid for students and admission'

distance = 496
spam score = 53
title = 'episcopal theological seminary of the southwest texas tx college scholarships find money for college financial aid for students and admission'

distance = 496
spam score = 54
title = 'roxbury community college massachusetts ma college scholarships find money for college financial aid for students and admission'

distance = 496
spam score = 51
title = 'universityof missouri system um missouri mo college scholarships find money for college financial aid for students and admission'

distance = 497
spam score = 51
title = 'greenville college illinois il college scholarships find money for college financial aid for students and admission'

distance = 497
spam score = 53
title = 'santa fe community college new mexico nm college scholarships find money for college financial aid for students and admission'

distance = 497
spam score = 59
title = 'university of south dakotasouth dakota sd amp college scholarships find money for college financial aid for students and admission'

distance = 497
spam score = 50
title = 'blackburn college illinois il college scholarships find money for college financial aid for students and admission'

distance = 524
spam score = 56
title = 'university of massachusetts system umass massachusetts ma college scholarships find money for college financial aid for students and admission'

distance = 524
spam score = 55
title = 'the thomas more college of liberal arts new hampshire nh college scholarships find money for college financial aid for students and admission'

distance = 524
spam score = 54
title = 'texas aampm university prairie view aampm university texas tx college scholarships find money for college financial aid for students and admission'

distance = 525
spam score = 53
title = 'northeastern illinois university illinois il college scholarships find money for college financial aid for students and admission'

distance = 525
spam score = 52
title = 'broward community college florida fl college scholarships find money for college financial aid for students and admission'

distance = 525
spam score = 52
title = 'finger lakes community college new york ny college scholarships find money for college financial aid for students and admission'

distance = 525
spam score = 51
title = 'valencia community college florida fl college scholarships find money for college financial aid for students and admission'

distance = 526
spam score = 56
title = 'northern essex community college massachusetts ma college scholarships find money for college financial aid for students and admission'

distance = 526
spam score = 53
title = 'rose hulman institute of technology indiana in college scholarships find money for college financial aid for students and admission'

distance = 526
spam score = 51
title = 'fulton montgomery community college new york ny college scholarships find money for college financial aid for students and admission'

distance = 555
spam score = 52
title = 'virginia community college system virginia va college scholarships find money for college financial aid for students and admission'

distance = 556
spam score = 52
title = 'north harris montgomery county community college kingwood college texas tx college scholarships find money for college financial aid for students and admission'

distance = 556
spam score = 52
title = 'southwest missouri state university west plains missouri mo college scholarships find money for college financial aid for students and admission'

distance = 556
spam score = 54
title = 'university of charleston west virginia wv student loans west virginai wv college scholarships find money for college financial aid for students and admission'

distance = 556
spam score = 54
title = 'rensselaer polytechnic institute new york ny college scholarships find money for college financial aid for students and admission'

distance = 556
spam score = 52
title = 'polk community college florida fl college scholarships find money for college financial aid for students and admission'

distance = 557
spam score = 54
title = 'southwestern indian polytechnic institute new mexico nm college scholarships find money for college financial aid for students and admission'

distance = 558
spam score = 51
title = 'virginia community college system tidewater community college virginia va college scholarships find money for college financial aid for students and admission'

distance = 558
spam score =