tree path: root node -> e0e466bf0
clusters in node: 129
spam scores: The spammiest documents have a score of 0, and the least spammy have a score of 99. The spam score is the percentage of documents in the collection more spammy than this document. Cluster spam scores are averaged across all documents in a cluster.

clusterid = e0f0556c0
RMSE = 0
spam score = 46
documents = 1
clusterid = e0e74a890
RMSE = 0
spam score = 4
documents = 1
clusterid = e0ef7c480
RMSE = 0
spam score = 70
documents = 1
clusterid = e0edf7ef0
RMSE = 0
spam score = 55
documents = 1
clusterid = e0e60ced0
RMSE = 0
spam score = 1
documents = 1
clusterid = e0f119af0
RMSE = 0
spam score = 15
documents = 1
clusterid = e0e8b2270
RMSE = 0
spam score = 75
documents = 1
clusterid = e0eb63280
RMSE = 0
spam score = 5
documents = 2
clusterid = e0f252de0
RMSE = 72.4603
spam score = 3
documents = 2
clusterid = e0ed40330
RMSE = 145
spam score = 13
documents = 2
clusterid = e0e873040
RMSE = 171.571
spam score = 9.60542
documents = 849
clusterid = e0f2100e0
RMSE = 205.002
spam score = 10.0173
documents = 753
clusterid = e0e4cb340
RMSE = 207.409
spam score = 7.31541
documents = 3459
clusterid = e0f231760
RMSE = 209.396
spam score = 2.9925
documents = 667
clusterid = e0f182140
RMSE = 210.022
spam score = 10.0526
documents = 741
clusterid = e0e512410
RMSE = 210.321
spam score = 9.27855
documents = 858
clusterid = e0e823ad0
RMSE = 210.865
spam score = 11.8707
documents = 704
clusterid = e0f100a10
RMSE = 211.204
spam score = 11.1136
documents = 44
clusterid = e0ed37d90
RMSE = 211.773
spam score = 4.61596
documents = 664
clusterid = e0f07f2e0
RMSE = 211.806
spam score = 13.7865
documents = 801
clusterid = e0e59c2e0
RMSE = 213.412
spam score = 10.2013
documents = 770
clusterid = e0e69b270
RMSE = 213.893
spam score = 3.94559
documents = 680
clusterid = e0f1bc8a0
RMSE = 214.251
spam score = 10.4654
documents = 881
clusterid = e0ec3c4c0
RMSE = 214.941
spam score = 4.08892
documents = 731
clusterid = e0f0408b0
RMSE = 215.182
spam score = 4.8763
documents = 768
clusterid = e0f0513f0
RMSE = 215.193
spam score = 7.69599
documents = 3513
clusterid = e0ec93fd0
RMSE = 215.327
spam score = 9.48922
documents = 742
clusterid = e0f0983c0
RMSE = 215.445
spam score = 9.44488
documents = 771
clusterid = e0ec16b70
RMSE = 216.185
spam score = 5.00791
documents = 759
clusterid = e0e5efb20
RMSE = 216.338
spam score = 3.25658
documents = 760
clusterid = e0f2b2e90
RMSE = 216.709
spam score = 5.9723
documents = 758
clusterid = e0e71c9a0
RMSE = 217.257
spam score = 3.73077
documents = 520
clusterid = e0e49d3c0
RMSE = 217.459
spam score = 14.0329
documents = 760
clusterid = e0e802450
RMSE = 218.299
spam score = 11.1213
documents = 849
clusterid = e0ef5f0d0
RMSE = 218.736
spam score = 7.70294
documents = 579
clusterid = e0e7b71b0
RMSE = 219.28
spam score = 9.70674
documents = 757
clusterid = e0e5a8b50
RMSE = 219.519
spam score = 7.81897
documents = 812
clusterid = e0ef0b890
RMSE = 219.575
spam score = 14.6987
documents = 780
clusterid = e0ee75350
RMSE = 219.595
spam score = 8.40788
documents = 711
clusterid = e0f27ca00
RMSE = 221.088
spam score = 10.5583
documents = 815
clusterid = e0e927130
RMSE = 221.372
spam score = 6.71488
documents = 726
clusterid = e0e90e050
RMSE = 221.808
spam score = 11.7159
documents = 859
clusterid = e0e5d2770
RMSE = 221.954
spam score = 1.99863
documents = 731
clusterid = e0e93bf40
RMSE = 221.979
spam score = 12.0681
documents = 793
clusterid = e0efbaeb0
RMSE = 222.418
spam score = 12.5948
documents = 733
clusterid = e0efd3f90
RMSE = 223.09
spam score = 7.40986
documents = 710
clusterid = e0e494e20
RMSE = 224.466
spam score = 7.00791
documents = 759
clusterid = e0f24a840
RMSE = 225.561
spam score = 4.20427
documents = 749
clusterid = e0e619740
RMSE = 225.702
spam score = 13.7519
documents = 806
clusterid = e0ea08910
RMSE = 225.95
spam score = 6.92472
documents = 704
clusterid = e0f267bf0
RMSE = 226.802
spam score = 15.9876
documents = 805
clusterid = e0e7a6670
RMSE = 228.22
spam score = 2.03305
documents = 696
clusterid = e0f044b80
RMSE = 229.427
spam score = 5.40159
documents = 757
clusterid = e0ef99830
RMSE = 231.019
spam score = 5.01912
documents = 680
clusterid = e0e7465c0
RMSE = 231.515
spam score = 5.12874
documents = 870
clusterid = e0f2422a0
RMSE = 231.832
spam score = 11.2028
documents = 725
clusterid = e0eb80630
RMSE = 231.873
spam score = 15.5106
documents = 758
clusterid = e0ee79620
RMSE = 232.43
spam score = 9.04183
documents = 765
clusterid = e0ee92700
RMSE = 233.055
spam score = 9.63345
documents = 843
clusterid = e0eeafab0
RMSE = 233.318
spam score = 7.70946
documents = 148
clusterid = e0ee57fa0
RMSE = 234.325
spam score = 5.99858
documents = 706
clusterid = e0e490b70
RMSE = 238.161
spam score = 6.06974
documents = 717
clusterid = e0e4c7070
RMSE = 238.703
spam score = 4.47489
documents = 657
clusterid = e0f0277d0
RMSE = 240.67
spam score = 7.3733
documents = 809
clusterid = e0ef8cfc0
RMSE = 241.174
spam score = 8.30376
documents = 744
clusterid = e0e899750
RMSE = 242.879
spam score = 8.46727
documents = 779
clusterid = e0f0e3660
RMSE = 244.136
spam score = 12.0875
documents = 2675
clusterid = e0e96e100
RMSE = 245.188
spam score = 3.09861
documents = 791
clusterid = e0ef633a0
RMSE = 245.999
spam score = 4.8093
documents = 860
clusterid = e0e4a5960
RMSE = 246.006
spam score = 12.8863
documents = 915
clusterid = e0efcb9f0
RMSE = 246.844
spam score = 7.69059
documents = 850
clusterid = e0e52f7c0
RMSE = 252.543
spam score = 8.43217
documents = 715
clusterid = e0eef27b0
RMSE = 255.183
spam score = 6.45569
documents = 1433
clusterid = e0e6c9160
RMSE = 255.655
spam score = 14.5422
documents = 498
clusterid = e0ea15180
RMSE = 258.127
spam score = 5.92956
documents = 3989
clusterid = e0ebbf060
RMSE = 261.64
spam score = 5.3272
documents = 706
clusterid = e0e799e00
RMSE = 262.764
spam score = 6.11111
documents = 693
clusterid = e0f02baa0
RMSE = 263.846
spam score = 9.98146
documents = 755
clusterid = e0f06a4d0
RMSE = 266.387
spam score = 6.3876
documents = 774
clusterid = e0e9daa20
RMSE = 268.084
spam score = 5.58513
documents = 740
clusterid = e0ee43190
RMSE = 270.649
spam score = 4.05589
documents = 841
clusterid = e0eddee10
RMSE = 270.712
spam score = 3.22496
documents = 689
clusterid = e0f001e80
RMSE = 270.726
spam score = 4.12031
documents = 773
clusterid = e0ebf97c0
RMSE = 271.057
spam score = 2.99747
documents = 791
clusterid = e0eaf6960
RMSE = 299.21
spam score = 70.6
documents = 5
clusterid = e0eec8b90
RMSE = 302.055
spam score = 5.14894
documents = 94
clusterid = e0ef91290
RMSE = 302.31
spam score = 7.39702
documents = 670
clusterid = e0ee3abf0
RMSE = 306.585
spam score = 5.40793
documents = 706
clusterid = e0f0efed0
RMSE = 314.184
spam score = 8.85185
documents = 6500
clusterid = e0e4f0c90
RMSE = 324.482
spam score = 11.0884
documents = 860
clusterid = e0ead95b0
RMSE = 326.379
spam score = 5.36611
documents = 661
clusterid = e0edb0f20
RMSE = 326.666
spam score = 7.95686
documents = 765
clusterid = e0ef2cf10
RMSE = 339.695
spam score = 58.5
documents = 2
clusterid = e0f0c62b0
RMSE = 352.992
spam score = 6.12788
documents = 1431
clusterid = e0e4b2260
RMSE = 356.419
spam score = 8.24644
documents = 4350
clusterid = e0e4a1690
RMSE = 359.3
spam score = 3.97232
documents = 1192
clusterid = e0e4bead0
RMSE = 366.732
spam score = 8.08628
documents = 30052
clusterid = e0e4990f0
RMSE = 369.086
spam score = 9.81954
documents = 10950
clusterid = e0e52b4f0
RMSE = 381.676
spam score = 7.6471
documents = 1601
clusterid = e0efa60a0
RMSE = 382.323
spam score = 8.14896
documents = 819
clusterid = e0e48c840
RMSE = 384.319
spam score = 7.54086
documents = 38507
clusterid = e0e4a9c30
RMSE = 385.348
spam score = 7.57519
documents = 37144
clusterid = e0e4b6530
RMSE = 385.484
spam score = 7.53183
documents = 38926
clusterid = e0e4ba800
RMSE = 398.363
spam score = 7.55015
documents = 667617
clusterid = e0e4c2da0
RMSE = 450.206
spam score = 6.75
documents = 100
clusterid = e0ee64810
RMSE = 468.214
spam score = 8.5286
documents = 1154
clusterid = e0e5dad10
RMSE = 480.009
spam score = 54.5
documents = 2
clusterid = e0f299db0
RMSE = 511.465
spam score = 8.05778
documents = 5175
clusterid = e0edce2d0
RMSE = 550.081
spam score = 4.05882
documents = 51
clusterid = e0f13b170
RMSE = 560.629
spam score = 8.60081
documents = 4960
clusterid = e0f059990
RMSE = 620.25
spam score = 61.5
documents = 2
clusterid = e0f0df390
RMSE = 668
spam score = 3.5
documents = 2
clusterid = e0e692cd0
RMSE = 782.73
spam score = 4.7
documents = 10
clusterid = e0e9b93a0
RMSE = 801.811
spam score = 63
documents = 3
clusterid = e0f2a6620
RMSE = 834.381
spam score = 0.32967
documents = 91
clusterid = e0e4e86f0
RMSE = 941.159
spam score = 56
documents = 2
clusterid = e0e5ace20
RMSE = 1040.8
spam score = 6.22222
documents = 9
clusterid = e0e905ab0
RMSE = 1113.34
spam score = 69.8
documents = 5
clusterid = e0ee36920
RMSE = 1138.09
spam score = 68.75
documents = 4
clusterid = e0edc1a60
RMSE = 1139.51
spam score = 7.63158
documents = 19
clusterid = e0eb20580
RMSE = 1142.29
spam score = 0.0222222
documents = 45
clusterid = e0e909d80
RMSE = 1179.11
spam score = 1.26923
documents = 26
clusterid = e0e6b0080
RMSE = 1239.45
spam score = 18.6667
documents = 3
clusterid = e0ed1ecb0
RMSE = 1348.73
spam score = 7.2
documents = 25
clusterid = e0ec2b980
RMSE = 1361.8
spam score = 20.8667
documents = 15
clusterid = e0e98f780
RMSE = 1366.84
spam score = 28
documents = 2
clusterid = e0e5018d0
RMSE = 1406.83
spam score = 20
documents = 4
clusterid = e0e8946c0
RMSE = 1441.46
spam score = 5.5
documents = 8
clusterid = e0eb17fe0
RMSE = 1452.8
spam score = 50
documents = 2
distance = 0
spam score = 46
title = ''

distance = 0
spam score = 4
title = ''

distance = 0
spam score = 70
title = ''

distance = 0
spam score = 55
title = ''

distance = 0
spam score = 1
title = ''

distance = 0
spam score = 15
title = ''

distance = 0
spam score = 75
title = ''

distance = 0
spam score = 5
title = ''

distance = 0
spam score = 5
title = ''

distance = 49
spam score = 3
title = ''

distance = 90
spam score = 3
title = ''

distance = 145
spam score = 13
title = ''

distance = 145
spam score = 13
title = ''

distance = 36
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 epop203123crackslomalkaorg'

distance = 41
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 filemakerprov60crackslomalkaorg'

distance = 45
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 emailsv210crackslomalkaorg'

distance = 45
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 gutecollectioncrackslomalkaorg'

distance = 45
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 hackerv11crackslomalkaorg'

distance = 46
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 keygenslomalkaorg'

distance = 48
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 ascv30crackslomalkaorg'

distance = 49
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 eiconsv370bycorecrackslomalkaorg'

distance = 50
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 animatedscreenv223crackslomalkaorg'

distance = 50
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 eplanpro30crackslomalkaorg'

distance = 52
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 gcodeitcrackslomalkaorg'

distance = 53
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 packplus210crackslomalkaorg'

distance = 54
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 filesecurerv353crackslomalkaorg'

distance = 59
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 autopanoprov121crackslomalkaorg'

distance = 61
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 angelsvsdevilscrackslomalkaorg'

distance = 63
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 f22raptor1000510crackslomalkaorg'

distance = 64
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 asmematev21crackslomalkaorg'

distance = 67
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 hackmanv601crackslomalkaorg'

distance = 70
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 namov505crackslomalkaorg'

distance = 72
spam score = 12
title = 'f34 floppy image flowers screensaver volume v2 activerefresh131build509crackslomalkaorg'

distance = 122
spam score = 11
title = 'f34 floppy image flowers screensaver volume v2 activerefresh136build551crackslomalkaorg'

distance = 122
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 p7dp7crackslomalkaorg'

distance = 122
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 limewireprov347crackslomalkaorg'

distance = 122
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 fsecureantivirusv4051291polishcrackslomalkaorg'

distance = 122
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 accessimagev240newcrackslomalkaorg'

distance = 123
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 arealvalidatorv111keygencrackslomalkaorg'

distance = 123
spam score = 11
title = 'f34 floppy image flowers screensaver volume v2 activefaxserverv388build195crackslomalkaorg'

distance = 123
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 alexsysteamv260crackslomalkaorg'

distance = 123
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 alarmmasterplusv495crackslomalkaorg'

distance = 123
spam score = 11
title = 'f34 floppy image flowers screensaver volume v2 actualspyv171fixedcrackslomalkaorg'

distance = 138
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 favogov11forpalmoscrackslomalkaorg'

distance = 138
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 activesmartscsiv241crackslomalkaorg'

distance = 138
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 acdexpressclientv351bywktcrackslomalkaorg'

distance = 139
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 autopilotv130build731crackcrackslomalkaorg'

distance = 139
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 pusoydos10crackslomalkaorg'

distance = 139
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 nod32allversionscrackslomalkaorg'

distance = 139
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 activestatekomodov25076516crackslomalkaorg'

distance = 140
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 amazingslowdownerv108bydistinctcrackslomalkaorg'

distance = 140
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 arobfantasticmp3networkedencoderv14bymanifestcrackslomalkaorg'

distance = 140
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 audiotoolsv370byrp2kcrackslomalkaorg'

distance = 151
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 ppingtoolsv26crackslomalkaorg'

distance = 151
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 fontshowv39byevidencecrackslomalkaorg'

distance = 152
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 eterm32v120028crackslomalkaorg'

distance = 152
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 anticrashv20crackslomalkaorg'

distance = 152
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 adcomparisonandsynchronizationv112crackslomalkaorg'

distance = 152
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 awiconsprov920crackslomalkaorg'

distance = 152
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 activestartupv112build57crackslomalkaorg'

distance = 152
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 rstudiofatv20crackslomalkaorg'

distance = 153
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 puntotekv15goldcrackslomalkaorg'

distance = 153
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 acdseev603powerpackcrackslomalkaorg'

distance = 163
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 activepdfdocconverterv352crackslomalkaorg'

distance = 163
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 powerarchiver2004v90101crackslomalkaorg'

distance = 164
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 filepeekv23crackslomalkaorg'

distance = 164
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 adobeillustratorcsv70crackslomalkaorg'

distance = 164
spam score = 8
title = 'f34 floppy image flowers screensaver volume v2 polpressfastv123crackslomalkaorg'

distance = 164
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 adailybackupv361crackslomalkaorg'

distance = 164
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 flashmailerv14build141crackslomalkaorg'

distance = 164
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 powerclock407crackslomalkaorg'

distance = 164
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 flashfxpv144build836crackslomalkaorg'

distance = 164
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 airmagnetsurveyorv20crackslomalkaorg'

distance = 174
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 puzzlecreator11build4crackslomalkaorg'

distance = 174
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 aspackv21212jan2002crackslomalkaorg'

distance = 174
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 activemp3activexcontrol19byfhcfcrackslomalkaorg'

distance = 174
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 absolutespadesserialcrackslomalkaorg'

distance = 174
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 activereports2professionalbydatadynamicscrackslomalkaorg'

distance = 174
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 activestatevisualxsltforvs2003v1812494crackslomalkaorg'

distance = 174
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 archivejoev1024crackslomalkaorg'

distance = 174
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 forumposterv10crackslomalkaorg'

distance = 174
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 powercheckv209crackslomalkaorg'

distance = 175
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 powerarchiver2003v87009crackslomalkaorg'

distance = 189
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 privacyinspectorv120bymp2kcrackslomalkaorg'

distance = 189
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 windowsxpkeygenkeychangecrackslomalkaorg'

distance = 189
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 powerarchiver2004v90033byrifcrackslomalkaorg'

distance = 189
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 powerboxxv10crackslomalkaorg'

distance = 189
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 nameityourwayniyowv140crackslomalkaorg'

distance = 189
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 addremoveplus2004v41byfosicrackslomalkaorg'

distance = 190
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 alluringislandsscreensaverv500crackslomalkaorg'

distance = 190
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 postxpertv251build42crackslomalkaorg'

distance = 190
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 uleadvideostudiov900100englishtbybtofullcrackbybidjancrackslomalkaorg'

distance = 190
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 ecleanv101crackslomalkaorg'

distance = 206
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 freshdiagnosev350byimscrackslomalkaorg'

distance = 207
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 fprotantivirusv312dbytsmacrackslomalkaorg'

distance = 207
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 powerwmarecorderv131crackslomalkaorg'

distance = 207
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 privacyprotectorv410crackslomalkaorg'

distance = 207
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 aptechgaussv800910crackslomalkaorg'

distance = 207
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 australiaoutbackscreensaver10crackslomalkaorg'

distance = 207
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 privacysolverv221crackslomalkaorg'

distance = 208
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 privacyinspectorv151crackslomalkaorg'

distance = 208
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 powercryptov14byrp2kcrackslomalkaorg'

distance = 208
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 acehightexttospeechreaderv130bymp2kcrackslomalkaorg'

distance = 226
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 fileprotector2001specialeditionv205crackslomalkaorg'

distance = 227
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 powerarchiver2001v70208byeminencecrackslomalkaorg'

distance = 227
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 ubwdreamcatcherv710crackslomalkaorg'

distance = 227
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 futuremark3dmark2003crackslomalkaorg'

distance = 227
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 postguardv32multilannguagecrackslomalkaorg'

distance = 227
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 fprotantivirusv312cbyfreeze1crackslomalkaorg'

distance = 227
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 aimtoolspro30professionaleditionkeygencrackslomalkaorg'

distance = 227
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 filepulverizerv40bylashcrackslomalkaorg'

distance = 228
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 activestateperldevkitv411crackslomalkaorg'

distance = 228
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 flashfxpv302build1044sceneeditioncrackslomalkaorg'

distance = 272
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 activeskinocxv43patchbydceptioncrackslomalkaorg'

distance = 275
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 pacsoftwarenetworkconsolev30crackslomalkaorg'

distance = 281
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 andromedaredeyeprofilterv11foradobephotoshopcrackslomalkaorg'

distance = 282
spam score = 10
title = 'f34 floppy image flowers screensaver volume v2 postworkquickiescriptspsp8vol2crackslomalkaorg'

distance = 285
spam score = 8
title = 'f34 floppy image flowers screensaver volume v2 powerbusinessusa20011steditioncrackslomalkaorg'

distance = 296
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 powerdefragv301crackbymrkrackercrackslomalkaorg'

distance = 301
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 agnitumoutpostfirewallprov1016171854crackslomalkaorg'

distance = 303
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 puremotionnoisereductionv10forpremierecrackslomalkaorg'

distance = 308
spam score = 9
title = 'f34 floppy image flowers screensaver volume v2 powerdefragpro200bydbccrackslomalkaorg'

distance = 56
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe rdriveimagev30b3011crackslomalkaorg'

distance = 57
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe emanagerv35b08crackslomalkaorg'

distance = 57
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe r2jv10crackslomalkaorg'

distance = 60
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe appointment2000v30crackslomalkaorg'

distance = 61
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe p2cpascalcompiler205ecrackslomalkaorg'

distance = 62
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe archiveitallcrackslomalkaorg'

distance = 63
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activewhoisv212591crackslomalkaorg'

distance = 65
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe forwardmailv279crackcrackslomalkaorg'

distance = 68
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe ecardxpress13crackslomalkaorg'

distance = 69
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activelaunchv124crackslomalkaorg'

distance = 69
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe appointmentbooknetworkv365crackslomalkaorg'

distance = 71
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe f22raptor1000500rcrackslomalkaorg'

distance = 73
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe accessanimationv115crackslomalkaorg'

distance = 74
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe divxprov521crackslomalkaorg'

distance = 80
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe eplanpro35crackslomalkaorg'

distance = 80
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe fx2000v30crackslomalkaorg'

distance = 81
spam score = 11
title = 'w39 winedt winforcer winfax pro wineye winexpe animatedscreenv52crackslomalkaorg'

distance = 83
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe f12001keygencrackslomalkaorg'

distance = 84
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe facemailv10crackslomalkaorg'

distance = 85
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe aplusfileprotectionv26crackslomalkaorg'

distance = 145
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe audiospherev151crackslomalkaorg'

distance = 145
spam score = 11
title = 'w39 winedt winforcer winfax pro wineye winexpe serialslomalkaorg'

distance = 146
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe freepyrofor3dsmaxr4crackslomalkaorg'

distance = 146
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe factorizerv866crackslomalkaorg'

distance = 146
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe odbcviewer22crackslomalkaorg'

distance = 146
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe odbcviewer30crackslomalkaorg'

distance = 146
spam score = 12
title = 'w39 winedt winforcer winfax pro wineye winexpe activerefresh131build509crackslomalkaorg'

distance = 147
spam score = 11
title = 'w39 winedt winforcer winfax pro wineye winexpe adventuremakerv204crackslomalkaorg'

distance = 148
spam score = 11
title = 'w39 winedt winforcer winfax pro wineye winexpe arobfantasticmp3encoderv13byciacrackslomalkaorg'

distance = 148
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe advancedcallcenter302499crackslomalkaorg'

distance = 162
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe amusicalgeneratorv30crackslomalkaorg'

distance = 162
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activeprofile12crackslomalkaorg'

distance = 162
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activeskinv421byfyscrackerscrackslomalkaorg'

distance = 163
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe acescreencapturev215crackslomalkaorg'

distance = 163
spam score = 11
title = 'w39 winedt winforcer winfax pro wineye winexpe andyv135keygencrackslomalkaorg'

distance = 163
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe babylonpro5crackslomalkaorg'

distance = 163
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe puzzlechampionv1200234crackslomalkaorg'

distance = 164
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe advancedalbumeditorv43byorioncrackslomalkaorg'

distance = 164
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe fprotantivirusforwindowsv312acrackslomalkaorg'

distance = 164
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe aplusfilenamingsystemv110crackslomalkaorg'

distance = 178
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activexmanagerv14crackslomalkaorg'

distance = 178
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe windowsxpsp2keygenbyffgcrackslomalkaorg'

distance = 178
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe amethystdwg2pdfv20101crackslomalkaorg'

distance = 178
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe a1dvdaudioripperv1141crackslomalkaorg'

distance = 178
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe arealvalidatorv11crackslomalkaorg'

distance = 178
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe advancedmp3wmarecorderv48crackslomalkaorg'

distance = 178
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activexmanagerv13byfhcfcrackslomalkaorg'

distance = 179
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe fileshredder28crackslomalkaorg'

distance = 179
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activestateperldevkitv411crackslomalkaorg'

distance = 179
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe animatetetbloxv13crackslomalkaorg'

distance = 195
spam score = 11
title = 'w39 winedt winforcer winfax pro wineye winexpe emailhunterv120crackslomalkaorg'

distance = 195
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe apersonaltodolistv10crackslomalkaorg'

distance = 195
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe formpalv50crackslomalkaorg'

distance = 195
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe fsecureantivirusv53finalcrackslomalkaorg'

distance = 195
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe aceutilitiesv14crackslomalkaorg'

distance = 195
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activestartupv112build57crackslomalkaorg'

distance = 196
spam score = 11
title = 'w39 winedt winforcer winfax pro wineye winexpe abstractwebstudio40crackslomalkaorg'

distance = 196
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe pacdoom3halloweenpartyv21bytsrhcrackslomalkaorg'

distance = 196
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe postmasterv263crackslomalkaorg'

distance = 196
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe gawebserverv10100crackslomalkaorg'

distance = 211
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe eborderclient211crackslomalkaorg'

distance = 211
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe fsecureantivirusforwindowsv540crackslomalkaorg'

distance = 211
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe gadugaduv491crackslomalkaorg'

distance = 211
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe fileshredder2000v37bynatabeccrackslomalkaorg'

distance = 212
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe formula1organizerdeluxev20crackslomalkaorg'

distance = 212
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe ecleanv101crackslomalkaorg'

distance = 212
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activefaxserverv385192crackslomalkaorg'

distance = 212
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe enterprisearchitecteav410739unicodecrackslomalkaorg'

distance = 212
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe afabtimezone2015crackslomalkaorg'

distance = 212
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe aprspreadcalculatorv1000byucfcrackslomalkaorg'

distance = 225
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 225
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe fabsoftreformenterprisev9003crackslomalkaorg'

distance = 226
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe picsgebhrenzhlerv5201crackslomalkaorg'

distance = 226
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activeskincontrolocxv20crackslomalkaorg'

distance = 226
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe alltexthtproactivexv45crackslomalkaorg'

distance = 227
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe avitovcdsvcddvdconverterv152crackslomalkaorg'

distance = 228
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe proteusv52profrenchcrackslomalkaorg'

distance = 228
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe windowsxpactivationandspcrackcrackslomalkaorg'

distance = 229
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe windowsxpkeygencrackslomalkaorg'

distance = 229
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe acousticamp3towaveconverterplusv2341byrevengecrackslomalkaorg'

distance = 242
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe formelbank21crackslomalkaorg'

distance = 242
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe activefaxserverv387build194crackslomalkaorg'

distance = 242
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe flamingpearprimuscrackslomalkaorg'

distance = 243
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe faxamaticva96018crackslomalkaorg'

distance = 243
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe acdvideomagicv10bycimcrackslomalkaorg'

distance = 244
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe powerwmarecorderv11crackslomalkaorg'

distance = 244
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe fatecengineeringfmatv10137byscfcrackslomalkaorg'

distance = 244
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe windowsxpservicepack2activatorcrackslomalkaorg'

distance = 244
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe nerodvdvideoplugincrackslomalkaorg'

distance = 244
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe asplogin2000serverlicensecrackslomalkaorg'

distance = 268
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe occilloscopeaudiov22crackslomalkaorg'

distance = 269
spam score = 11
title = 'w39 winedt winforcer winfax pro wineye winexpe activexmanagerv14byevccrackslomalkaorg'

distance = 269
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe abeautifulsunsetscreensaverv10crackslomalkaorg'

distance = 270
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe alawarbacktoearthv10byexplosioncrackslomalkaorg'

distance = 271
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe adreamlottov161multilingualcrackslomalkaorg'

distance = 271
spam score = 9
title = 'w39 winedt winforcer winfax pro wineye winexpe fprotantivirusv315bevafstopwupdatercrackslomalkaorg'

distance = 272
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe xsqueezemev404crackslomalkaorg'

distance = 274
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe abcwarearealv2000220crackslomalkaorg'

distance = 274
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe glockeasymail20077crackslomalkaorg'

distance = 276
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe advancedvbapasswordrecoveryprov132byeaglecrackslomalkaorg'

distance = 382
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe fsecurevpnplusv550166winnt2kxpcrackslomalkaorg'

distance = 386
spam score = 10
title = 'w39 winedt winforcer winfax pro wineye winexpe acdpicaview32v131spanishpatchbybidjancrackslomalkaorg'

distance = 422
spam score = 11
title = 'w39 winedt winforcer winfax pro wineye winexpe gadugaduallversionsbannerkiller2v11byunrealcrackslomalkaorg'

distance = 13
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv andorv10newcrackslomalkaorg'

distance = 22
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv axev21crackslomalkaorg'

distance = 26
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv qwwwcrackslomalkaorg'

distance = 33
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv gbee13crackslomalkaorg'

distance = 34
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv halloweenv19992crackslomalkaorg'

distance = 35
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv r2v504crackslomalkaorg'

distance = 36
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv analyzer2000v310crackslomalkaorg'

distance = 36
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv alockv65crackslomalkaorg'

distance = 37
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv r2v507gcrackslomalkaorg'

distance = 38
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv anywhere2000v50crackslomalkaorg'

distance = 39
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv kftpv32419crackslomalkaorg'

distance = 40
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv activetodolistv11crackslomalkaorg'

distance = 40
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv halflifev1015crackslomalkaorg'

distance = 46
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv autobahnv16crackslomalkaorg'

distance = 47
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv freshdownloadv310newcrackslomalkaorg'

distance = 48
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv pmanv10bandwjavacrackslomalkaorg'

distance = 49
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv findflashv150crackslomalkaorg'

distance = 51
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv anydvdv3911crackslomalkaorg'

distance = 51
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv anydvdv6031crackslomalkaorg'

distance = 51
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv abc2winv21hcrackslomalkaorg'

distance = 143
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv aureliov11crackslomalkaorg'

distance = 143
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv tagandrenamev13crackslomalkaorg'

distance = 143
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv kagayakiiiistandardcrackslomalkaorg'

distance = 143
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv p3shortcutsv10crackslomalkaorg'

distance = 143
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv bjigsawv72crackslomalkaorg'

distance = 144
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv namov502crackslomalkaorg'

distance = 144
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv advancedsystemoptimizerv2012crackslomalkaorg'

distance = 144
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv adobephotoshopelementsv1retailcrackslomalkaorg'

distance = 144
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv tagandrenamev20crackslomalkaorg'

distance = 144
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv anyreaderv1426crackslomalkaorg'

distance = 162
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv atomtimerv220crackslomalkaorg'

distance = 162
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv arlesimagewebpagecreatorv521crackslomalkaorg'

distance = 163
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv finditv303crackslomalkaorg'

distance = 163
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv anetimagegallery20crackslomalkaorg'

distance = 163
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv applequicktimeprov652germancrackslomalkaorg'

distance = 163
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv advancedpichunterv152crackslomalkaorg'

distance = 163
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv abfoutlookexpressbackupv183219crackslomalkaorg'

distance = 163
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv babychartsv10byorioncrackslomalkaorg'

distance = 163
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv zannograbv124crackslomalkaorg'

distance = 163
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv fontdinerkentuckyfriedcrackslomalkaorg'

distance = 179
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv awiconsv850bysccrackslomalkaorg'

distance = 179
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv axialisiconworkshopv503bydeecrackslomalkaorg'

distance = 179
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv atomicalarmclockv41crackslomalkaorg'

distance = 180
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv abookprov30nscrackslomalkaorg'

distance = 180
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv qarbonviewletbuilderv411crackslomalkaorg'

distance = 180
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv objectrexxv21crackslomalkaorg'

distance = 180
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv appletbuttonfactoryv40crackslomalkaorg'

distance = 180
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv applauncherv90crackslomalkaorg'

distance = 180
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv tableditv260b7crackslomalkaorg'

distance = 180
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv axialisaxcdplayerv260newcrackslomalkaorg'

distance = 194
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv axialisalbumphotov20bynemrod34crackslomalkaorg'

distance = 194
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv axialisiconworkshopv502corporateeditioncrackslomalkaorg'

distance = 194
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv findv26bydfcrackslomalkaorg'

distance = 194
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv pacestarlanflowv4171787crackslomalkaorg'

distance = 194
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv atscreenthiefv320build256crackslomalkaorg'

distance = 194
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv arlesimagewebpagecreatorv473bylashcrackslomalkaorg'

distance = 194
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv ntrackstudiov33crackslomalkaorg'

distance = 194
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv anvirvirusdestroyerv35crackslomalkaorg'

distance = 194
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv odbcviewer30crackslomalkaorg'

distance = 194
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv awiconsv850newcrackslomalkaorg'

distance = 209
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv armadillosoftwareprotectionsystemv183crackslomalkaorg'

distance = 209
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv atscreenthief391365crackslomalkaorg'

distance = 209
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv xadventurev10crackslomalkaorg'

distance = 209
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv abracadabrav126bytnocrackslomalkaorg'

distance = 209
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv accountswitchv10crackslomalkaorg'

distance = 209
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv qsetv132022crackslomalkaorg'

distance = 210
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv amazingslowdownerv102serialbyevidencecrackslomalkaorg'

distance = 210
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv abroadv42forpalmoscrackslomalkaorg'

distance = 210
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv amazev404crackslomalkaorg'

distance = 210
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv frendv471germancrackslomalkaorg'

distance = 228
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv anettopasswordsaverv20crackslomalkaorg'

distance = 228
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv adobegoliveinterfaceimproverv15crackslomalkaorg'

distance = 228
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv animagicgifanimatorlitev110crackslomalkaorg'

distance = 228
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv arlesimagewebpagecreatorv462bytmgcrackslomalkaorg'

distance = 228
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv acdfotoangelov10patchcrackslomalkaorg'

distance = 228
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv abilitiesbuildermeasureitv11crackslomalkaorg'

distance = 228
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv anywhere2000v41byaaocgcrackslomalkaorg'

distance = 228
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv arlingtoncustombrowserv812bycphvcrackslomalkaorg'

distance = 228
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv anyformv31bystreamcrackslomalkaorg'

distance = 228
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv facefilterstandardv10crackslomalkaorg'

distance = 247
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv freememprofessionalv5001bylaxitycrackslomalkaorg'

distance = 247
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv qrecovery20build400crackslomalkaorg'

distance = 247
spam score = 6
title = 'm1 mabry x activex control m http ftp ftpserv xvideoconverterv233crackslomalkaorg'

distance = 247
spam score = 6
title = 'm1 mabry x activex control m http ftp ftpserv xaudiovideoclipjoinerv12crackslomalkaorg'

distance = 247
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv adobeacrobatv6xkeygenbyrorcrackslomalkaorg'

distance = 247
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv appletbuttonfactoryv45bytexcrackslomalkaorg'

distance = 247
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv aurorampegtodvdburnerv371crackslomalkaorg'

distance = 247
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv activewhoisv212583crackslomalkaorg'

distance = 247
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv vampirethemasquaradev10crackslomalkaorg'

distance = 247
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv atelierwebsecurityportscannerawspsv451crackslomalkaorg'

distance = 274
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv armadillosoftwareprotectionsystemv190beta2crackslomalkaorg'

distance = 274
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv adobeillustratorcstryoutexpiryremovalpatchcrackslomalkaorg'

distance = 274
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv pcad2001fulltrialfixedv2crackslomalkaorg'

distance = 274
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv zaxwerks3dinvigoratorv403foradobeaftereffectscrackslomalkaorg'

distance = 274
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv arlesimagewebpagecreatorv473bytntcrackslomalkaorg'

distance = 274
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv tabulex2001v501crackslomalkaorg'

distance = 275
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv aurorasoftware2productsgenericcrackslomalkaorg'

distance = 275
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv aportisdocv20forpalmoscrackslomalkaorg'

distance = 275
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv fabsoftreformenterprisev9003crackslomalkaorg'

distance = 275
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv ubrechnungv207crackslomalkaorg'

distance = 382
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv auroravideovcdsvcddvdconverterandcreatorv101bytbecrackslomalkaorg'

distance = 384
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv namowebeditorv402trialbyamokcrackslomalkaorg'

distance = 384
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv acdfotocanvasv11englishbybidjancrackslomalkaorg'

distance = 385
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv namowebeditorsuitev602105trialgermancrackslomalkaorg'

distance = 396
spam score = 8
title = 'm1 mabry x activex control m http ftp ftpserv namowebeditorv50bycrackmanboycrackslomalkaorg'

distance = 403
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv adobephotoshopcsv80andadobeimagereadycsv80crackslomalkaorg'

distance = 427
spam score = 7
title = 'm1 mabry x activex control m http ftp ftpserv auroravideovcdsvcddvdconverterandcreatorv121bycafecrackslomalkaorg'

distance = 1330
spam score = 17
title = 'mabry http client activex control with ssl support 201 mabryhttpclientactivexcontrolwithsslsupport201crackslomalkaru'

distance = 1406
spam score = 17
title = 'mabry hitimex high resolution timer for visual basic hitime vbx mabryhitimexhighresolutiontimerforvisualbasichitimevbxcrackslomalkaru'

distance = 2
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fishv333431crackslomalkaorg'

distance = 37
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s adayinthelifev15serialcrackslomalkaorg'

distance = 59
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s activerefreshv22622crackslomalkaorg'

distance = 60
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s finetunev141crackslomalkaorg'

distance = 61
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s acehtmlprov40crackslomalkaorg'

distance = 63
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s activeoptimizercrackslomalkaorg'

distance = 68
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s activeskinv426crackslomalkaorg'

distance = 68
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s adayinthelifev15crackcrackslomalkaorg'

distance = 70
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s qacoachv2215crackslomalkaorg'

distance = 70
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s advancedcallrecorderv130157crackslomalkaorg'

distance = 72
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s animatedblackjackv10crackslomalkaorg'

distance = 73
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s f1racingsimcrackslomalkaorg'

distance = 74
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s nrecv17crackslomalkaorg'

distance = 75
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s archivershellv60by404crackslomalkaorg'

distance = 77
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fortknox2059crackslomalkaorg'

distance = 82
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s f12001keygencrackslomalkaorg'

distance = 84
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s falbumv101crackslomalkaorg'

distance = 86
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s asteroidminerv31byevidencecrackslomalkaorg'

distance = 87
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s anticrashv21build883crackslomalkaorg'

distance = 90
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s acousticav30crackslomalkaorg'

distance = 150
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s amabilis3dcanvasprov60byepscrackslomalkaorg'

distance = 150
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s antennawebdesignstudiov1673bycafecrackslomalkaorg'

distance = 150
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s p2cpascalcompilerv212ecrackslomalkaorg'

distance = 151
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s avdvolumecalculatorv50crackslomalkaorg'

distance = 151
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s acousticav310227crackslomalkaorg'

distance = 151
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s abcpagerplus508crackslomalkaorg'

distance = 151
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s finditprov400bytsrhcrackslomalkaorg'

distance = 152
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s autobahnv16crackslomalkaorg'

distance = 152
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s autoresponderv20034crackslomalkaorg'

distance = 152
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s actualsearchandreplacev253crackslomalkaorg'

distance = 167
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s ativaprov3xxcrackslomalkaorg'

distance = 167
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fathsendmailcontrolforwin32v15crackslomalkaorg'

distance = 167
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s activeskinv4273crackslomalkaorg'

distance = 169
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s a1audioripperv100crackslomalkaorg'

distance = 169
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s eborderserversmallbushiness12crackslomalkaorg'

distance = 169
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s agmapthat375crackslomalkaorg'

distance = 169
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s rwin2000keyboardswitchv601021crackslomalkaorg'

distance = 169
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s aktienprofiv102crackslomalkaorg'

distance = 169
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s achristmasatsantasv29byfffcrackslomalkaorg'

distance = 169
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s filescavengerv21ucrackslomalkaorg'

distance = 183
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s activeskincontrolv43crackslomalkaorg'

distance = 183
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s rwin2000keyboardswitchv6001119crackslomalkaorg'

distance = 184
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s galav100byfffcrackslomalkaorg'

distance = 184
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s agamawebbuttonsv261crackslomalkaorg'

distance = 184
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s activeskinocxv425crackslomalkaorg'

distance = 185
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s aardvarkprohtmleditorv301byjumanji98crackslomalkaorg'

distance = 185
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s formpalv50crackslomalkaorg'

distance = 185
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s arcticrushv12crackslomalkaorg'

distance = 185
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s allwebmenusv12keygencrackslomalkaorg'

distance = 185
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s windowsxpactivationcrackv42crackslomalkaorg'

distance = 198
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s architecturalsforbricscadv410008frenchcrackslomalkaorg'

distance = 198
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s asposepdfv19crackslomalkaorg'

distance = 198
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fsecureworkstationsuite401crackslomalkaorg'

distance = 198
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s emailalertv10110bystreamcrackslomalkaorg'

distance = 198
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s arialsoundrecorderv116crackslomalkaorg'

distance = 199
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s atomparktagslockprov130crackslomalkaorg'

distance = 200
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s windows2003xpkeygencrackslomalkaorg'

distance = 200
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fapremierleaguestars2001byfhcfcrackslomalkaorg'

distance = 200
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fprotantivirusv312cbyfreeze1crackslomalkaorg'

distance = 200
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s pacecalc112crackslomalkaorg'

distance = 215
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s accentofficepasswordrecovery240crackslomalkaorg'

distance = 216
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s archivesearcherv12crackslomalkaorg'

distance = 216
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s firmtoolsalbumcreatorprov30crackslomalkaorg'

distance = 217
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s kasperskyantiviruspersonalv50xfixedcrackslomalkaorg'

distance = 217
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s firehandemberv631crackslomalkaorg'

distance = 217
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s emailextractorexpressv210511serialcrackslomalkaorg'

distance = 217
spam score = 2
title = 'p48 ping for pinao piloc plotter palmos pink s fastnetconnectionacceleratorv14byevidencecrackslomalkaorg'

distance = 218
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s flashcamv158crackslomalkaorg'

distance = 218
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s nerodvdvideoplugincrackslomalkaorg'

distance = 218
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s aardvarkpolisherforvb6084crackslomalkaorg'

distance = 232
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s advancedregistrytracerv14bypccrackslomalkaorg'

distance = 232
spam score = 2
title = 'p48 ping for pinao piloc plotter palmos pink s favoritefolders11crackslomalkaorg'

distance = 232
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s ftdwatchdogv80crackslomalkaorg'

distance = 232
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s almostalladingsoftwareproductscrackslomalkaorg'

distance = 233
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s emailmanv311build0302crackslomalkaorg'

distance = 233
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s vagcomv078betacrackslomalkaorg'

distance = 233
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s emailextractorv21build05011bytntcrackslomalkaorg'

distance = 233
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s anconiarocketsalesv15276crackslomalkaorg'

distance = 233
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fileshredder2000v41crackslomalkaorg'

distance = 233
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s activestatevisualpythonforvs2002v1812082crackslomalkaorg'

distance = 250
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s ashampoomp3audiocenterv150bycimcrackslomalkaorg'

distance = 250
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s a1quicktrayv20bylocklesscrackslomalkaorg'

distance = 250
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s pcad2001fulltrialfixedv2crackslomalkaorg'

distance = 250
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s agendamsdv240spanishbydbccrackslomalkaorg'

distance = 250
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s g6ftpserver20rc1regfilecrackslomalkaorg'

distance = 250
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s ntrackstudiov202214pluginscrackslomalkaorg'

distance = 250
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fprotantivirusforwindowsv307crackslomalkaorg'

distance = 251
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s aesopgifcreatorv102crackslomalkaorg'

distance = 251
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s animagicgifanimatorv122apatchcrackslomalkaorg'

distance = 252
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fsecuantivirusformimesweeperv5419180crackslomalkaorg'

distance = 274
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s frequencyfiler43bydistinctcrackslomalkaorg'

distance = 274
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s actualtestscomhphp0680examcheatsheetv101304crackslomalkaorg'

distance = 275
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s actualtestscomoracle1z0026examcheatsheetv112203crackslomalkaorg'

distance = 276
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s antigameplusv53crackslomalkaorg'

distance = 276
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s argosoftftpserverv1412crackslomalkaorg'

distance = 277
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s apispy32v25crackslomalkaorg'

distance = 277
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fontsubstv142forpalmoscrackslomalkaorg'

distance = 277
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s fprotantivirusforwindowsv311abysparkcrackslomalkaorg'

distance = 278
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s arclabpfadfinderv15bytnocrackslomalkaorg'

distance = 279
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s ajcctnmv610forpocketpccrackslomalkaorg'

distance = 340
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s pinnaclestudioplusv93248trialtofullparisacrackbyruteamcrackslomalkaorg'

distance = 344
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s ashampoomovieshrinkandburnv10crackslomalkaorg'

distance = 350
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s osadobephotoshopcs2tryouttofullactivationkeygenbyoscoriacrackslomalkaorg'

distance = 352
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s arobfantasticmp3encoderv20regfilecrackslomalkaorg'

distance = 375
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s advancedvbapasswordrecoveryprov132byaaocgcrackslomalkaorg'

distance = 379
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s editorebookcompilerv25crackslomalkaorg'

distance = 389
spam score = 3
title = 'p48 ping for pinao piloc plotter palmos pink s agentcyseagentcyselfextractinginstallerv101byeminencecrackslomalkaorg'

distance = 36
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp qprov20120crackslomalkaorg'

distance = 41
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp uwipe27crackslomalkaorg'

distance = 41
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp focusv12crackslomalkaorg'

distance = 57
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp activewhoisv202466crackslomalkaorg'

distance = 65
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp winrarallversionscrackslomalkaorg'

distance = 67
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp aviarymanagerv301crackslomalkaorg'

distance = 67
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp autorecorderv11crackslomalkaorg'

distance = 71
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp autoptionv40crackslomalkaorg'

distance = 73
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp ppingtools26crackslomalkaorg'

distance = 74
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp tmailv133crackslomalkaorg'

distance = 78
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp filescavengerv21crackslomalkaorg'

distance = 80
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp apollovcl52crackslomalkaorg'

distance = 81
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp fullcontrol28crackslomalkaorg'

distance = 82
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp flanker251crackslomalkaorg'

distance = 85
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp fcutterv160crackslomalkaorg'

distance = 86
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp findgraphv1321crackslomalkaorg'

distance = 87
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp slomalkaorg'

distance = 89
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp pacbomberv154crackslomalkaorg'

distance = 89
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp halflifev1016crackslomalkaorg'

distance = 91
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp nod32allversionscrackslomalkaorg'

distance = 154
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp namewizv31keygencrackslomalkaorg'

distance = 154
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp freewebcrackerv100crackslomalkaorg'

distance = 154
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp emailsv225keygenbyfffcrackslomalkaorg'

distance = 155
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp emailsv222crackslomalkaorg'

distance = 155
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp p2cpluscompilerv218ecrackslomalkaorg'

distance = 156
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp avast4professionaleditionrepackcrackslomalkaorg'

distance = 156
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp adayinthelife15crackslomalkaorg'

distance = 157
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp absolutesecurity39crackslomalkaorg'

distance = 157
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp nod32crackslomalkaorg'

distance = 158
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp absolutesecuritystandardv36crackslomalkaorg'

distance = 171
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp fineprintv463enterpriseeditioncrackslomalkaorg'

distance = 171
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp ashampoomp3studiov1036ecrackslomalkaorg'

distance = 171
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp obriseasygradeprov36crackslomalkaorg'

distance = 171
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp fabsoftreformenterprisev90012crackslomalkaorg'

distance = 171
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp alladvantageideditor100crackslomalkaorg'

distance = 172
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp namowebeditorv304crackslomalkaorg'

distance = 172
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp assetandequipmenttrackingsystemv141crackslomalkaorg'

distance = 172
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp apollophoto2vcdv111crackslomalkaorg'

distance = 172
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp autoyachtv820crackslomalkaorg'

distance = 173
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp activeskincontrolocxv20crackslomalkaorg'

distance = 183
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp faxamaticva93201bydbccrackslomalkaorg'

distance = 183
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp autostitchv2185crackslomalkaorg'

distance = 184
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp ecampaigncorporateeditionv4811crackslomalkaorg'

distance = 184
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp allinoneyahtzeev25keygencrackslomalkaorg'

distance = 184
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp asoundrecorderv25crackslomalkaorg'

distance = 184
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp abeechmmakerv13crackslomalkaorg'

distance = 185
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp activeskinocxv4257crackslomalkaorg'

distance = 185
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp aboxv11release100crackslomalkaorg'

distance = 185
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp address2000v550qcrackslomalkaorg'

distance = 185
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp nagger20140crackslomalkaorg'

distance = 197
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp editorv30byf4cgcrackslomalkaorg'

distance = 197
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp antiviruskasperskypersonalprov502keygenfilecrackslomalkaorg'

distance = 197
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp windowsxphomeeditionactivationcrackcrackslomalkaorg'

distance = 198
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp axialisiconworkshopv501corporateeditioncrackslomalkaorg'

distance = 198
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp fsecureworkstationsuite401crackslomalkaorg'

distance = 198
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp activestatevisualxsltforvs2002v1812494crackslomalkaorg'

distance = 198
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp editorv30bymp2kcrackslomalkaorg'

distance = 198
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 198
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp aliasmayaunlimitedv60forlinuxcrackslomalkaorg'

distance = 198
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp filequestlite20crackslomalkaorg'

distance = 216
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp accesspasswordrecoverv162crackslomalkaorg'

distance = 216
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp pacestarlanflowv4171787crackslomalkaorg'

distance = 217
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp fantasytetrixv10byphantomsoftcrackslomalkaorg'

distance = 217
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp akalaexelockv300byhammerheadcrackslomalkaorg'

distance = 217
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp finetunev150serialbyfhcfcrackslomalkaorg'

distance = 217
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp autopage211crackslomalkaorg'

distance = 217
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp activefile227crackslomalkaorg'

distance = 217
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp emailextractorexpressv21byeminencecrackslomalkaorg'

distance = 217
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp aurorix2woodmakerv20crackslomalkaorg'

distance = 218
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp xaudiovideoclipjoinerv12crackslomalkaorg'

distance = 231
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp antiviruskasperskypersonalpro5xcrackslomalkaorg'

distance = 231
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp gsoftencryptor2006v101crackslomalkaorg'

distance = 231
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp acedvdbackupv122crackslomalkaorg'

distance = 232
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp activexmanagerv13byserials2000crackslomalkaorg'

distance = 233
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp finditv400byembracecrackslomalkaorg'

distance = 233
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp airxonixv135byglupicrackslomalkaorg'

distance = 233
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp animatedformeffect10fordelphi4crackslomalkaorg'

distance = 233
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp fsecureantivirusv409crackslomalkaorg'

distance = 234
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp eiconsv316crackslomalkaorg'

distance = 234
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp argosoftmailserverprov1837crackslomalkaorg'

distance = 250
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp freememprofessionalv43byfhcfcrackslomalkaorg'

distance = 250
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp fastmenuv104bytntcrackslomalkaorg'

distance = 250
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp afsearchv865abyfritmocrackslomalkaorg'

distance = 250
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp imtoo3gpvideoconverterv2115build1201crackslomalkaorg'

distance = 251
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp namowebeditorsuitev602105trialgermancrackslomalkaorg'

distance = 251
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp reallusionfacefilterv105181studioeditioncrackslomalkaorg'

distance = 251
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp g6utillitiesv17crackslomalkaorg'

distance = 251
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp halflife2properbylogiccrackslomalkaorg'

distance = 251
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp firehandemberprov3519crackslomalkaorg'

distance = 251
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp atomsbondingandstructure11crackslomalkaorg'

distance = 277
spam score = 9
title = 'c72 coolspeech coolfocus pro treeview cooolftp filetimeedit2v210crackslomalkaorg'

distance = 278
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp windows2003andxpandlhantiproductactivationv200crackslomalkaorg'

distance = 278
spam score = 11
title = 'c72 coolspeech coolfocus pro treeview cooolftp avirtsohov42crackslomalkaorg'

distance = 279
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp puzzlebrainstormv12crackslomalkaorg'

distance = 280
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp acdsystemsacdseev70powerpackcrackslomalkaorg'

distance = 281
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp activeskincontrolocxv22byeclipsecrackslomalkaorg'

distance = 281
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp activexmanagerv14bydbccrackslomalkaorg'

distance = 282
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp fsecureantivirusformicrosoftexchangewithspamcontrolv631crackslomalkaorg'

distance = 282
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp windowsxpsp2keygenbyffgcrackslomalkaorg'

distance = 283
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp autoplaymenubuilderv40byfffcrackslomalkaorg'

distance = 386
spam score = 10
title = 'c72 coolspeech coolfocus pro treeview cooolftp osadobephotoshopcs2tryouttofullactivationkeygenbyoscoriacrackslomalkaorg'

distance = 37
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fcutterv152crackslomalkaorg'

distance = 43
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa adayinthelifev151serialcrackslomalkaorg'

distance = 56
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa atafv500crackslomalkaorg'

distance = 58
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa accessadministratorprov30crackslomalkaorg'

distance = 62
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa rastarmonkeyv1001crackslomalkaorg'

distance = 62
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa accesslockv23crackslomalkaorg'

distance = 64
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa emailsv222crackslomalkaorg'

distance = 66
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa acqurlv40crackslomalkaorg'

distance = 66
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa faxamaticva94714crackslomalkaorg'

distance = 73
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa v2000sr4crackslomalkaorg'

distance = 75
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fcutterv160crackslomalkaorg'

distance = 76
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa fastmenuv106crackslomalkaorg'

distance = 76
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa asthmaassistant11crackslomalkaorg'

distance = 78
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa eborderclient20crackslomalkaorg'

distance = 79
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa qftp23crackslomalkaorg'

distance = 79
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa ecampaignv2961crackslomalkaorg'

distance = 84
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa aprcalcv30byfaith2000crackslomalkaorg'

distance = 84
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa activeundeletev50crackslomalkaorg'

distance = 84
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa facefilterstandardv10crackslomalkaorg'

distance = 85
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa albumcreatorv32crackslomalkaorg'

distance = 153
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa anfyv21crackslomalkaorg'

distance = 153
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa addremoveplus2004v410750crackslomalkaorg'

distance = 153
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa filerecover2000v222dcrackslomalkaorg'

distance = 154
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fsecuresshclientv5454crackslomalkaorg'

distance = 154
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fineprint321crackslomalkaorg'

distance = 154
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa argentumbackupv180bylashcrackslomalkaorg'

distance = 155
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa falbumv101crackslomalkaorg'

distance = 155
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fsecureantivirusv531crackslomalkaorg'

distance = 155
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa findduplicatev22crackslomalkaorg'

distance = 155
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa absolutepatiencev23byinsightcrackslomalkaorg'

distance = 172
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa qbiknetpatrolv11crackslomalkaorg'

distance = 172
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa observeranddistributedobserver62acrackslomalkaorg'

distance = 172
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa emailextractorv21build05011bytntcrackslomalkaorg'

distance = 173
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa ardamaxkeyloggerv16bymp2kcrackslomalkaorg'

distance = 173
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa acedvdbackupv128crackslomalkaorg'

distance = 173
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa namowebeditorv602105trialfrenchcrackslomalkaorg'

distance = 173
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa astonshellv191crackslomalkaorg'

distance = 174
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa alphatrisv30serialcrackslomalkaorg'

distance = 174
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa nod32allversionsfixedcrackslomalkaorg'

distance = 174
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa autotrackv10bforautocad14crackslomalkaorg'

distance = 185
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa abpmonv20136crackslomalkaorg'

distance = 185
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa freshuiv590crackslomalkaorg'

distance = 185
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa autorecorderv23betacrackslomalkaorg'

distance = 185
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa achristmasatsantasv29newcrackslomalkaorg'

distance = 185
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa fablockocxactivexcomponent11crackslomalkaorg'

distance = 185
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa aplusfileprotectionv21crackslomalkaorg'

distance = 186
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa akeywordthingv10101crackslomalkaorg'

distance = 186
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa purchaseorderv15r2crackslomalkaorg'

distance = 186
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa animalsfromafricascreensavercrackslomalkaorg'

distance = 186
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa abcwallpapermachinev1030293crackslomalkaorg'

distance = 199
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa farpointlistproactivexv21xcrackslomalkaorg'

distance = 199
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa amazingimagesscreensaverv250crackslomalkaorg'

distance = 199
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa powereditv212byacmecrackslomalkaorg'

distance = 199
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa farpointspreadforwebformsv1070crackslomalkaorg'

distance = 200
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa acevideoworkshopv1436crackslomalkaorg'

distance = 200
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa activewhoisbrowserv202466byheritagecrackslomalkaorg'

distance = 200
spam score = 8
title = 'k5 kchess elite keep kc keeptool build softwa fileslicerv20build09001byeclipsecrackslomalkaorg'

distance = 200
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa asfseekmakerv12crackslomalkaorg'

distance = 200
spam score = 11
title = 'k5 kchess elite keep kc keeptool build softwa activerefreshv20build613crackslomalkaorg'

distance = 201
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa advancedtaskmanager2002crackslomalkaorg'

distance = 217
spam score = 8
title = 'k5 kchess elite keep kc keeptool build softwa powervideoconverterv138crackslomalkaorg'

distance = 217
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa avigifv106bylashcrackslomalkaorg'

distance = 217
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa advancedarchivepasswordrecoveryv200crackslomalkaorg'

distance = 217
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa emailextractorexpressv20byfhcfcrackslomalkaorg'

distance = 218
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fire130forpalmoscrackslomalkaorg'

distance = 218
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa addremove4goodv20bypccrackslomalkaorg'

distance = 218
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa familykeyloggerv250crackslomalkaorg'

distance = 219
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa activeskinv425byulises2kcrackslomalkaorg'

distance = 219
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa editorial2v201crackslomalkaorg'

distance = 219
spam score = 8
title = 'k5 kchess elite keep kc keeptool build softwa postersoftposterv79hcrackslomalkaorg'

distance = 233
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa flipalbumprofessionalv55byfosicrackslomalkaorg'

distance = 233
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa accessmanagerv60bytsrhcrackslomalkaorg'

distance = 233
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa adobeatmospherev10build198tryoutmultilanguagecrackslomalkaorg'

distance = 234
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa autourlsubmit16crackslomalkaorg'

distance = 234
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa activestatekomodov301professionalcrackslomalkaorg'

distance = 234
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa emailalertv10110bystreamcrackslomalkaorg'

distance = 234
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa activexmanagerv13byamokcrackslomalkaorg'

distance = 235
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa acousticav221byaaocgcrackslomalkaorg'

distance = 235
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa arealvalidatorv111keygencrackslomalkaorg'

distance = 235
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa aprspreadcalculatorv1000bypccrackslomalkaorg'

distance = 251
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa privacyfence10crackslomalkaorg'

distance = 252
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa kasperskyantiviruskeyscollectioncrackslomalkaorg'

distance = 252
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa pacestarumldiagrammer417build1787trialcrackslomalkaorg'

distance = 252
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fileviewactivexcontrolv50crackslomalkaorg'

distance = 252
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa acdsystemsacdseepowerpackv7061crackslomalkaorg'

distance = 252
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa aptcomputeraccessmanagerclientv101crackslomalkaorg'

distance = 253
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa flashfxpv22build966crackslomalkaorg'

distance = 253
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa vandykesecurecrtv409460crackslomalkaorg'

distance = 253
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa flashfxpv144build836crackslomalkaorg'

distance = 253
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa absolutistjetducksv10forpocketpccrackslomalkaorg'

distance = 276
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa halworks22crackslomalkaorg'

distance = 276
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa firehandemberexpress35xcrackslomalkaorg'

distance = 278
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa puzzlecreator11build4crackslomalkaorg'

distance = 278
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa antispyprov102byarteamcrackslomalkaorg'

distance = 278
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fathftpcontrolforwin32v15crackslomalkaorg'

distance = 279
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fprotantivirusforwindowsv308crackslomalkaorg'

distance = 279
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa windowsxpactivationhackhomeoemretailcrackslomalkaorg'

distance = 279
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa alienskinxenofex11crackslomalkaorg'

distance = 280
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa acdfotoslatev30englishbybidjancrackslomalkaorg'

distance = 280
spam score = 10
title = 'k5 kchess elite keep kc keeptool build softwa powerdefragpro200bytntcrackslomalkaorg'

distance = 342
spam score = 8
title = 'k5 kchess elite keep kc keeptool build softwa kasperskyantiviruspersonalprov5020keygenfilebyblackstarcrackslomalkaorg'

distance = 355
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 358
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa accureventerprisev401solariscrackslomalkaorg'

distance = 360
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa postsmilev22bytsrhcrackslomalkaorg'

distance = 364
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa acdsystemsacdseev7062powerpackgermancrackslomalkaorg'

distance = 365
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa activeskinocxv43patchbydceptioncrackslomalkaorg'

distance = 377
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa fastreamiqwebftpserverprofessionalv10rcrackslomalkaorg'

distance = 390
spam score = 9
title = 'k5 kchess elite keep kc keeptool build softwa privatedesktopv16patchbytsrhcrackslomalkaorg'

distance = 3
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis ripv107crackslomalkaorg'

distance = 34
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis eiconsv325crackslomalkaorg'

distance = 52
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis g3bayv104crackslomalkaorg'

distance = 55
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis activeoptimizercrackslomalkaorg'

distance = 55
spam score = 13
title = 'r8 ramcleaner ramactive build ramturbo ramdis objectbarv12crackslomalkaorg'

distance = 65
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis tagandm3uv1311202003crackslomalkaorg'

distance = 68
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis adailybackupv350crackslomalkaorg'

distance = 70
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fisheyeplayerv130crackslomalkaorg'

distance = 71
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis activelaunchv124crackslomalkaorg'

distance = 79
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis frapsv221crackslomalkaorg'

distance = 81
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis f12000v10crackslomalkaorg'

distance = 90
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis gutecollectionbymp2kcrackslomalkaorg'

distance = 90
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fprotv312acrackslomalkaorg'

distance = 94
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis amusicalgeneratorv200288crackslomalkaorg'

distance = 95
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis adregclnv21keygencrackslomalkaorg'

distance = 95
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis ebusinessappletv410crackslomalkaorg'

distance = 98
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis autopilotv102newcrackslomalkaorg'

distance = 98
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis alarmmasterv46crackslomalkaorg'

distance = 102
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fx2000v30crackslomalkaorg'

distance = 102
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis amusicalgeneratorv30beta7crackslomalkaorg'

distance = 150
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis emailextractorexpressv21byorioncrackslomalkaorg'

distance = 151
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis adobeillustratorinterfaceimproverv20crackslomalkaorg'

distance = 151
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis freespacemonitorv25crackslomalkaorg'

distance = 151
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fsecureworkstationsuite43crackslomalkaorg'

distance = 152
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis freshdiagnosev10crackslomalkaorg'

distance = 152
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis autorunarchitectv21003crackslomalkaorg'

distance = 153
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis atguardv22crackslomalkaorg'

distance = 154
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis akaicdxtractv123crackslomalkaorg'

distance = 154
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis focusphotoeditorv3018crackslomalkaorg'

distance = 154
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis activepdfportfolioprofessional35crackslomalkaorg'

distance = 171
spam score = 13
title = 'r8 ramcleaner ramactive build ramturbo ramdis antivirusformicrosoftntserverv45094crackslomalkaorg'

distance = 171
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis accessmanagerv43crackslomalkaorg'

distance = 172
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis ancestralauthorv21fcrackslomalkaorg'

distance = 172
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis rguardv22974crackslomalkaorg'

distance = 172
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis arclabcleanerv20crackslomalkaorg'

distance = 173
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis pacbomber16crackslomalkaorg'

distance = 173
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis folderdogv12crackslomalkaorg'

distance = 173
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis antibosskeyv301crackslomalkaorg'

distance = 173
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis akeywordthingv10101keygencrackslomalkaorg'

distance = 173
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis acdmpowertoolsv1010007crackslomalkaorg'

distance = 186
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis glockeasymail20077crackslomalkaorg'

distance = 186
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis nagsawayv11crackslomalkaorg'

distance = 187
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis advancedtetric32crackslomalkaorg'

distance = 187
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis ashampoowinoptimizer2000v112crackcrackslomalkaorg'

distance = 188
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis airforcebigplanesscreensaver21crackslomalkaorg'

distance = 188
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis ppingtoolsv26crackslomalkaorg'

distance = 188
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis activexmanagerv14crackslomalkaorg'

distance = 188
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis anticrashv20crackslomalkaorg'

distance = 188
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis allwebmenusprov30498crackslomalkaorg'

distance = 188
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis acescreensaverv211crackslomalkaorg'

distance = 203
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fprotantivirusv312dbyfullmooncrackslomalkaorg'

distance = 203
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis finditv304regmakercrackslomalkaorg'

distance = 203
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis namodeepsearchv306basiccrackslomalkaorg'

distance = 203
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis qbeezcrackslomalkaorg'

distance = 203
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis atomtime98v21bypenguincrackslomalkaorg'

distance = 203
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis activexmanagerv13bycokecrackslomalkaorg'

distance = 204
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis antipopupv15crackslomalkaorg'

distance = 204
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis firstclassfollytairev90crackslomalkaorg'

distance = 204
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis windowsxpservicepack2activatorcrackbyhjcrackslomalkaorg'

distance = 204
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fileshredder27crackslomalkaorg'

distance = 218
spam score = 13
title = 'r8 ramcleaner ramactive build ramturbo ramdis arobfantasticmp3encoderv13bycorecrackslomalkaorg'

distance = 218
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis ashampoowinoptimizerplatinumsuitev113crackslomalkaorg'

distance = 219
spam score = 14
title = 'r8 ramcleaner ramactive build ramturbo ramdis activerefreshv136build551crackslomalkaorg'

distance = 220
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis fontsubstv141forpalmoscrackslomalkaorg'

distance = 220
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis glockeasymail20091crackslomalkaorg'

distance = 220
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis xdvdripperv1118crackslomalkaorg'

distance = 220
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis rstudio20crackslomalkaorg'

distance = 220
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis allegrosurfv6001crackslomalkaorg'

distance = 220
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis galacticcivilizationsiicrackslomalkaorg'

distance = 220
spam score = 10
title = 'r8 ramcleaner ramactive build ramturbo ramdis aiswatermarkpicturesprotectorv351crackslomalkaorg'

distance = 232
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis abfoutlookbackupv22061crackslomalkaorg'

distance = 232
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis arobfantasticmp3encoderv20crackslomalkaorg'

distance = 233
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis alienvspredator2crackslomalkaorg'

distance = 234
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis nelearningdrivingtheorytest20022003ukeditionv214gcrackslomalkaorg'

distance = 234
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis ecampaigncorporateeditionv4815crackslomalkaorg'

distance = 234
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis ucertifymicrosoftm70218prepkitv80005crackslomalkaorg'

distance = 235
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis hackmanhexeditorv705crackslomalkaorg'

distance = 235
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis animatedscreensaver22crackslomalkaorg'

distance = 235
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fabsoftreformenterprisev90012crackslomalkaorg'

distance = 236
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis nod32allversionscrackslomalkaorg'

distance = 249
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis abcpixv211crackslomalkaorg'

distance = 249
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis odbcexplorerv10byaaocgcrackslomalkaorg'

distance = 250
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis airysticketsv101bydfcrackslomalkaorg'

distance = 250
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis autosort13keygencrackslomalkaorg'

distance = 251
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fsecuresshserverv5238crackslomalkaorg'

distance = 251
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis asta25componentfordelphi5crackslomalkaorg'

distance = 252
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 252
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis activestatevisualpythonforvs2002v1812082crackslomalkaorg'

distance = 252
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis finalrecoveryv13crackslomalkaorg'

distance = 252
spam score = 13
title = 'r8 ramcleaner ramactive build ramturbo ramdis autoplaymenubuilderv32crackslomalkaorg'

distance = 275
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis finalassessmentsystemccna1v31withanswerscrackslomalkaorg'

distance = 276
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis namowebeditorsuitev602105trialgermancrackslomalkaorg'

distance = 276
spam score = 13
title = 'r8 ramcleaner ramactive build ramturbo ramdis activexmanagerv13bytntcrackslomalkaorg'

distance = 277
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fastmenuv105bydbccrackslomalkaorg'

distance = 277
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis namowebeditorv55crackslomalkaorg'

distance = 277
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis fsecureantivirusv55010260forcitrixserverscrackslomalkaorg'

distance = 278
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis aplusvideotoipodpsp3gpv318crackslomalkaorg'

distance = 279
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis actualdrawingv45bytsrhcrackslomalkaorg'

distance = 280
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis activeskinocxv43patchbydceptioncrackslomalkaorg'

distance = 280
spam score = 13
title = 'r8 ramcleaner ramactive build ramturbo ramdis actualtestscomcisco642541examcheatsheetv110403crackslomalkaorg'

distance = 361
spam score = 13
title = 'r8 ramcleaner ramactive build ramturbo ramdis windows2003andwindowsxpsp2antiproductactivationcrackv12fixedcrackslomalkaorg'

distance = 371
spam score = 12
title = 'r8 ramcleaner ramactive build ramturbo ramdis activeshopperaspcomponent10crackslomalkaorg'

distance = 392
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis uleadvideostudiov900100englishtbybtofullcrackbybidjancrackslomalkaorg'

distance = 394
spam score = 11
title = 'r8 ramcleaner ramactive build ramturbo ramdis acehighmp3wavwmaoggconverterv320byfffcrackslomalkaorg'

distance = 114
spam score = 11
title = ''

distance = 123
spam score = 11
title = ''

distance = 127
spam score = 11
title = ''

distance = 134
spam score = 11
title = ''

distance = 138
spam score = 11
title = ''

distance = 140
spam score = 11
title = ''

distance = 141
spam score = 11
title = ''

distance = 153
spam score = 11
title = ''

distance = 159
spam score = 11
title = ''

distance = 160
spam score = 11
title = ''

distance = 163
spam score = 11
title = ''

distance = 165
spam score = 11
title = ''

distance = 167
spam score = 11
title = ''

distance = 179
spam score = 11
title = ''

distance = 179
spam score = 11
title = ''

distance = 185
spam score = 11
title = ''

distance = 186
spam score = 11
title = ''

distance = 186
spam score = 11
title = ''

distance = 188
spam score = 11
title = ''

distance = 188
spam score = 12
title = ''

distance = 191
spam score = 12
title = ''

distance = 194
spam score = 10
title = ''

distance = 194
spam score = 11
title = ''

distance = 204
spam score = 11
title = ''

distance = 206
spam score = 11
title = ''

distance = 207
spam score = 11
title = ''

distance = 210
spam score = 12
title = ''

distance = 212
spam score = 11
title = ''

distance = 214
spam score = 11
title = ''

distance = 228
spam score = 11
title = ''

distance = 237
spam score = 12
title = ''

distance = 241
spam score = 11
title = ''

distance = 244
spam score = 12
title = ''

distance = 246
spam score = 11
title = ''

distance = 247
spam score = 11
title = ''

distance = 251
spam score = 11
title = ''

distance = 253
spam score = 12
title = ''

distance = 255
spam score = 10
title = ''

distance = 255
spam score = 12
title = ''

distance = 289
spam score = 11
title = ''

distance = 295
spam score = 12
title = ''

distance = 295
spam score = 11
title = ''

distance = 301
spam score = 11
title = ''

distance = 349
spam score = 10
title = ''

distance = 25
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk ecampaignv2961crackslomalkaorg'

distance = 43
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk animatedformv100ccrackslomalkaorg'

distance = 51
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk akeywordthingv10101crackslomalkaorg'

distance = 66
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk folderlockv5crackslomalkaorg'

distance = 67
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk arealvalidatorv111keygencrackslomalkaorg'

distance = 67
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk eiconsv3xcrackslomalkaorg'

distance = 68
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk allmailv10newcrackslomalkaorg'

distance = 69
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk emailsv220crackslomalkaorg'

distance = 73
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk farv360592crackslomalkaorg'

distance = 77
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk eborderclient211crackslomalkaorg'

distance = 80
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk f22raptor1000510crackslomalkaorg'

distance = 80
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk ecampaignv295crackslomalkaorg'

distance = 80
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk rstudioagentv20crackslomalkaorg'

distance = 84
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk filesecurerv341crackslomalkaorg'

distance = 84
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk adayinthelifev151serialcrackslomalkaorg'

distance = 84
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk adayatthebeachslots11crackslomalkaorg'

distance = 85
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk addingmachinecrackslomalkaorg'

distance = 86
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk filerenamerv10crackslomalkaorg'

distance = 86
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk autopurge2000v322crackslomalkaorg'

distance = 87
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk amusicalgeneratorv20288crackslomalkaorg'

distance = 150
spam score = 6
title = 'a14 builder abilities abf v66 ability abfallk activerefreshv134build531crackslomalkaorg'

distance = 150
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk accessmanagerforwindows30crackslomalkaorg'

distance = 150
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk posterv7605242002crackslomalkaorg'

distance = 151
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk advancedcallcenterv410600crackcrackslomalkaorg'

distance = 152
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk fileutilities97frenchcrackslomalkaorg'

distance = 152
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk autocapturev17crackslomalkaorg'

distance = 152
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk agentransackv17crackslomalkaorg'

distance = 152
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk findyourmp3v102035byevidencecrackslomalkaorg'

distance = 153
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk amethystshadowfx16crackslomalkaorg'

distance = 153
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk foratomicsynchronizationv11000serialcrackslomalkaorg'

distance = 171
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk powerarchiver2001v70208newcrackslomalkaorg'

distance = 171
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activeskinocxv425crackslomalkaorg'

distance = 172
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk acemacropro21crackslomalkaorg'

distance = 172
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk gaebgetterprofessionalv29germancrackslomalkaorg'

distance = 172
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk filespy100bytntcrackslomalkaorg'

distance = 172
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk apluscalcv11crackslomalkaorg'

distance = 173
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk accesspasswordrecoveryhelperv160crackslomalkaorg'

distance = 173
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk absolutepatiencev41crackslomalkaorg'

distance = 173
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk alotnannyv10keygencrackslomalkaorg'

distance = 173
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk namov310crackslomalkaorg'

distance = 184
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk airmessengerprov406bylaxitycrackslomalkaorg'

distance = 184
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk p2cpluspascalcompiler2006ecrackslomalkaorg'

distance = 184
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk facemailv10bytsrhcrackslomalkaorg'

distance = 184
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activestateperldevkitv411crackslomalkaorg'

distance = 184
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk fairstarsrecorderv251byrevengecrackslomalkaorg'

distance = 185
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk airgun72crackslomalkaorg'

distance = 185
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk fairstarsmp3recorderv102bysndcrackslomalkaorg'

distance = 185
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activeskinv43crackslomalkaorg'

distance = 185
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk qcopy2000beta5build250crackslomalkaorg'

distance = 185
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk fileshredder2000v33byimscrackslomalkaorg'

distance = 200
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk advancedvideopokerv111crackslomalkaorg'

distance = 200
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk adobeincopyv20byssgcrackslomalkaorg'

distance = 200
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk emailhooverv154bytsrhcrackslomalkaorg'

distance = 201
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk adobeimagereadyv10bypanteracrackslomalkaorg'

distance = 201
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activeshopperaspcomponent10crackslomalkaorg'

distance = 201
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk alphascubalogv31112crackslomalkaorg'

distance = 202
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk powervideoconverterv138bycafecrackslomalkaorg'

distance = 202
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk aplusfileprotectionv27crackslomalkaorg'

distance = 203
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activeskincontrolocxv20crackslomalkaorg'

distance = 203
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk fprotantivirusforwindowsv308bfixedcrackslomalkaorg'

distance = 216
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk accesslockv151bytsrhcrackslomalkaorg'

distance = 216
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk albumwebprov22build678crackslomalkaorg'

distance = 217
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk flashfxpv143build835byeaglecrackslomalkaorg'

distance = 217
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activepagerv10crackslomalkaorg'

distance = 217
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk arealvalidatorv111byamokcrackslomalkaorg'

distance = 217
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk emailalertv10110bystreamcrackslomalkaorg'

distance = 217
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activeskincontrolv43crackslomalkaorg'

distance = 217
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk a1dvdripperprofessionalv1102byarteamcrackslomalkaorg'

distance = 217
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk archicadv65r1fullcrackslomalkaorg'

distance = 217
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk attributemagicprov21beta5crackslomalkaorg'

distance = 235
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk aliaswavefrontstudiotoolsv100crackslomalkaorg'

distance = 235
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk glockadvancedadministrativetools400624crackslomalkaorg'

distance = 236
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk ajdcomputingmortgagemanagerv11crackslomalkaorg'

distance = 236
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk alltotrayv33crackslomalkaorg'

distance = 237
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk ppingtoolsv20crackslomalkaorg'

distance = 237
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activexmanagerv14byamokcrackslomalkaorg'

distance = 237
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk puzzlebrainstormcrackslomalkaorg'

distance = 238
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk alarmclockv10crackslomalkaorg'

distance = 238
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk flashgetv095byfhcfcrackslomalkaorg'

distance = 238
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk aspasapv20crackslomalkaorg'

distance = 256
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk emailextractorexpressv21byevidencecrackslomalkaorg'

distance = 256
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk windowsxpsp2activationcrackbyffgcrackslomalkaorg'

distance = 257
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk fsecuresshserverv5238crackslomalkaorg'

distance = 257
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk aimatsiteietoolbarv30crackslomalkaorg'

distance = 257
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk algolabrastertovectorconversiontoolkitv261crackslomalkaorg'

distance = 257
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activefilerecoveryv20byheritagecrackslomalkaorg'

distance = 259
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk addremove4goodv20byeminencecrackslomalkaorg'

distance = 259
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk windows2003andwindowsxpsp2antiproductactivationcrackv12crackslomalkaorg'

distance = 260
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk autotask2000v241byorioncrackslomalkaorg'

distance = 260
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk actualtestscomcisco642413examcheatsheetv50404crackslomalkaorg'

distance = 279
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk powerdefragpro200bytntcrackslomalkaorg'

distance = 279
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk emailfactoryv12bytsrhcrackslomalkaorg'

distance = 280
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk polyphonicwizardv20fixedcrackslomalkaorg'

distance = 280
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk aelitatimeadminv2xcrackslomalkaorg'

distance = 282
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk fsecuresshclientv51crackslomalkaorg'

distance = 283
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk activefaxv385build0192crackslomalkaorg'

distance = 283
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activemp3controlforwin32v20crackslomalkaorg'

distance = 283
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk animallogicmaxman13andabovefor3dstudiomaxcrackslomalkaorg'

distance = 284
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk purchaseorderv11byimscrackslomalkaorg'

distance = 285
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk namowebeditor60suitefrenchcrackslomalkaorg'

distance = 358
spam score = 15
title = 'u15 ultralingua english french ultraiso v340 abilitiesbuilderdividewholenumbersv66crackslomalkaorg'

distance = 383
spam score = 5
title = 'a14 builder abilities abf v66 ability abfallk activeskincontrolocxv40byadhamdahabcrackslomalkaorg'

distance = 385
spam score = 4
title = 'a14 builder abilities abf v66 ability abfallk acunetixwebvulerabilityscannerv40consultanteditioncrackslomalkaorg'

distance = 412
spam score = 8
title = 'b44 bubble budget buddyphone for bubblelines b abilitiesbuildermultiplywholenumbersv66crackslomalkaorg'

distance = 34
spam score = 15
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp emailsv222crackslomalkaorg'

distance = 49
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp objectbarv15crackslomalkaorg'

distance = 49
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp activeskinv352crackslomalkaorg'

distance = 50
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp administratorv42crackslomalkaorg'

distance = 58
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp epop203123crackslomalkaorg'

distance = 59
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp tfix307doscrackslomalkaorg'

distance = 62
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp emailsv210crackslomalkaorg'

distance = 68
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp eiconsv3xcrackslomalkaorg'

distance = 68
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp adressenverwaltungv30ccrackslomalkaorg'

distance = 72
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp frigatev322272crackslomalkaorg'

distance = 74
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp aptschedulerv118crackslomalkaorg'

distance = 75
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp allseeingeyev21crackslomalkaorg'

distance = 76
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp fordstreetracing3crackslomalkaorg'

distance = 83
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp atlantisv1514crackslomalkaorg'

distance = 85
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp amusicalgeneratorv20288crackslomalkaorg'

distance = 86
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp nod32allversionsfixedcrackslomalkaorg'

distance = 87
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp filepulverizer5crackslomalkaorg'

distance = 88
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp almanacv300crackslomalkaorg'

distance = 90
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp alphatrisv310crackslomalkaorg'

distance = 90
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp filestoexev10betacrackslomalkaorg'

distance = 146
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp protectx402crackslomalkaorg'

distance = 147
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp activewhoisv202466crackslomalkaorg'

distance = 147
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp fcutterv160keygencrackslomalkaorg'

distance = 147
spam score = 15
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp adobegolivev50trialcrackslomalkaorg'

distance = 147
spam score = 15
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp adronv101crackslomalkaorg'

distance = 147
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp vampv1400bypccrackslomalkaorg'

distance = 148
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp activebarv25crackslomalkaorg'

distance = 148
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp emailhunterv120crackslomalkaorg'

distance = 148
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp purgatioprov20acrackslomalkaorg'

distance = 149
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp ubsellerv213crackslomalkaorg'

distance = 167
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp observeranddistributedobserver62acrackslomalkaorg'

distance = 168
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp anfibiawatchmanv47crackslomalkaorg'

distance = 168
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp gabrielv19crackslomalkaorg'

distance = 168
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp advantixcalculatorv20crackslomalkaorg'

distance = 168
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp ventafaxv50crackslomalkaorg'

distance = 169
spam score = 12
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp powervideoconverterv138crackslomalkaorg'

distance = 169
spam score = 12
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp posterdownloadercrackslomalkaorg'

distance = 169
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp adayinthelifev15crackcrackslomalkaorg'

distance = 169
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp activestatevisualxsltforvs2003v1812494crackslomalkaorg'

distance = 169
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp asposepowerpointv126crackslomalkaorg'

distance = 185
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp oandkprintwatchv240crackslomalkaorg'

distance = 185
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp rmail11build9605crackslomalkaorg'

distance = 185
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp aprspreadcalculatorv1000bypccrackslomalkaorg'

distance = 185
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp windowsxpkeygennewcrackslomalkaorg'

distance = 186
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp animatedscreenv223crackslomalkaorg'

distance = 186
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp puremotiondvconverterv10crackslomalkaorg'

distance = 186
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp fprotantivirusforwindowsv310crackslomalkaorg'

distance = 186
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp aspackv211crackcrackslomalkaorg'

distance = 187
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp aemailspamfilterv20crackslomalkaorg'

distance = 187
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp appletnavigationfactoryv20byc4acrackslomalkaorg'

distance = 202
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp appleteffectsfactoryv20byraccrackslomalkaorg'

distance = 202
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp gallacticbattlegroundscrackslomalkaorg'

distance = 202
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp nortoninternetsecurity2005crackslomalkaorg'

distance = 202
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp ubwdreamcatcherv710crackslomalkaorg'

distance = 202
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp fastsubmitv421crackslomalkaorg'

distance = 203
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp pcad2002trialbuild170050crackslomalkaorg'

distance = 203
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp argosoftftpserverv1208crackslomalkaorg'

distance = 203
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp animatedscreenv61crackbyevccrackslomalkaorg'

distance = 203
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp emailextractorexpressv21bydbccrackslomalkaorg'

distance = 203
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp a1quicktrayv20byciacrackslomalkaorg'

distance = 218
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp rwipeandcleanv511169crackslomalkaorg'

distance = 218
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp antiviraltoolkitproavp30build129crackslomalkaorg'

distance = 218
spam score = 15
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp absolutesecurityprov40crackslomalkaorg'

distance = 219
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp namescannerv14crackslomalkaorg'

distance = 219
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp poweraudiotoolsv362fixedcrackslomalkaorg'

distance = 219
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp tableditv233acrackslomalkaorg'

distance = 219
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp advancedpopupkiller2002v21bylashcrackslomalkaorg'

distance = 219
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp arobfantasticmp3networkedencoderv14bymanifestcrackslomalkaorg'

distance = 219
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp abetonefirmendatenbankserienbriefprov721crackslomalkaorg'

distance = 219
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp filestoragev26forbcb4crackslomalkaorg'

distance = 234
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp alawarmysteriesofhorusv101crackslomalkaorg'

distance = 234
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp emailviaphone11byamokcrackslomalkaorg'

distance = 235
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp ubonicsoftwarepwassistantv10crackslomalkaorg'

distance = 235
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp aaaftpeasyv40bydbccrackslomalkaorg'

distance = 235
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp arcsoftmultimediaemailv3crackslomalkaorg'

distance = 235
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp glockspamcombatv265650crackslomalkaorg'

distance = 235
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp acdexpressv315servercrackslomalkaorg'

distance = 235
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp aheadneroburningromultraeditionv6600crackslomalkaorg'

distance = 235
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp activeprofile12crackslomalkaorg'

distance = 236
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp activeskinv421byfyscrackerscrackslomalkaorg'

distance = 255
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp emailextractorexpressv20byevccrackslomalkaorg'

distance = 255
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp faxmachinev401byagaincrackslomalkaorg'

distance = 255
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp fritzefisch265crackslomalkaorg'

distance = 255
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp aplusvideoconverterv518crackslomalkaorg'

distance = 255
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp argosoftmailserverprowithimapv1862crackslomalkaorg'

distance = 256
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp advancedspamgeneratorasgv111crackslomalkaorg'

distance = 256
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp windowsxpservicepack2activatorcrackslomalkaorg'

distance = 256
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp namov55regfilebyneocoderzcrackslomalkaorg'

distance = 257
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp fontviewer10crackslomalkaorg'

distance = 257
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp emailextractorexpressv20byfhcfcrackslomalkaorg'

distance = 286
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp akalaexelockv300byfffcrackslomalkaorg'

distance = 286
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp windowsxpservicepack2keygenandpathcrackslomalkaorg'

distance = 286
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp gadwinsystemsdiagramstudiov3602405crackslomalkaorg'

distance = 287
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp acdfotoslatev11patchbybidjancrackslomalkaorg'

distance = 288
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp pcad2001fulltrialfixedv2crackslomalkaorg'

distance = 288
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp activestateperldevkitv411crackslomalkaorg'

distance = 288
spam score = 13
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp powerarchiver2004v90033july2004crackslomalkaorg'

distance = 289
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp powerarchiver2002v80053rc3crackslomalkaorg'

distance = 289
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp ardexussalescyclemanagerwindowseditionv210crackslomalkaorg'

distance = 289
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp picsgebhrenzhlerv5201crackslomalkaorg'

distance = 425
spam score = 14
title = 'x12 xml xnview xp xnote tools stopwatch xoftsp windows2003andwindowsxpsp2antiproductactivationcrackv12fixedcrackslomalkaorg'

distance = 37
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess amusicalgeneratorv200288crackslomalkaorg'

distance = 48
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess alittlevietnamesev12crackslomalkaorg'

distance = 55
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess fate101crackslomalkaorg'

distance = 59
spam score = 9
title = 't51 trellian treepad ftp plus treesize profess akeywordthingv10101keygencrackslomalkaorg'

distance = 63
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess adayinthelifev15crackcrackslomalkaorg'

distance = 63
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess emailtalkerv330crackslomalkaorg'

distance = 63
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess activepenv10713crackslomalkaorg'

distance = 63
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess autosizev230crackslomalkaorg'

distance = 64
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess frigatev129crackslomalkaorg'

distance = 68
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess aresv52crackslomalkaorg'

distance = 70
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess xdvdripperv1150crackslomalkaorg'

distance = 70
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess ecampaignv297crackslomalkaorg'

distance = 71
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess formpalv504crackslomalkaorg'

distance = 78
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess activetodolistv11crackslomalkaorg'

distance = 79
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess bjigsawv76crackslomalkaorg'

distance = 80
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess editorv30bymp2kcrackslomalkaorg'

distance = 86
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess f12001keygencrackslomalkaorg'

distance = 88
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess emanagerv35b08crackslomalkaorg'

distance = 90
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess facefilterstandardv10crackslomalkaorg'

distance = 92
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess rdriveimage10build1013crackslomalkaorg'

distance = 155
spam score = 12
title = 't51 trellian treepad ftp plus treesize profess objectstudioenterprise65080crackslomalkaorg'

distance = 155
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess agendamsdv410spanishcrackslomalkaorg'

distance = 155
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess halflifev1010crackslomalkaorg'

distance = 156
spam score = 9
title = 't51 trellian treepad ftp plus treesize profess advancedvideopokerv12crackslomalkaorg'

distance = 156
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess fineimageviewerv20crackslomalkaorg'

distance = 156
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess adcsv108crackbyrp2kcrackslomalkaorg'

distance = 156
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess octagon10keygenbyevidencecrackslomalkaorg'

distance = 156
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess autositepasswordsv12crackslomalkaorg'

distance = 156
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess g6ftpserverallversionscrackslomalkaorg'

distance = 156
spam score = 9
title = 't51 trellian treepad ftp plus treesize profess attendancecontroller6024crackslomalkaorg'

distance = 170
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess gaeawinsievev112crackslomalkaorg'

distance = 170
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess admuncherv441build3866crackslomalkaorg'

distance = 170
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess activefilerecoveryv50crackslomalkaorg'

distance = 170
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess animatedformeffect10fordelphi4crackslomalkaorg'

distance = 170
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess automaintenanceprov80keygenbyevccrackslomalkaorg'

distance = 170
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess purgem2000v200crackslomalkaorg'

distance = 171
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess emageforwebv12134crackslomalkaorg'

distance = 171
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess activexmanagerv13byamokcrackslomalkaorg'

distance = 171
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess fastsfvv11crackslomalkaorg'

distance = 171
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess ecampaigncorporateeditionv2961crackslomalkaorg'

distance = 186
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess p3shortcutsv10crackslomalkaorg'

distance = 186
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess finddoublefilesv10crackslomalkaorg'

distance = 187
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess advancedmp3wmarecorderv375crackslomalkaorg'

distance = 187
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess purgeieprov15062crackslomalkaorg'

distance = 187
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess achessexpertprofessionaleditionv371crackslomalkaorg'

distance = 187
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess avimpegasfwmvsplitterv231crackslomalkaorg'

distance = 187
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess allwebmenusv30build492crackslomalkaorg'

distance = 187
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess arobfantasticmp3encoderv14crackslomalkaorg'

distance = 188
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess activemessenger105crackslomalkaorg'

distance = 188
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess pacbomber16crackslomalkaorg'

distance = 201
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess emailextractorexpressv21byorioncrackslomalkaorg'

distance = 201
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess nerodvdvideoplugincrackslomalkaorg'

distance = 201
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess powereditv212crackslomalkaorg'

distance = 202
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess ecampaignv30crackslomalkaorg'

distance = 203
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess activefaxserverv381191bylaxitycrackslomalkaorg'

distance = 203
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess antibosskeyv382crackslomalkaorg'

distance = 203
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess acehtmlprov5021crackslomalkaorg'

distance = 203
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess fileshredder2000v30bytcacrackslomalkaorg'

distance = 203
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess accessanimationv100bylashcrackslomalkaorg'

distance = 203
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess ancestralauthorv20dcrackslomalkaorg'

distance = 215
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess tadvstringgridv2850fordelphiv7crackslomalkaorg'

distance = 216
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess animatedscreenv310serialbypccrackslomalkaorg'

distance = 216
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess avigifv107crackslomalkaorg'

distance = 216
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess activewhoisbrowserv202466crackslomalkaorg'

distance = 216
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess fprotantivirusv312dbytsmacrackslomalkaorg'

distance = 216
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess fprotantivirusv312cbyfreeze1crackslomalkaorg'

distance = 217
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess activeskincontrolocxv20crackslomalkaorg'

distance = 217
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess antihackerandtrojanexpert2003v16crackslomalkaorg'

distance = 218
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess autorundesignspecialityv5006crackslomalkaorg'

distance = 218
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess flashconverter216bytntcrackslomalkaorg'

distance = 235
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess a1worldexchangecalculatorv212crackslomalkaorg'

distance = 235
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess glockemailprocessorv198750crackslomalkaorg'

distance = 235
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess filesplitprov10bydbccrackslomalkaorg'

distance = 236
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess arobfantasticmp3encoderv20crackslomalkaorg'

distance = 236
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess absolutepitchv215crackslomalkaorg'

distance = 236
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess acqurlv70crackslomalkaorg'

distance = 236
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess namodeepsearchv306basiccrackslomalkaorg'

distance = 237
spam score = 9
title = 't51 trellian treepad ftp plus treesize profess kasperskyantiviruspersonalv50227keygenfilecrackslomalkaorg'

distance = 238
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess emailextractorv21build05011bytntcrackslomalkaorg'

distance = 238
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess windowsxpservicepack2keygenandpathcrackslomalkaorg'

distance = 257
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess arenawarsallaccesscheatbytntcrackslomalkaorg'

distance = 257
spam score = 12
title = 't51 trellian treepad ftp plus treesize profess activerefreshv134build531crackslomalkaorg'

distance = 257
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess arealvalidatorv111byamokcrackslomalkaorg'

distance = 257
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess powerarchiver2003v86002crackslomalkaorg'

distance = 257
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess ativanetmeterv403crackslomalkaorg'

distance = 258
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess abcvideorollv25build72crackslomalkaorg'

distance = 258
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess admuncherv441build1533crackslomalkaorg'

distance = 258
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess flashfxpv30build1015bytokeinatorwreckcrackslomalkaorg'

distance = 258
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess alawartrafficjamextremev10allaccesscheatcrackslomalkaorg'

distance = 259
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess apollodatabaseserver52crackslomalkaorg'

distance = 289
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess activefaxserverv387build194crackslomalkaorg'

distance = 289
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess avimpegrmjoinerv2401crackslomalkaorg'

distance = 289
spam score = 9
title = 't51 trellian treepad ftp plus treesize profess fastreamnetfileserverv624653crackslomalkaorg'

distance = 290
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess autorunassistantv25byrastafreecrackslomalkaorg'

distance = 290
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess ashampoowinoptimizerplatinumsuitev100byucfcrackslomalkaorg'

distance = 290
spam score = 11
title = 't51 trellian treepad ftp plus treesize profess autoplaymenubuilderv41737crackslomalkaorg'

distance = 291
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess powerarchiver2002v80570finalcrackslomalkaorg'

distance = 291
spam score = 9
title = 't51 trellian treepad ftp plus treesize profess flamingpearflexifyphotoshoppluginv14crackslomalkaorg'

distance = 291
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess pacestaredgediagrammerv4191790crackslomalkaorg'

distance = 291
spam score = 10
title = 't51 trellian treepad ftp plus treesize profess pacdoomiiihalloweenpartyv30plus7trainercrackslomalkaorg'

distance = 36
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven h3d10crackslomalkaorg'

distance = 42
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven g6renamer2000v14crackcrackslomalkaorg'

distance = 57
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven aliasirunv34crackslomalkaorg'

distance = 57
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven activewhoisv212587crackslomalkaorg'

distance = 58
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven adressen2001081411crackslomalkaorg'

distance = 70
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven eiconsv325crackslomalkaorg'

distance = 73
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fx2000v30crackslomalkaorg'

distance = 74
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fcutterv152crackslomalkaorg'

distance = 75
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven absolutesoundrecorderv329crackslomalkaorg'

distance = 75
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven filesecurerv340crackslomalkaorg'

distance = 77
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven adventurerv10javacrackslomalkaorg'

distance = 78
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven halflifev1100crackslomalkaorg'

distance = 78
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven ob6000crackslomalkaorg'

distance = 79
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven arenawarsv121crackslomalkaorg'

distance = 79
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven eformez175crackslomalkaorg'

distance = 79
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven arkanoid2000v16crackslomalkaorg'

distance = 81
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven accessdeniedv210crackslomalkaorg'

distance = 82
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fprotv312acrackslomalkaorg'

distance = 84
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven aktienprofiv104crackslomalkaorg'

distance = 84
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven nrecv12crackslomalkaorg'

distance = 150
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven babylonpro5crackslomalkaorg'

distance = 151
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven ebook12crackslomalkaorg'

distance = 152
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven amiquotev165crackslomalkaorg'

distance = 152
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven alteredperceptionsv12crackslomalkaorg'

distance = 153
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven activepagerv10crackslomalkaorg'

distance = 153
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fabfilteronev201crackslomalkaorg'

distance = 153
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven activepdfportfolioprofessional35crackslomalkaorg'

distance = 154
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fatmon3101crackslomalkaorg'

distance = 154
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven ventafaxv50crackslomalkaorg'

distance = 154
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven accusplitv303crackslomalkaorg'

distance = 173
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven actualdrawingv51byicicrackslomalkaorg'

distance = 173
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven amigo2000v11crackslomalkaorg'

distance = 173
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fabioliveatbbcradio1crackslomalkaorg'

distance = 173
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven ntrackstudiov33crackslomalkaorg'

distance = 173
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven audiospherev257crackslomalkaorg'

distance = 174
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fastmenuv104byrp2kcrackslomalkaorg'

distance = 174
spam score = 3
title = 's51 sockscap build snowy v10 sockschain adven ecardxpress10crackslomalkaorg'

distance = 174
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven galaxyunfurledv103crackslomalkaorg'

distance = 175
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven firehandlightningv194crackslomalkaorg'

distance = 175
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven akoffmusiccomposerv20serialbywktcrackslomalkaorg'

distance = 190
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fcutterv160keygencrackslomalkaorg'

distance = 190
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven adcsv105byeclipsecrackslomalkaorg'

distance = 190
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven acdexpressv351crackslomalkaorg'

distance = 191
spam score = 3
title = 's51 sockscap build snowy v10 sockschain adven aplusfileprotectionv21crackslomalkaorg'

distance = 191
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven p2cpluscompilerv218ecrackslomalkaorg'

distance = 191
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven pacboyv10crackslomalkaorg'

distance = 191
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven uanimatorv10keygencrackslomalkaorg'

distance = 191
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fastmenuv107crackslomalkaorg'

distance = 192
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven activefaxserverv388build195germancrackslomalkaorg'

distance = 192
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven abcdeev25crackslomalkaorg'

distance = 206
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven activexmanagerv13bypccrackslomalkaorg'

distance = 206
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fsecureantivirusv4051291polishcrackslomalkaorg'

distance = 206
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven audioslimmerv1191bylashcrackslomalkaorg'

distance = 206
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven arealvalidatorv111crackslomalkaorg'

distance = 207
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven advancedcataloguerv24build66crackslomalkaorg'

distance = 207
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven absolutedatabasev474fordelphiv4567andbcbv456crackslomalkaorg'

distance = 207
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven activeskincontrolocxv40crackslomalkaorg'

distance = 207
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven p2cpluscompilerv214ecrackslomalkaorg'

distance = 207
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven arealvalidatorv111byamokcrackslomalkaorg'

distance = 208
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven arobfantasticmp3networkedencoderv14bycovecrackslomalkaorg'

distance = 223
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven emailsv226frenchcrackslomalkaorg'

distance = 223
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven activefaxserverv388build195crackslomalkaorg'

distance = 223
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven activeskinv423crackslomalkaorg'

distance = 223
spam score = 3
title = 's51 sockscap build snowy v10 sockschain adven fireburnerv106bytmgcrackslomalkaorg'

distance = 223
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven filesplitter2000v210crackslomalkaorg'

distance = 224
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fsecureantivirusv407crackslomalkaorg'

distance = 224
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven ppingtools20acrackslomalkaorg'

distance = 224
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven p2cpluspascalcompilerversion121ecrackslomalkaorg'

distance = 224
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven ashampoo99deluxev102crackslomalkaorg'

distance = 224
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fxeditv32byucucrackslomalkaorg'

distance = 239
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven pacdoomdangerousadventuresv121byamokcrackslomalkaorg'

distance = 239
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven pcad2002trialbuild170050crackslomalkaorg'

distance = 239
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven p2cpascalcompiler1236ecrackslomalkaorg'

distance = 239
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven alivemp3converterv1822crackslomalkaorg'

distance = 239
spam score = 3
title = 's51 sockscap build snowy v10 sockschain adven alarmnotesv20crackslomalkaorg'

distance = 240
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven aistmoviepackv30build4975crackslomalkaorg'

distance = 240
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fishglobev104forpalmoscrackslomalkaorg'

distance = 240
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven halworks2314crackslomalkaorg'

distance = 241
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven atrisehtmlockv161crackslomalkaorg'

distance = 241
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven apollompegtodvdburnerv31crackslomalkaorg'

distance = 255
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven familyphotobuddyserverv1003crackslomalkaorg'

distance = 255
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven totalcommanderv653regfilebytwtcrackslomalkaorg'

distance = 256
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven atrildejavu23crackslomalkaorg'

distance = 256
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven addremoveplus2002v310201crackslomalkaorg'

distance = 256
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven windows2003andxpantiproductactivationcrackv162crackslomalkaorg'

distance = 256
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven actualdrawingv51byrp2kcrackslomalkaorg'

distance = 257
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven acqurlv54crackslomalkaorg'

distance = 257
spam score = 3
title = 's51 sockscap build snowy v10 sockschain adven favovideoconverterv50byrevengecrackslomalkaorg'

distance = 258
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven akoffguitarassistantv101serialbyaircrackslomalkaorg'

distance = 258
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven avizthoughtmapperv11crackslomalkaorg'

distance = 286
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven aimingclickv300132crackslomalkaorg'

distance = 286
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven editorebookcompilerv30crackslomalkaorg'

distance = 286
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven fsecuresshclientv5323crackslomalkaorg'

distance = 286
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven alawarbacktoearthv11byexplosioncrackslomalkaorg'

distance = 287
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven activestatetcldevkitv261crackslomalkaorg'

distance = 287
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven aheadneroburningromultraeditionv63xxcrackslomalkaorg'

distance = 287
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven powerarchiver2004v90024crackslomalkaorg'

distance = 287
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven accentofficepasswordrecovery101byamokcrackslomalkaorg'

distance = 288
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven aplusscreensavercreatorv34crackslomalkaorg'

distance = 288
spam score = 4
title = 's51 sockscap build snowy v10 sockschain adven alienseedscanmail114crackslomalkaorg'

distance = 38
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev qrecovery98v20crackslomalkaorg'

distance = 41
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev fcutterv15crackslomalkaorg'

distance = 44
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev ecampaignv2961crackslomalkaorg'

distance = 45
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev advent2000v103crackslomalkaorg'

distance = 51
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev ascv30crackslomalkaorg'

distance = 54
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev filov17crackslomalkaorg'

distance = 61
spam score = 9
title = 'b24 blackboard black filewipe biuticker imagev ebusinessappletv410crackslomalkaorg'

distance = 63
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev qheal5216crackslomalkaorg'

distance = 66
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev acedesignpro13crackslomalkaorg'

distance = 66
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev accusplitv36crackslomalkaorg'

distance = 70
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev faxamaticvv96514crackslomalkaorg'

distance = 76
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev hackerv11crackslomalkaorg'

distance = 81
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev epop203123crackslomalkaorg'

distance = 82
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev editorv30build1090crackslomalkaorg'

distance = 84
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev fcutterv160serialcrackslomalkaorg'

distance = 84
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev folderindexerv146crackslomalkaorg'

distance = 84
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev alleditor242crackslomalkaorg'

distance = 87
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev galav100crackslomalkaorg'

distance = 88
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev g6utilitiesv162build1crackslomalkaorg'

distance = 88
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev alteros3d23build2302keygencrackslomalkaorg'

distance = 155
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev aprs251crackslomalkaorg'

distance = 155
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev achristmasatsantasv29byfffcrackslomalkaorg'

distance = 155
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev favoripper30crackslomalkaorg'

distance = 155
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev attributemagicprov223crackslomalkaorg'

distance = 155
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev alphabetattack3crackslomalkaorg'

distance = 155
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev alittlevietnamesev12crackslomalkaorg'

distance = 156
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev freshdownloadv560crackslomalkaorg'

distance = 156
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev privatedesktopv191crackslomalkaorg'

distance = 156
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev awiconsprov920byunknowncrackslomalkaorg'

distance = 156
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev babynamesv101crackslomalkaorg'

distance = 174
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev aideonlinometerv17crackslomalkaorg'

distance = 174
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev puntotekv15goldcrackslomalkaorg'

distance = 174
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev aplusfileprotectionv21crackslomalkaorg'

distance = 175
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev windowsxp4in1keygenandchangeinfocrackslomalkaorg'

distance = 175
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev ghackerv20crackslomalkaorg'

distance = 175
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev activeskinv423crackslomalkaorg'

distance = 176
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev purgatioprov50acrackslomalkaorg'

distance = 176
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev namebase30crackslomalkaorg'

distance = 176
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev adrbookv57crackslomalkaorg'

distance = 176
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev emageforwebv12134crackslomalkaorg'

distance = 189
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev animatedscreenv61serialbytcacrackslomalkaorg'

distance = 189
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev fatmanadventuresv103byeclipsecrackslomalkaorg'

distance = 189
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev atviewfor8100switches60crackslomalkaorg'

distance = 189
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev activeprofile12crackslomalkaorg'

distance = 189
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev fireburnerv217crackslomalkaorg'

distance = 190
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev arealvalidatorv111keygencrackslomalkaorg'

distance = 190
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev hackmanhexeditorv704crackslomalkaorg'

distance = 191
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev editorv30crackslomalkaorg'

distance = 191
spam score = 9
title = 'b24 blackboard black filewipe biuticker imagev favovideoconverterv50byrevengecrackslomalkaorg'

distance = 191
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev asthmaassistant13crackslomalkaorg'

distance = 206
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev advanceduninstallerpro2003v6crackslomalkaorg'

distance = 206
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev finditv303crackslomalkaorg'

distance = 206
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev xfilesscreensaverscrackslomalkaorg'

distance = 206
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev powerarchiver2003v88004crackslomalkaorg'

distance = 207
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev activetaskv10crackslomalkaorg'

distance = 207
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev posterv7605242002crackslomalkaorg'

distance = 207
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev emailalertv10110bystreamcrackslomalkaorg'

distance = 207
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev amiracleinathoughtscreenflashscreensavercrackslomalkaorg'

distance = 207
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev privacyfencev30crackslomalkaorg'

distance = 207
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev finditnowv30byskywalkercrackslomalkaorg'

distance = 219
spam score = 12
title = 'b24 blackboard black filewipe biuticker imagev auscompenavigatorsuite2000v69crackslomalkaorg'

distance = 219
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev filescavengerv140bcrackslomalkaorg'

distance = 219
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev alphatastv14acrackslomalkaorg'

distance = 220
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev airmessengerlanserverv20crackslomalkaorg'

distance = 220
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev atriseeveryfindv481crackslomalkaorg'

distance = 220
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev antennawebdesignstudiov270130crackslomalkaorg'

distance = 220
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev powerwebsitebuilderv150crackslomalkaorg'

distance = 220
spam score = 13
title = 'b24 blackboard black filewipe biuticker imagev activerefreshv136build551bytsrhcrackslomalkaorg'

distance = 221
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev aktienprofiv242crackslomalkaorg'

distance = 221
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev protocolinspector21build0101crackslomalkaorg'

distance = 234
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev acecatv151crackslomalkaorg'

distance = 234
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev activestatetclprov1502crackslomalkaorg'

distance = 234
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev advancedrarenamerv12bytntcrackslomalkaorg'

distance = 234
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev addremoveplus2002v311223bymp2kcrackslomalkaorg'

distance = 235
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev audiotoolsv40crackslomalkaorg'

distance = 235
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev powerarchiverv80058v80063crackslomalkaorg'

distance = 235
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev powerarchiver2001v702newcrackslomalkaorg'

distance = 236
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev powerarchiver2001v70208bydesperatecrackslomalkaorg'

distance = 236
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev pureiev501crackslomalkaorg'

distance = 236
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev privacymakerv114017crackslomalkaorg'

distance = 254
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev fsecuresshclientv5457japanesecrackslomalkaorg'

distance = 254
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev windowsxpactivationandreactivationbyruteamcrackslomalkaorg'

distance = 255
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev emailseekerv15crackslomalkaorg'

distance = 256
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev purgeieprov21067crackslomalkaorg'

distance = 256
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev puzzlecreator11build4crackslomalkaorg'

distance = 256
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev purgeiev502crackslomalkaorg'

distance = 257
spam score = 12
title = 'b24 blackboard black filewipe biuticker imagev actualtestscomcisco642801examcheatsheetv120903crackslomalkaorg'

distance = 257
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev arobfantasticmp3networkedencoder14crackslomalkaorg'

distance = 257
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev norton2005liveupdatesubscriptionlimitremovercrackslomalkaorg'

distance = 257
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev powercryptov14crackslomalkaorg'

distance = 283
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev activestateperldevkitdvk20crackslomalkaorg'

distance = 283
spam score = 9
title = 'b24 blackboard black filewipe biuticker imagev powervideoconverterv138byfffcrackslomalkaorg'

distance = 283
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev activexmanagerv14bydbccrackslomalkaorg'

distance = 283
spam score = 12
title = 'b24 blackboard black filewipe biuticker imagev autoplaymenustudiov3007bycracklabscrackslomalkaorg'

distance = 284
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev kasperskyantiviruspersonalv50xcrackbybadmentalcrackslomalkaorg'

distance = 284
spam score = 11
title = 'b24 blackboard black filewipe biuticker imagev antechinusjavascripteditorv40webeffectsv22crackslomalkaorg'

distance = 284
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev appletheadlinefactoryv40byserials2000crackslomalkaorg'

distance = 285
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev agnitumoutpostfirewallprov1015111038crackslomalkaorg'

distance = 286
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev halobyeldiablocrackslomalkaorg'

distance = 287
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev accentmoneypasswordrecoveryv110betabyamokcrackslomalkaorg'

distance = 407
spam score = 10
title = 'b24 blackboard black filewipe biuticker imagev aareavitovcddvdsvcdmpegconverterv61bydigeraticrackslomalkaorg'

distance = 33
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa slomalkaorg'

distance = 42
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa h3d10crackslomalkaorg'

distance = 58
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa eformez175crackslomalkaorg'

distance = 59
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa fruitytracks1425crackslomalkaorg'

distance = 62
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa fireburnerv207crackslomalkaorg'

distance = 63
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa allc3systemssoftwarecrackslomalkaorg'

distance = 63
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa emailsv226crackslomalkaorg'

distance = 66
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa farv165bycorecrackslomalkaorg'

distance = 67
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa ecleanv101crackslomalkaorg'

distance = 69
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa serialslomalkaorg'

distance = 70
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa ecampaigncorporateeditionv2961crackslomalkaorg'

distance = 70
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa accessviewerv11crackslomalkaorg'

distance = 71
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa acxtractorv300crackslomalkaorg'

distance = 71
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa filesecurerv340crackslomalkaorg'

distance = 74
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa fifa2004crackslomalkaorg'

distance = 78
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa advocate2002v116351crackslomalkaorg'

distance = 78
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa a1monitorv410crackslomalkaorg'

distance = 81
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa finditprov40bysevencrackslomalkaorg'

distance = 82
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aplusfileprotectionv2101crackslomalkaorg'

distance = 83
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa xcopy2004v1350crackslomalkaorg'

distance = 153
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa microsoftoffice2003proserialnumbercrackslomalkaorg'

distance = 153
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa advancedcallcenterv400594crackslomalkaorg'

distance = 153
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aspjpeg11crackslomalkaorg'

distance = 154
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa ebook12crackslomalkaorg'

distance = 154
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa filescannerprov11crackslomalkaorg'

distance = 154
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa footballcupv107crackslomalkaorg'

distance = 155
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa animagicgifv106crackslomalkaorg'

distance = 155
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa airmessengersnppv130crackslomalkaorg'

distance = 155
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa flashgetv088crackslomalkaorg'

distance = 155
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa activexmanagerv14crackslomalkaorg'

distance = 173
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa acebuddyv300crackslomalkaorg'

distance = 173
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa luxorv10534ragamescrackbyffgcrackslomalkaorg'

distance = 173
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa airtime15crackslomalkaorg'

distance = 174
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa afterburn25bfor3dsmax4crackslomalkaorg'

distance = 174
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa eplusmaxaltera100crackslomalkaorg'

distance = 175
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa fprotantivirusforwindowsv309acrackslomalkaorg'

distance = 175
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa accessadministratorprov28crackslomalkaorg'

distance = 175
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa agosysihcopyv14042crackslomalkaorg'

distance = 175
spam score = 5
title = 's64 speaking deluxe clock speak pocket spb spa accessadministratorv22bytsrhcrackslomalkaorg'

distance = 175
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa autotask2000taskschedulerv354crackslomalkaorg'

distance = 192
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa activexmanagerv14byevccrackslomalkaorg'

distance = 192
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aimkeysv2011115keygencrackslomalkaorg'

distance = 192
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa archivejoev1000024byfhcfcrackslomalkaorg'

distance = 192
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa p2cpluspascalcompilerversion121ecrackslomalkaorg'

distance = 192
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aplusfilenamingsystemv127crackslomalkaorg'

distance = 193
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa admuncherv418crackslomalkaorg'

distance = 193
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aareavitovcdconverterv30crackslomalkaorg'

distance = 193
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa namebase30crackslomalkaorg'

distance = 194
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa adobeillustratorinterfaceimproverv15crackslomalkaorg'

distance = 194
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa asteriskprv214crackslomalkaorg'

distance = 205
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa tabmailv20crackslomalkaorg'

distance = 205
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa friendsbasev20crackslomalkaorg'

distance = 205
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa activeskinv425byulises2kcrackslomalkaorg'

distance = 206
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa eiconsv325crackslomalkaorg'

distance = 206
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa ppingtoolsv26ecrackslomalkaorg'

distance = 206
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa falbumv101crackslomalkaorg'

distance = 206
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa animalempirev21crackslomalkaorg'

distance = 207
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa p2cpluscompilerv218ecrackslomalkaorg'

distance = 207
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa alfaparav30crackslomalkaorg'

distance = 207
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa fortressv212bycafecrackslomalkaorg'

distance = 222
spam score = 5
title = 's64 speaking deluxe clock speak pocket spb spa autoplaymediastudiov5004professionalcrackslomalkaorg'

distance = 222
spam score = 5
title = 's64 speaking deluxe clock speak pocket spb spa allawsoftproductscrackslomalkaorg'

distance = 222
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa agendamsdv330crackslomalkaorg'

distance = 222
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aesopgifcreatorv100215bymetroidcrackslomalkaorg'

distance = 222
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa p2cpascalcompiler1236ecrackslomalkaorg'

distance = 223
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa adkillercrackslomalkaorg'

distance = 223
spam score = 5
title = 's64 speaking deluxe clock speak pocket spb spa antivirusandtrojanv736crackslomalkaorg'

distance = 223
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa agamawebbuttons261crackslomalkaorg'

distance = 223
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa ntrackstudio33patchcrackslomalkaorg'

distance = 224
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa acdimagefox20crackslomalkaorg'

distance = 240
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa alstrasoftadtrackerprov10crackslomalkaorg'

distance = 240
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa avconvertermobileringtoneconverterv2323crackslomalkaorg'

distance = 240
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa amigo2000v1132bitbyfhcfcrackslomalkaorg'

distance = 241
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aprcalcv30bypccrackslomalkaorg'

distance = 241
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa altnmdaemongroupwarev104crackslomalkaorg'

distance = 241
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa finaldataenterprisev10bymarcinsoftcrackslomalkaorg'

distance = 241
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa algolabrastertovectorconversiontoolkitv263crackslomalkaorg'

distance = 242
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa flashgetv13bysanyafoxcrackslomalkaorg'

distance = 242
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa powerbusinessusa20011steditioncrackslomalkaorg'

distance = 242
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aaapegimagebrowserv106byinsidecrackslomalkaorg'

distance = 261
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa activexmanagerv14byfhcfcrackslomalkaorg'

distance = 261
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa puntotekv15goldcrackslomalkaorg'

distance = 261
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa fsecureantivirusv4092220crackslomalkaorg'

distance = 261
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa activewhoisv212587crackslomalkaorg'

distance = 262
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa emailviaphone11byamokcrackslomalkaorg'

distance = 262
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa advancedpichunterv156crackslomalkaorg'

distance = 262
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa windows2003andwindowsxpsp2antiproductactivationcrackv12fixedcrackslomalkaorg'

distance = 262
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aimg2pdfv110crackslomalkaorg'

distance = 262
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa privatedesktopv16bynatabeccrackslomalkaorg'

distance = 262
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa privatepixv14crackslomalkaorg'

distance = 285
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa halocombatevolvedupdatev105crackslomalkaorg'

distance = 286
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa advancedtypewriterscrolljavaappletv20crackslomalkaorg'

distance = 286
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa freememprofessionalv51bycorecrackslomalkaorg'

distance = 286
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa apollodvdbackupprov112bydigeraticrackslomalkaorg'

distance = 287
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa acutesoftwareelectronicnetworkdiaryv40735crackslomalkaorg'

distance = 287
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa fairstarsaudioconverterv143crackslomalkaorg'

distance = 288
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa argosoftmailserverprowithimapv1845crackslomalkaorg'

distance = 289
spam score = 5
title = 's64 speaking deluxe clock speak pocket spb spa actualtestscomcisco9e0601examcheatsheetv51404crackslomalkaorg'

distance = 289
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa fileshredder2000v3xbyamokcrackslomalkaorg'

distance = 290
spam score = 5
title = 's64 speaking deluxe clock speak pocket spb spa atomicclockservicev10byrevengecrackslomalkaorg'

distance = 398
spam score = 4
title = 's64 speaking deluxe clock speak pocket spb spa aareavitovcddvdsvcdmpegconverterv50crackslomalkaorg'

distance = 35
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe adayinthelifev13crackslomalkaorg'

distance = 35
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe adayinthelifev15crackcrackslomalkaorg'

distance = 50
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe akeywordthingv10101crackslomalkaorg'

distance = 58
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe qbiclesv10crackslomalkaorg'

distance = 61
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activequerycrackslomalkaorg'

distance = 62
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe aktienprofiv104crackslomalkaorg'

distance = 67
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe thesims2crackcrackslomalkaorg'

distance = 68
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe emailsv220crackslomalkaorg'

distance = 75
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activeskinv43crackslomalkaorg'

distance = 76
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activexmanagerv14crackslomalkaorg'

distance = 81
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe fortressv212bycafecrackslomalkaorg'

distance = 82
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe ebook12crackslomalkaorg'

distance = 84
spam score = 6
title = 's78 stay connected statistxp car v10 stcc swe activerefreshv20build613crackslomalkaorg'

distance = 85
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe accessanimationv10crackslomalkaorg'

distance = 89
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe accessadministratorv39crackslomalkaorg'

distance = 89
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe raatomicadeluxev251rcrackslomalkaorg'

distance = 91
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe animateddesktopv12crackslomalkaorg'

distance = 92
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe g6renamer2000v14crackcrackslomalkaorg'

distance = 95
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe ecapturerv206crackslomalkaorg'

distance = 95
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe privatesitesv3012021crackslomalkaorg'

distance = 155
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe fishglobev104forpalmoscrackslomalkaorg'

distance = 156
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe postmasterv263crackslomalkaorg'

distance = 156
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe autoplaymenustudioprofessionalv203acrackslomalkaorg'

distance = 156
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe acxtractorv300crackslomalkaorg'

distance = 157
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe eformez175crackslomalkaorg'

distance = 157
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe absolutelyonlinev25build34crackslomalkaorg'

distance = 157
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe glockeasymail20087crackslomalkaorg'

distance = 157
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe ripv107crackslomalkaorg'

distance = 158
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe powerwmarecorderv130crackslomalkaorg'

distance = 158
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe objectexplorer212standardexecutivecrackslomalkaorg'

distance = 175
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe flashfxpv20build905crackslomalkaorg'

distance = 175
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe fprotantivirusforwindowsv311crackslomalkaorg'

distance = 175
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe filerecover2000crackslomalkaorg'

distance = 175
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe tabwizardv10crackslomalkaorg'

distance = 175
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe xhdlv3232crackslomalkaorg'

distance = 175
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activeskincontrolocxv352crackslomalkaorg'

distance = 175
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe tmailv1xxnewcrackslomalkaorg'

distance = 175
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe admuncherv418crackslomalkaorg'

distance = 175
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe purchaseorderv131crackslomalkaorg'

distance = 175
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe amfintelligentorgan20crackslomalkaorg'

distance = 189
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe afterburn25bfor3dsmax4crackslomalkaorg'

distance = 190
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe arealvalidatorv11crackslomalkaorg'

distance = 190
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activeskinv426crackslomalkaorg'

distance = 190
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe arobfantasticmp3encoderv20crackslomalkaorg'

distance = 190
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe powerchipsv10418crackslomalkaorg'

distance = 191
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe nod32allversionsfixedcrackslomalkaorg'

distance = 191
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe puzzleblastv10keygenbyfffcrackslomalkaorg'

distance = 191
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe adailybackupv361crackslomalkaorg'

distance = 192
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe accessmdeunlockerv13crackslomalkaorg'

distance = 192
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe allc3systemssoftwarecrackslomalkaorg'

distance = 207
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe fineprint2000build30deutschbyamokcrackslomalkaorg'

distance = 207
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe fsprolabslockmypcv23crackslomalkaorg'

distance = 207
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe amigaforeverv40crackslomalkaorg'

distance = 207
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activeskinv425byulises2kcrackslomalkaorg'

distance = 208
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe fsecureantivirusforwindowsv540crackslomalkaorg'

distance = 208
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe puzzazv10crackslomalkaorg'

distance = 208
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe powerarchiver2003v87010crackslomalkaorg'

distance = 208
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe asposeexcelv17crackslomalkaorg'

distance = 208
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe aistmoviepackv30build4975crackslomalkaorg'

distance = 208
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe antibov15crackslomalkaorg'

distance = 220
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activestatevisualpythonforvs2002v1812082crackslomalkaorg'

distance = 220
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activefaxserverv387build194crackslomalkaorg'

distance = 220
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activexmanagerv14byfhcfcrackslomalkaorg'

distance = 221
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe fsecureantivirusv53finalcrackslomalkaorg'

distance = 221
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe privatedesktopv13byskywalkercrackslomalkaorg'

distance = 221
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe arobfantasticmp3networkedencoder14crackslomalkaorg'

distance = 221
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe avconvertermobileringtoneconverterv2323crackslomalkaorg'

distance = 221
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe acdimagefoxv20trialbyrealistycrackslomalkaorg'

distance = 221
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe finalwayv131build20011018crackslomalkaorg'

distance = 221
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe poweraudiotoolsv362fixedcrackslomalkaorg'

distance = 234
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe flashsavermakerv162byrp2kcrackslomalkaorg'

distance = 234
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe fsecurevpnplusv550166winnt2kxpcrackslomalkaorg'

distance = 234
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe emailsv225serialbyfffcrackslomalkaorg'

distance = 234
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe adobepremierev70crackslomalkaorg'

distance = 234
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe accentofficepasswordrecovery101byamokcrackslomalkaorg'

distance = 234
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe spywaredoctorv300288crackslomalkaorg'

distance = 235
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe purgeieprov104crackslomalkaorg'

distance = 235
spam score = 6
title = 's78 stay connected statistxp car v10 stcc swe actualtestscomoracle1z0032examcheatsheetv120303crackslomalkaorg'

distance = 235
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe putzi4win14acrackslomalkaorg'

distance = 235
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activeskincontrolocxv22byeclipsecrackslomalkaorg'

distance = 253
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe powerdeskexplorerv303crackslomalkaorg'

distance = 253
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe activestatetclprov1502crackslomalkaorg'

distance = 253
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe atomicclockservicev10byrevengecrackslomalkaorg'

distance = 254
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe amiracleinathoughtscreenflashscreensavercrackslomalkaorg'

distance = 254
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe absolutesecurityprov37serialbyucccrackslomalkaorg'

distance = 254
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe windowsxpactivationandspcrackcrackslomalkaorg'

distance = 254
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe aplusscreensavercreatorv34crackslomalkaorg'

distance = 255
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe privacyeraserv350bycimcrackslomalkaorg'

distance = 255
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe xcomserverv271118crackslomalkaorg'

distance = 255
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe poweraudioeditorv305fixedcrackslomalkaorg'

distance = 283
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe fineprint2000v432enterpriseeditioncrackslomalkaorg'

distance = 283
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe purgeieprov10414060crackslomalkaorg'

distance = 284
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe powerarchiver2001v702portuguesecrackslomalkaorg'

distance = 284
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe postguardv32multilannguagecrackslomalkaorg'

distance = 285
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe allpurposeresumesv101byevidencecrackslomalkaorg'

distance = 285
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe privatedesktopv19crackslomalkaorg'

distance = 285
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe privacysweeperv260crackslomalkaorg'

distance = 285
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe addremoveplus2004v41build755crackslomalkaorg'

distance = 286
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe macromediadreamweavermx2004trialcrackslomalkaorg'

distance = 286
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe windowsxpservicepack2activatorcrackslomalkaorg'

distance = 354
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe fathsoftbarcodexocxv53bylucidcrackslomalkaorg'

distance = 359
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe adobephotoshopandimagereadycsv801tryoutmultilanguagefixedcrackslomalkaorg'

distance = 359
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe acdsystemsacdseev7061powerpackcrackslomalkaorg'

distance = 359
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe aareavitovcddvdsvcdmpegconverterv50crackslomalkaorg'

distance = 360
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe appliedflowtechnologyaftfathomv5020030805winalldonglecrackedcrackslomalkaorg'

distance = 367
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe powerdefragv301serialbymrkrackercrackslomalkaorg'

distance = 368
spam score = 4
title = 's78 stay connected statistxp car v10 stcc swe uleadvideostudiov900100englishtbybtofullcrackbybidjancrackslomalkaorg'

distance = 372
spam score = 5
title = 's78 stay connected statistxp car v10 stcc swe avimpegrmjoinerv240bytsrhcrackslomalkaorg'

distance = 0
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac ripv109crackslomalkaorg'

distance = 18
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac nameit10crackslomalkaorg'

distance = 25
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac hackmanv501newcrackslomalkaorg'

distance = 28
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac tablev202crackslomalkaorg'

distance = 33
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac kmlv312301crackslomalkaorg'

distance = 33
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac andyv216serialcrackslomalkaorg'

distance = 37
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac octopusvs519dcrackslomalkaorg'

distance = 37
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac tfix307doscrackslomalkaorg'

distance = 39
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac uwipev14crackslomalkaorg'

distance = 40
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac analyzer2000v40crackslomalkaorg'

distance = 44
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac andorv10crackslomalkaorg'

distance = 45
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac alwaysontimev10112crackslomalkaorg'

distance = 48
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac p2crocket11crackslomalkaorg'

distance = 50
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac halloweenv1666crackslomalkaorg'

distance = 51
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac kmlv35202crackslomalkaorg'

distance = 51
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac vcomsystemcommanderv80crackslomalkaorg'

distance = 53
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac raavalanchev10crackslomalkaorg'

distance = 53
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac anydvdv3936crackslomalkaorg'

distance = 54
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac axalbumv20crackslomalkaorg'

distance = 56
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac b2m2v104crackslomalkaorg'

distance = 150
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac aptmailingassistant305ucrackslomalkaorg'

distance = 150
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac fsecureantivirusclientsecurityv554crackslomalkaorg'

distance = 150
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac ativanetmeterv301crackslomalkaorg'

distance = 150
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac kagayakiiiistandardcrackslomalkaorg'

distance = 150
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac armadillorunv101crackslomalkaorg'

distance = 150
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac occilloscopeaudiov22crackslomalkaorg'

distance = 150
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac tabmailv20crackslomalkaorg'

distance = 150
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac hamhelper12crackslomalkaorg'

distance = 151
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac kmlv38247crackslomalkaorg'

distance = 151
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac finditprov400crackslomalkaorg'

distance = 169
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac tabmailv25byngencrackslomalkaorg'

distance = 169
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac anfxv423bysection8crackslomalkaorg'

distance = 169
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac finalrecoveryv121bysndcrackslomalkaorg'

distance = 169
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac ripstrikebackv202trainercrackslomalkaorg'

distance = 169
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac acereaderprofessionalv11bcrackslomalkaorg'

distance = 169
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac aprintdirect3604crackslomalkaorg'

distance = 169
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac rstudioagentemergency20build819crackslomalkaorg'

distance = 169
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac adregclnv21serialcrackslomalkaorg'

distance = 169
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac antispyv213byfffcrackslomalkaorg'

distance = 169
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac appforgev86crackslomalkaorg'

distance = 186
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac atomic3dshooterv10crackslomalkaorg'

distance = 186
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac acereaderv43bytmgcrackslomalkaorg'

distance = 186
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac aone3gpvideoconverterv215crackslomalkaorg'

distance = 186
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac abilitiesbuildermeasureitv11crackslomalkaorg'

distance = 186
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac halworks2314crackslomalkaorg'

distance = 186
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac fprotantivirusv312dbyngencrackslomalkaorg'

distance = 186
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac adobepremierev60serialbypecascrackslomalkaorg'

distance = 187
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac aboundscreensaverv10crackslomalkaorg'

distance = 187
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac kmailv34214crackslomalkaorg'

distance = 187
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac advancedreplacerv12bydistinctcrackslomalkaorg'

distance = 204
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac acidwavv22crackslomalkaorg'

distance = 204
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac applauncherv70crackslomalkaorg'

distance = 204
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac alstrasoftlinkdirectoryv102crackslomalkaorg'

distance = 204
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac awiconsprov920crackslomalkaorg'

distance = 204
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac alltowmaconverterv14crackslomalkaorg'

distance = 204
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac abpfiffv802germancrackslomalkaorg'

distance = 204
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac anziolitev124kcrackcrackslomalkaorg'

distance = 204
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac packplus171frenchcrackslomalkaorg'

distance = 205
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac halflifev1005crackslomalkaorg'

distance = 205
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac abicoderv3611crackslomalkaorg'

distance = 222
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac allsynthesoftproducts2000seriescrackslomalkaorg'

distance = 222
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac advancedsmtpserverv26crackslomalkaorg'

distance = 222
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac abbyyfinereaderprofessionalv700543crackslomalkaorg'

distance = 222
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac amaraflashnewstickercrackslomalkaorg'

distance = 222
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac namowebeditorv304crackslomalkaorg'

distance = 222
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac qplusbridgev61crackslomalkaorg'

distance = 222
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac adressen2001011193germancrackslomalkaorg'

distance = 222
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac adrbookv57byucolcrackslomalkaorg'

distance = 222
spam score = 6
title = 'h1 half life 2 hackman halo halloween ham hac xaudiovideoclipjoinerv12crackslomalkaorg'

distance = 222
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac nameityourwayniyowv152crackslomalkaorg'

distance = 239
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac amabilis3dcanvasprov60byepscrackslomalkaorg'

distance = 239
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac qimagepro1004crackslomalkaorg'

distance = 239
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac adobephotoshopv70keygenfixedbyssgcrackslomalkaorg'

distance = 239
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac adobeacrobatv6xcrackslomalkaorg'

distance = 239
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac advancedsmtpserverv25crackslomalkaorg'

distance = 239
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac adobegolivecsv70crackslomalkaorg'

distance = 239
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac findv26bydfcrackslomalkaorg'

distance = 239
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac halflife2byapecrackslomalkaorg'

distance = 239
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac qarbonviewletcamv102003crackslomalkaorg'

distance = 240
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac animagicgifanimatorv122crackslomalkaorg'

distance = 261
spam score = 9
title = 'h1 half life 2 hackman halo halloween ham hac ucertifymicrosoftm70218prepkitv80005crackslomalkaorg'

distance = 261
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac antivirusexpertavxprofessional590crackslomalkaorg'

distance = 261
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac halflifev1016newcrackslomalkaorg'

distance = 261
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac v2iprotectorv201servereditioncrackslomalkaorg'

distance = 261
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac namowebeditorv40trialcrackslomalkaorg'

distance = 261
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac galleon3dscreensaverv11newcrackslomalkaorg'

distance = 261
spam score = 9
title = 'h1 half life 2 hackman halo halloween ham hac appletglidenavigationprov20crackslomalkaorg'

distance = 261
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac galaxyrebellionv141germanallaccesscheatcrackslomalkaorg'

distance = 261
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac namodeepsearchv306basiccrackslomalkaorg'

distance = 261
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac tabmailv13workingcrackslomalkaorg'

distance = 290
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac gaebgetterprofessionalv29germancrackslomalkaorg'

distance = 290
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac alteros3dv23bytportcrackslomalkaorg'

distance = 290
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac autowebviewscreensaverv10crackslomalkaorg'

distance = 290
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac protectxhackerdefensesuitev411crackslomalkaorg'

distance = 291
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac aurorix2bulgixv20crackslomalkaorg'

distance = 291
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac amazingmidi160crackcrackslomalkaorg'

distance = 291
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac altomp3makerv310byfhcfcrackslomalkaorg'

distance = 291
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac advancedsmtpserverv23bysndcrackslomalkaorg'

distance = 291
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac antiviraltoolkitproavpforlinux3xbuildxxxcrackslomalkaorg'

distance = 292
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac namowebeditor60suitefrenchcrackslomalkaorg'

distance = 407
spam score = 8
title = 'h1 half life 2 hackman halo halloween ham hac adobeillustratorcstryoutexpiryremovalpatchcrackslomalkaorg'

distance = 414
spam score = 7
title = 'h1 half life 2 hackman halo halloween ham hac abfoutlookexpressbackupv183219bylucidcrackslomalkaorg'

distance = 435
spam score = 9
title = 'h1 half life 2 hackman halo halloween ham hac adobephotoshopv80cscreativesuitepatchbybidjancrackslomalkaorg'

distance = 24
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig associatev13byd4ccrackslomalkaorg'

distance = 36
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig gbee13crackslomalkaorg'

distance = 41
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig finalfantasy7crackslomalkaorg'

distance = 45
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig eborderclient211crackslomalkaorg'

distance = 57
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig advancedcallcenterv410602crackcrackslomalkaorg'

distance = 62
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig finditv3xcrackslomalkaorg'

distance = 63
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig flydsv200400crackslomalkaorg'

distance = 65
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig a1monitor2004v621crackslomalkaorg'

distance = 67
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig eiconsv343crackcrackslomalkaorg'

distance = 69
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig tagandrenamev20finalcrackslomalkaorg'

distance = 74
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig p2psharespyv10crackslomalkaorg'

distance = 76
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig babylonpro5crackslomalkaorg'

distance = 78
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig uwipev20crackslomalkaorg'

distance = 80
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig xchat28crackslomalkaorg'

distance = 81
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig accessanimationv115crackslomalkaorg'

distance = 82
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig archiveitallcrackslomalkaorg'

distance = 82
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig accessreporternetforiisv634crackslomalkaorg'

distance = 83
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig serialslomalkaorg'

distance = 83
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig filescannerprov11crackslomalkaorg'

distance = 83
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig afskaufmann2000v1081crackslomalkaorg'

distance = 151
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig alarmmasterplusv498forwin9xment2kcrackslomalkaorg'

distance = 152
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig ghackerv20crackslomalkaorg'

distance = 152
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig filescout10crackslomalkaorg'

distance = 152
spam score = 11
title = 'w56 winxfiles blowfish winxp manager winvestig nod32allversionsfixedcrackslomalkaorg'

distance = 152
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig advancedreplacerv11byhscrackslomalkaorg'

distance = 152
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig galacticpatrolv160crackslomalkaorg'

distance = 153
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig emailtalkerv40crackslomalkaorg'

distance = 153
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig facefilterstandardv10crackslomalkaorg'

distance = 154
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig albumexpressv26cbydesperatecrackslomalkaorg'

distance = 154
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig automaintenanceprov8006bydistinctcrackslomalkaorg'

distance = 173
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig albumgeneratorandviewerv230crackslomalkaorg'

distance = 174
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig flashcards2000v20crackslomalkaorg'

distance = 174
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig powerdesignerv951736crackslomalkaorg'

distance = 174
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig agsattrackv1031bylucidcrackslomalkaorg'

distance = 175
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig accessmdeunlocker151crackslomalkaorg'

distance = 175
spam score = 8
title = 'w56 winxfiles blowfish winxp manager winvestig posterdownloadercrackslomalkaorg'

distance = 175
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig ativaprov31114byevidencecrackslomalkaorg'

distance = 175
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig antares8v8128crackslomalkaorg'

distance = 175
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig odbcviewer22crackslomalkaorg'

distance = 176
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig adayinthelife15crackslomalkaorg'

distance = 192
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig fontlabv311crackslomalkaorg'

distance = 193
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig windowsxpkeygencrackslomalkaorg'

distance = 193
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig archivepowersmallbusinessv149crackslomalkaorg'

distance = 193
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig fsecuresshclientv5457japanesecrackslomalkaorg'

distance = 193
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig avdslideshowv20crackslomalkaorg'

distance = 193
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig advancedmp3converterv201bymp2kcrackslomalkaorg'

distance = 193
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig fsecureantivirusv55010260forserverscrackslomalkaorg'

distance = 193
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig privacyinspectorv131crackslomalkaorg'

distance = 194
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig australiabestaddress2003v440bysndcrackslomalkaorg'

distance = 194
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig arealvalidatorv111byfhcfcrackslomalkaorg'

distance = 208
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig all4audiomp3makerv112newcrackslomalkaorg'

distance = 208
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig powereditv202acrackslomalkaorg'

distance = 208
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig argosoftmailserverprov1618crackslomalkaorg'

distance = 208
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig fileshredder28crackslomalkaorg'

distance = 209
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig activefaxserverv388build195germancrackslomalkaorg'

distance = 209
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig animatedoptionboxv100ccrackslomalkaorg'

distance = 209
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig asmwtweak2004v112crackslomalkaorg'

distance = 209
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig alawarbacktoearthv10byexplosioncrackslomalkaorg'

distance = 209
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig advanceduninstallerpro2003bymp2kcrackslomalkaorg'

distance = 209
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig automasterv517crackslomalkaorg'

distance = 222
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig powercryptov132crackslomalkaorg'

distance = 222
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig airdesktools156crackslomalkaorg'

distance = 222
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig acqurlv43crackslomalkaorg'

distance = 222
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig pacestarumldiagrammerv4191790crackslomalkaorg'

distance = 223
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig puzzleexpressv1001crackslomalkaorg'

distance = 223
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig aversoftstickerv231crackslomalkaorg'

distance = 224
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig aesopgifcreatorv102302byimscrackslomalkaorg'

distance = 224
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig animatedbuttonv103crackslomalkaorg'

distance = 224
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig stylexpv306keygenbyexclipsecrackslomalkaorg'

distance = 224
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig activemp3controlforwin32v20crackslomalkaorg'

distance = 238
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig activeskinocxv4257crackslomalkaorg'

distance = 238
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig atomicemailloggerv144bydigeraticrackslomalkaorg'

distance = 238
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig arcservev6xforwindowsntcrackslomalkaorg'

distance = 239
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig advancedtetrisv412crackslomalkaorg'

distance = 239
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig adregclnv2110123crackslomalkaorg'

distance = 239
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig advancedmp3wmarecorderv39byucfcrackslomalkaorg'

distance = 239
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig fineprintpdffactoryv10win9xmecrackslomalkaorg'

distance = 239
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig fprotantivirusv312dbyngencrackslomalkaorg'

distance = 240
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig activeskincontrolocxv352crackslomalkaorg'

distance = 240
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig addflowactivex30crackslomalkaorg'

distance = 260
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig fprotantivirusforwindowsv311aloaderbytntcrackslomalkaorg'

distance = 260
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig alparysoftvideolockv10byfffcrackslomalkaorg'

distance = 260
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig findandreplaceinhtmlfilessoftwarev70crackslomalkaorg'

distance = 260
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig acousticamp3towaveconverterplusv226bysndcrackslomalkaorg'

distance = 260
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig adobeacrobatv70professionaltryoutcrackbytimcrackslomalkaorg'

distance = 261
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig purgem2000v102crackslomalkaorg'

distance = 262
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig privateeyev30crackslomalkaorg'

distance = 262
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig halflifev1106onlinepatchcrackslomalkaorg'

distance = 262
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig valesoftwareaudiostudiov21crackslomalkaorg'

distance = 262
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig ativapronetmeterv317byucucrackslomalkaorg'

distance = 284
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig accentofficepasswordrecovery101ltbyamokcrackslomalkaorg'

distance = 284
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig activegenderv25crackslomalkaorg'

distance = 285
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig attributemagicprov21beta7crackslomalkaorg'

distance = 285
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig acronisosselectorv80byneocoderzcrackslomalkaorg'

distance = 286
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig animallogicmayamanv128formayacrackslomalkaorg'

distance = 287
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig aareavitovcddvdsvcdconverter30crackslomalkaorg'

distance = 287
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig forehelphtmlpro400crackslomalkaorg'

distance = 288
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig purchaseorderv15r5crackslomalkaorg'

distance = 288
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig advancedvbapasswordrecoveryprov132byeaglecrackslomalkaorg'

distance = 288
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig osadobeillustratorcs2tryouttofullactivationkeygenbyoscarcrackslomalkaorg'

distance = 406
spam score = 10
title = 'w56 winxfiles blowfish winxp manager winvestig windows2003andwindowsxpsp2antiproductactivationcrackv12fixedcrackslomalkaorg'

distance = 411
spam score = 9
title = 'w56 winxfiles blowfish winxp manager winvestig uleadvideostudiov900100englishtbybtofullcrackbybidjancrackslomalkaorg'

distance = 43
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre filesecurerv360crackslomalkaorg'

distance = 56
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre findandreplace10crackslomalkaorg'

distance = 59
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre pmanv10bandwjavacrackslomalkaorg'

distance = 69
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre alarmv623crackslomalkaorg'

distance = 71
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre xballv21bypizzacrackslomalkaorg'

distance = 74
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre allegrosurfv4400crackslomalkaorg'

distance = 76
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre finditv304keygencrackslomalkaorg'

distance = 76
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre freshuiv660crackslomalkaorg'

distance = 76
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre auctionsentryv231crackslomalkaorg'

distance = 77
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre aftertune3000v100189crackslomalkaorg'

distance = 78
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre falbumv101crackslomalkaorg'

distance = 78
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre ecapturerv206crackslomalkaorg'

distance = 78
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fifa2002keygencrackslomalkaorg'

distance = 79
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre gabrielv19crackslomalkaorg'

distance = 81
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre albumexpressv25crackslomalkaorg'

distance = 81
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre eplanpro30crackslomalkaorg'

distance = 83
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre uwipev28crackslomalkaorg'

distance = 84
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre tackies30crackslomalkaorg'

distance = 87
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre limewireprov347crackslomalkaorg'

distance = 88
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre ntrackstudiov3111crackslomalkaorg'

distance = 152
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fireburnerv106byucucrackslomalkaorg'

distance = 152
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre filenameprov206crackslomalkaorg'

distance = 153
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre uwipev20bydbzcrackslomalkaorg'

distance = 153
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre appletcomposerv2xcrackslomalkaorg'

distance = 154
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre p2cpluspascal12407ecrackslomalkaorg'

distance = 154
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre tfix307doscrackslomalkaorg'

distance = 154
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre ecampaignprofessionaleditionv2944byfffcrackslomalkaorg'

distance = 155
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre ecampaignv302crackslomalkaorg'

distance = 155
spam score = 11
title = 'x13 pro xpcspy xreminder xpsecurity build xpre activerefreshv20build613crackslomalkaorg'

distance = 155
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre akaicdxtractv123crackslomalkaorg'

distance = 173
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre animatedscreenv62crackslomalkaorg'

distance = 173
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fontmapv237acrackslomalkaorg'

distance = 174
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre alphaballv14levelpackno3crackslomalkaorg'

distance = 174
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre pushftpv2011byeminencecrackslomalkaorg'

distance = 174
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre emailalertv1019byimscrackslomalkaorg'

distance = 174
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre powerarchiver2003v88004crackslomalkaorg'

distance = 175
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre keygenslomalkaorg'

distance = 175
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fsecureantivirusv4092220crackslomalkaorg'

distance = 176
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre activepenv10713crackslomalkaorg'

distance = 176
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fileshredder2000v31byevidencecrackslomalkaorg'

distance = 190
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre absolutesecurityprov37serialbytntcrackslomalkaorg'

distance = 190
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre autourlsubmit26crackslomalkaorg'

distance = 190
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre stylexpallversionskeygencrackslomalkaorg'

distance = 191
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre finalrecoveryv13byf4cgcrackslomalkaorg'

distance = 191
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre namo309crackslomalkaorg'

distance = 192
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre qverbspanishv101crackslomalkaorg'

distance = 192
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre privacyfencev30crackslomalkaorg'

distance = 192
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre activereports2professionalbydatadynamicscrackslomalkaorg'

distance = 193
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre microsoftoffice2003proserialnumbercrackslomalkaorg'

distance = 193
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre postpetv214crackslomalkaorg'

distance = 208
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre abfoutlookbackup22061crackslomalkaorg'

distance = 208
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre powerarchiver2001v702newcrackslomalkaorg'

distance = 208
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre protectx402crackslomalkaorg'

distance = 208
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre arobfantasticmp3networkedencoderv14bymanifestcrackslomalkaorg'

distance = 208
spam score = 8
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fastnetconnectionacceleratorcrackslomalkaorg'

distance = 209
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre antechinusphpeditorv11bydesperatecrackslomalkaorg'

distance = 209
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fineprintpdffactoryv10win9xmecrackslomalkaorg'

distance = 209
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre findflashv10crackslomalkaorg'

distance = 209
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre absolutesecuritystandardv37keygencrackslomalkaorg'

distance = 209
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre amusicalgeneratorv20288crackslomalkaorg'

distance = 221
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre filefolderlister200build20060918crackslomalkaorg'

distance = 221
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre flashimagebuilderv32bytsrhcrackslomalkaorg'

distance = 221
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre acxabetonedatenbankserienbriefv702germancrackslomalkaorg'

distance = 221
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre arcnotesv10crackslomalkaorg'

distance = 222
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre pacdoomv21crackslomalkaorg'

distance = 222
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre akalapasswordrevealerv10031103crackslomalkaorg'

distance = 222
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fruityloops30crackslomalkaorg'

distance = 222
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre filematrixv71crackslomalkaorg'

distance = 222
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre aipictureexplorerv7027015crackslomalkaorg'

distance = 223
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre appletpopupmenubuilderv10crackslomalkaorg'

distance = 237
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre windowsxpservicepack2activatorcrackbyhjcrackslomalkaorg'

distance = 237
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre activexmanagerv14byfffcrackslomalkaorg'

distance = 238
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre alluringislandsscreensaverv500byfhcfcrackslomalkaorg'

distance = 238
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre amfbackmeupv4001420crackslomalkaorg'

distance = 238
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre powerarchiver2002v80crackslomalkaorg'

distance = 238
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre activemp3activexcontrol17crackslomalkaorg'

distance = 238
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre advancedquerytoolv30byorioncrackslomalkaorg'

distance = 238
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre tacomakermarathonplus3crackslomalkaorg'

distance = 239
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fprotantivirusv31xevaluationcrackslomalkaorg'

distance = 239
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre protectxprofessionaleditionv402crackslomalkaorg'

distance = 258
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre forteagentv20build646bychollacrackslomalkaorg'

distance = 258
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre allkasperskyproductscrackslomalkaorg'

distance = 258
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre activeskinv426crackslomalkaorg'

distance = 259
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre argosoftmailserverprowithimapv1862crackslomalkaorg'

distance = 259
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre agnitumoutpostfirewallv21build3034009bytsrhcrackslomalkaorg'

distance = 260
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre advancedquerytoolv424crackslomalkaorg'

distance = 260
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fileviewer30bytntcrackslomalkaorg'

distance = 261
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre a1quicktrayv20byciacrackslomalkaorg'

distance = 262
spam score = 8
title = 'x13 pro xpcspy xreminder xpsecurity build xpre imtoo3gpvideoconverterv2115build1201crackslomalkaorg'

distance = 262
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre eiconsv3xcrackslomalkaorg'

distance = 285
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre powerdvdv60byparadoxcrackslomalkaorg'

distance = 286
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre alarmmasterplusv45bylashcrackslomalkaorg'

distance = 286
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre favoaudioconverterv50byfffcrackslomalkaorg'

distance = 286
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre fsecureantivirusv531crackslomalkaorg'

distance = 286
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre audiosynth015vstibyjorgenaasecrackslomalkaorg'

distance = 287
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre activexgltextv110crackslomalkaorg'

distance = 287
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre adwarespyv20byarteamcrackslomalkaorg'

distance = 287
spam score = 10
title = 'x13 pro xpcspy xreminder xpsecurity build xpre activewhoisbrowserv202466byheritagecrackslomalkaorg'

distance = 288
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre puzzleblastv10bypizzacrackslomalkaorg'

distance = 289
spam score = 9
title = 'x13 pro xpcspy xreminder xpsecurity build xpre flexsync10forpalmoscrackslomalkaorg'

distance = 411
spam score = 8
title = 'x13 pro xpcspy xreminder xpsecurity build xpre kasperskyantiviruspersonalprov5020keygenfilebyblackstarcrackslomalkaorg'

distance = 49
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with eborderclient21crackslomalkaorg'

distance = 57
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with axemanv30crackslomalkaorg'

distance = 60
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with editorial2v201crackslomalkaorg'

distance = 61
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with avast32v30crackslomalkaorg'

distance = 62
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with arealvalidatorcrackslomalkaorg'

distance = 64
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with r2extremeprov151crackslomalkaorg'

distance = 66
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with fortres101v41535crackslomalkaorg'

distance = 66
spam score = 4
title = 'c28 cfa v30 cepstral diznfo swifttalker with halloweenv19992crackslomalkaorg'

distance = 67
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with qbookspro99crackslomalkaorg'

distance = 69
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with emailsv226crackslomalkaorg'

distance = 81
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with galleryeffectsv152crackslomalkaorg'

distance = 81
spam score = 6
title = 'c28 cfa v30 cepstral diznfo swifttalker with albumcreatorv30crackslomalkaorg'

distance = 83
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with fcutterv160serialcrackslomalkaorg'

distance = 83
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with alarme215crackslomalkaorg'

distance = 85
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with qfolder95v32crackslomalkaorg'

distance = 88
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with ebusinesssolutionsv7000003crackslomalkaorg'

distance = 89
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with forestlife3dscreensaverv10crackslomalkaorg'

distance = 89
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with alignitv120crackslomalkaorg'

distance = 89
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with gutecollectionbymp2kcrackslomalkaorg'

distance = 92
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with animatedscreenv66crackslomalkaorg'

distance = 153
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with privatesitesv3012021crackslomalkaorg'

distance = 153
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with adcsv103bytntcrackslomalkaorg'

distance = 153
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with absolutelyonlinev23build27crackslomalkaorg'

distance = 153
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with actualtestscomsun310016examcheatsheetv103003crackslomalkaorg'

distance = 154
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with fileutilities97frenchcrackslomalkaorg'

distance = 154
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with finditv400byembracecrackslomalkaorg'

distance = 154
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with findback200302crackslomalkaorg'

distance = 154
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with advancedmp3wmarecorderv54crackslomalkaorg'

distance = 155
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with adayinthelifev151keygencrackslomalkaorg'

distance = 155
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with autositegalleryv15crackslomalkaorg'

distance = 171
spam score = 6
title = 'c28 cfa v30 cepstral diznfo swifttalker with oberonsecuridesignv10crackslomalkaorg'

distance = 171
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with ahaviewv313crackslomalkaorg'

distance = 171
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with ariolicmemlerv23crackslomalkaorg'

distance = 171
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with puzzleblastv10crackbyfffcrackslomalkaorg'

distance = 172
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with archivesearcherv12bytntcrackslomalkaorg'

distance = 172
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with powercheckv210crackslomalkaorg'

distance = 172
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with activefaxserverv388build195germancrackslomalkaorg'

distance = 172
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with powerarchiver2004v90026byfffcrackslomalkaorg'

distance = 173
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with emailalertv10110bystreamcrackslomalkaorg'

distance = 173
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with filescavengerv21vcrackslomalkaorg'

distance = 190
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with windowsxpprocrackslomalkaorg'

distance = 190
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with analyzerxpv20crackslomalkaorg'

distance = 190
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with aceexpertftpv130crackslomalkaorg'

distance = 190
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with hackmanv501byaaocgcrackslomalkaorg'

distance = 190
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with activewhoisv212587crackslomalkaorg'

distance = 190
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with formelbank22crackslomalkaorg'

distance = 191
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with argosoftmailserverv1866crackslomalkaorg'

distance = 191
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with airglidev11javacrackslomalkaorg'

distance = 191
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with findgraphv1321crackslomalkaorg'

distance = 192
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with arealvalidatorv111crackslomalkaorg'

distance = 205
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with activexmanagerv14byevidencecrackslomalkaorg'

distance = 205
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with addresseverywherev23crackslomalkaorg'

distance = 206
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with powerwmarecorderv130crackslomalkaorg'

distance = 207
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with ajeusermanagerenterprisev300107crackslomalkaorg'

distance = 207
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with fprotantivirusforwindowsv311crackslomalkaorg'

distance = 207
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with alapshadowcasterv322forquarkxpresscrackslomalkaorg'

distance = 207
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with powerdefragv301crackbymrkrackercrackslomalkaorg'

distance = 207
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with flat2servv15build171byamokcrackslomalkaorg'

distance = 208
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with acemoneyv334crackslomalkaorg'

distance = 208
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with atomtimeprov31acrackslomalkaorg'

distance = 222
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with anfx5v511byxzerocrackslomalkaorg'

distance = 222
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with ventafaxv50crackslomalkaorg'

distance = 222
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with albumgeneratorandviewerv2230keygenbyfffcrackslomalkaorg'

distance = 223
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with firstbase21000forpalmoscrackslomalkaorg'

distance = 223
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with awiconsv10crackslomalkaorg'

distance = 223
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with adwarexeliminatorv20byfffcrackslomalkaorg'

distance = 223
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with advancedcabrepairv10bydanielcrackslomalkaorg'

distance = 223
spam score = 6
title = 'c28 cfa v30 cepstral diznfo swifttalker with activerefresh136build551crackslomalkaorg'

distance = 223
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with filenameprov206crackslomalkaorg'

distance = 224
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with fprotantivirusforwindowsv310acrackslomalkaorg'

distance = 239
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with actualtitlebuttonsv11crackslomalkaorg'

distance = 239
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with akoffgutarassitantv101crackslomalkaorg'

distance = 239
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with powercardmakerv34crackslomalkaorg'

distance = 240
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with fsecureantivirusv552crackslomalkaorg'

distance = 240
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with windowsxpproductkeyviewercrackslomalkaorg'

distance = 240
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with argosoftmailserverplusv1405crackslomalkaorg'

distance = 240
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with aistxsearchv278bytsrhcrackslomalkaorg'

distance = 240
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with fileshredder2000v30bytcacrackslomalkaorg'

distance = 240
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with purchaseorderv131crackslomalkaorg'

distance = 241
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with autoplaymenubuilderv34build528crackslomalkaorg'

distance = 255
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with advancedattachmentsprocessorv130crackslomalkaorg'

distance = 256
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with animatedscreenv68byorioncrackslomalkaorg'

distance = 256
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with emageforwebv12134crackslomalkaorg'

distance = 256
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with animatedoptionboxv100ccrackslomalkaorg'

distance = 256
spam score = 4
title = 'c28 cfa v30 cepstral diznfo swifttalker with protectxprofessionaleditionv403crackslomalkaorg'

distance = 256
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with privacysweeperv260crackslomalkaorg'

distance = 256
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with faxamaticva93201bydbccrackslomalkaorg'

distance = 256
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with purgatioprov65crackslomalkaorg'

distance = 256
spam score = 4
title = 'c28 cfa v30 cepstral diznfo swifttalker with aircardsv115superkingair350crackslomalkaorg'

distance = 257
spam score = 4
title = 'c28 cfa v30 cepstral diznfo swifttalker with powervideoconverterv138crackslomalkaorg'

distance = 282
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with firmtoolsalbumcreatorprov35571crackslomalkaorg'

distance = 282
spam score = 4
title = 'c28 cfa v30 cepstral diznfo swifttalker with privatepixv211byeminencecrackslomalkaorg'

distance = 282
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with adobephotoshopcs2v90keygenbyss2crackslomalkaorg'

distance = 283
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with aprcalcv40111bypukecrackslomalkaorg'

distance = 285
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with purchaseorderorganizerdeluxev22crackslomalkaorg'

distance = 286
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with akoffmusiccomposerv20serialbyevidencecrackslomalkaorg'

distance = 287
spam score = 4
title = 'c28 cfa v30 cepstral diznfo swifttalker with apollo3gpvideoconverterv205crackslomalkaorg'

distance = 288
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with activestatetcldevkitv261crackslomalkaorg'

distance = 288
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with fablockocxactivexcomponent10crackslomalkaorg'

distance = 290
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with freememprofessionalv43byfhcfcrackslomalkaorg'

distance = 339
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with arobfantasticmp3networkedencoderv14bymanifestcrackslomalkaorg'

distance = 340
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with privateidahoemail461upgradecrackslomalkaorg'

distance = 345
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with argosoftftpserverv1411bycorecrackslomalkaorg'

distance = 348
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with findandreplacetextinmultiplefilessoftwarev70crackslomalkaorg'

distance = 360
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with emailviaphone11byamokcrackslomalkaorg'

distance = 388
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with afscncpaldrehen10crackslomalkaorg'

distance = 391
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with postworkquickiescriptspsp8vol2crackslomalkaorg'

distance = 403
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with addressmagicsoftwaredeveloperskitsdkcrackslomalkaorg'

distance = 446
spam score = 5
title = 'c28 cfa v30 cepstral diznfo swifttalker with appliedflowtechnologyaftfathomv5020030805winalldonglecrackedcrackslomalkaorg'

distance = 46
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 divxprov521crackslomalkaorg'

distance = 58
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 eformez175crackslomalkaorg'

distance = 64
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 ecampaigncorporateeditionv4815crackslomalkaorg'

distance = 64
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 adayinthelifev15crackcrackslomalkaorg'

distance = 65
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 fcutterv160crackslomalkaorg'

distance = 67
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 epop203123crackslomalkaorg'

distance = 69
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 eiconsv325crackslomalkaorg'

distance = 69
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 eiconsv3xcrackslomalkaorg'

distance = 70
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 agtransform116crackslomalkaorg'

distance = 70
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 emageforwebv12134crackslomalkaorg'

distance = 72
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 freshdesktopv300crackslomalkaorg'

distance = 74
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 fishv333431crackslomalkaorg'

distance = 81
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 anfxv423bysection8crackslomalkaorg'

distance = 88
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 activerefreshv135build537crackslomalkaorg'

distance = 88
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 emailsv175crackslomalkaorg'

distance = 91
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 f22raptor1000510crackslomalkaorg'

distance = 91
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 aceftpv301crackslomalkaorg'

distance = 93
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 g3bayv104crackslomalkaorg'

distance = 94
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 flaxv140crackslomalkaorg'

distance = 95
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 f1racingsimcrackslomalkaorg'

distance = 154
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 pcad2001trial2fixedcrackslomalkaorg'

distance = 154
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 vscribesystemstwangv30crackslomalkaorg'

distance = 154
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 antechinuscodechameleonv11crackslomalkaorg'

distance = 154
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 activeskinv421crackslomalkaorg'

distance = 155
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 xecutorv14134046crackslomalkaorg'

distance = 155
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 ecampaignv297crackslomalkaorg'

distance = 155
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 andyv135serialcrackslomalkaorg'

distance = 156
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 activexmanagerv14crackslomalkaorg'

distance = 157
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 arcsoftmultimediaemailv3crackslomalkaorg'

distance = 157
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 fsecureinternetsecurity2005multilanguagecrackslomalkaorg'

distance = 177
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 ucautocamv21crackslomalkaorg'

distance = 177
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 ecampaignprofessionaleditionv2944byfffcrackslomalkaorg'

distance = 178
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 ashampoosnapyacrackslomalkaorg'

distance = 178
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 familytreemaker600crackslomalkaorg'

distance = 178
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 filesplitterdeluxe335crackcrackslomalkaorg'

distance = 178
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 alteros3dv10byelilacrackslomalkaorg'

distance = 179
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 activeskincontrolocxv352crackslomalkaorg'

distance = 179
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 analogshellcrackslomalkaorg'

distance = 179
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 advancedcallcenterv2310448crackslomalkaorg'

distance = 179
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 fastmenuv105newcrackslomalkaorg'

distance = 194
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 xcomserverv25097crackslomalkaorg'

distance = 194
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 acehtmlprov5002bypccrackslomalkaorg'

distance = 195
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 faxamaticvv96514crackslomalkaorg'

distance = 195
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 argosoftftpserverv1211crackslomalkaorg'

distance = 195
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 g6ftpserver20finalcrackslomalkaorg'

distance = 195
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 finansstudio144crackslomalkaorg'

distance = 195
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 advancedtaskmanager2002v22bytsrhcrackslomalkaorg'

distance = 195
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 asianviewerv11crackslomalkaorg'

distance = 195
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 armadillosectionsstripper121crackslomalkaorg'

distance = 196
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 abilitiesbuilderspellwordsv66crackslomalkaorg'

distance = 209
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 acqurlv50serialbylashcrackslomalkaorg'

distance = 209
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 atrisehtmlockv162byfreifall7crackslomalkaorg'

distance = 209
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 finditnowv20crackslomalkaorg'

distance = 209
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 adventuremakerv351build1crackslomalkaorg'

distance = 209
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 absolutesoundrecorderv325crackslomalkaorg'

distance = 210
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 emailseekerv17newcrackslomalkaorg'

distance = 210
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 emailextractorv21build05011bytntcrackslomalkaorg'

distance = 210
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 addremoveplus2003v401byfffcrackslomalkaorg'

distance = 210
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 activestateperldevkitv411crackslomalkaorg'

distance = 210
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 alphaballv11crackslomalkaorg'

distance = 225
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 windowsxpproductkeyviewercrackslomalkaorg'

distance = 226
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 fsecureantivirusforwindowsv540crackslomalkaorg'

distance = 226
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 fsecureantivirusformicrosoftexchangev631win20002003crackslomalkaorg'

distance = 226
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 fruitmachinesimulatorcrackslomalkaorg'

distance = 226
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 powerarchiver2003v87009crackslomalkaorg'

distance = 227
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 autocad2002crackslomalkaorg'

distance = 227
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 windowsxpservicepack2activatorcrackslomalkaorg'

distance = 227
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 filescannerprov16001byevidencecrackslomalkaorg'

distance = 227
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 arobfantasticmp3encoderv20crackcrackslomalkaorg'

distance = 227
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 xnetstatprofessionalv40crackslomalkaorg'

distance = 239
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 kasperskyantiviruspersonalv50xcrackslomalkaorg'

distance = 239
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 powerwmarecorderv122crackslomalkaorg'

distance = 239
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 aivostoprojectanalyzerv6004crackslomalkaorg'

distance = 240
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 advancedtexttospeechattsv35crackslomalkaorg'

distance = 240
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 fsprofilesystemcryptographicprotectorv113crackslomalkaorg'

distance = 241
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 privatedesktopv16crackslomalkaorg'

distance = 241
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 autoplaymenubuilderv35crackslomalkaorg'

distance = 241
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 agesfamilytreedatabasev121crackslomalkaorg'

distance = 241
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 powerageskysimulator20crackslomalkaorg'

distance = 242
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 angovemdbviewer20crackslomalkaorg'

distance = 256
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 emailrobberv102build2602crackslomalkaorg'

distance = 256
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 audioslimmerv1190byfhcfcrackslomalkaorg'

distance = 257
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 g6ftpserver20rc1keygencrackslomalkaorg'

distance = 257
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 audioslimmerv119crackslomalkaorg'

distance = 258
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 activestateperldevkitv411crackslomalkaorg'

distance = 258
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 appletpasswordwizardv30bytntcrackslomalkaorg'

distance = 258
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 advancedmp3wmarecorderv3086crackslomalkaorg'

distance = 259
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 activestatevisualpythonforvs2002v1812082crackslomalkaorg'

distance = 259
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 addremoveplus2002v32build320250crackslomalkaorg'

distance = 260
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 autoplaymenubuilderv41737bychiccrackslomalkaorg'

distance = 282
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 283
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 australiabestaddress2004profesionalcrackslomalkaorg'

distance = 283
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 abcomdimensov1310forautocadgermancrackslomalkaorg'

distance = 283
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 axialisiconworkshopv501corporateeditionnewcrackslomalkaorg'

distance = 284
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 powercardmakerv34bycafecrackslomalkaorg'

distance = 285
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 emailextractorexpressv20byfhcfcrackslomalkaorg'

distance = 285
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 powerarchiver2003v880betakeygenbyrevengecrackslomalkaorg'

distance = 286
spam score = 4
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 akalaexelockv320build31122bylashcrackslomalkaorg'

distance = 286
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 ubsellerv217germancrackslomalkaorg'

distance = 286
spam score = 3
title = 'm48 mobile 10 mks vir for mldownloader mmd 20 powerdefragpro200bytntcrackslomalkaorg'

distance = 39
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 f22raptor1002100rcrackslomalkaorg'

distance = 40
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 eiconsv334crackslomalkaorg'

distance = 43
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 ecampaignv30crackslomalkaorg'

distance = 51
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 almanacv300crackslomalkaorg'

distance = 59
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 flashgetv088crackslomalkaorg'

distance = 62
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 eplanpro35crackslomalkaorg'

distance = 62
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 g6renamer2000v141bycorecrackslomalkaorg'

distance = 63
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 ebook12crackslomalkaorg'

distance = 66
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 airlinetycoonv100crackslomalkaorg'

distance = 70
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 h3d10crackslomalkaorg'

distance = 70
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 g6renamer2000v14crackcrackslomalkaorg'

distance = 73
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 findv10crackslomalkaorg'

distance = 75
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 ecampaigncorporateeditionv2961crackslomalkaorg'

distance = 75
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fontsinmotionv10crackslomalkaorg'

distance = 78
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 filesharingv15crackslomalkaorg'

distance = 79
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 alignitv207keygencrackslomalkaorg'

distance = 80
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 androidcrackslomalkaorg'

distance = 86
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 ageneralpracticelibraryv20100crackslomalkaorg'

distance = 87
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 accessimagev240crackslomalkaorg'

distance = 90
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 serialslomalkaorg'

distance = 159
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 atrildejavu23crackslomalkaorg'

distance = 159
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 animatedscreenv60serialcrackslomalkaorg'

distance = 159
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 aircheckv220crackslomalkaorg'

distance = 159
spam score = 5
title = 's48 sms snagit smtp smtpto for snack sim bar 3 advicecalculator11crackcrackslomalkaorg'

distance = 160
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 adwareawayv224crackslomalkaorg'

distance = 160
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 agnitumoutpostfirewallprov20290crackslomalkaorg'

distance = 160
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 tagandrenamev20xpfixedcrackslomalkaorg'

distance = 161
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 automousev133crackslomalkaorg'

distance = 162
spam score = 5
title = 's48 sms snagit smtp smtpto for snack sim bar 3 powerclock412crackslomalkaorg'

distance = 162
spam score = 7
title = 's48 sms snagit smtp smtpto for snack sim bar 3 absolutesoundrecorderv329crackslomalkaorg'

distance = 177
spam score = 7
title = 's48 sms snagit smtp smtpto for snack sim bar 3 activerefreshv135build537crackslomalkaorg'

distance = 177
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 thesims2crackcrackslomalkaorg'

distance = 177
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 glockeasymail20087crackslomalkaorg'

distance = 178
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 uanimatorv10crackslomalkaorg'

distance = 178
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 agnitumjammerv200528crackslomalkaorg'

distance = 178
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 powerarchiver2001v702englishcrackslomalkaorg'

distance = 178
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 emailsv226frenchcrackslomalkaorg'

distance = 179
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 p2cpluspascalcompilerversion121ecrackslomalkaorg'

distance = 179
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 antipopupforiev110103crackslomalkaorg'

distance = 179
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 p2cpascalcompiler1236ecrackslomalkaorg'

distance = 195
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 gadugaduv60build154polishcrackslomalkaorg'

distance = 195
spam score = 7
title = 's48 sms snagit smtp smtpto for snack sim bar 3 almapagegenerator2crackslomalkaorg'

distance = 195
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 windowsxpantiproductactivationcrackcrackslomalkaorg'

distance = 195
spam score = 5
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fileconverterv20crackslomalkaorg'

distance = 196
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 filesyncforcev134byrealcrackslomalkaorg'

distance = 196
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 privacymasterv3982crackslomalkaorg'

distance = 196
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 kasperskyantiviruspersonalcrackslomalkaorg'

distance = 197
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 apolloversatileburnerv1220byucfcrackslomalkaorg'

distance = 197
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 aipictureutilityv454crackslomalkaorg'

distance = 197
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 windowsxp4in1keygenandchangeinfocrackslomalkaorg'

distance = 208
spam score = 7
title = 's48 sms snagit smtp smtpto for snack sim bar 3 acdimagefox20crackslomalkaorg'

distance = 209
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 activewhoisv202466crackslomalkaorg'

distance = 209
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 aemailspamfilterv20bymp2kcrackslomalkaorg'

distance = 209
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 namo310crackslomalkaorg'

distance = 209
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 f12000v10crackslomalkaorg'

distance = 209
spam score = 5
title = 's48 sms snagit smtp smtpto for snack sim bar 3 powervideoconverterv129crackslomalkaorg'

distance = 210
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fx2000v30crackslomalkaorg'

distance = 210
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fifa2004crackslomalkaorg'

distance = 210
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 actualtestscomcitrix1y0992examcheatsheetv81204crackslomalkaorg'

distance = 210
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 autoplaymenustudiov205crackslomalkaorg'

distance = 221
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fsprolabslockmypcv23crackslomalkaorg'

distance = 222
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fsecuresshclientv5454crackslomalkaorg'

distance = 222
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 flashfxpv20build905crackslomalkaorg'

distance = 222
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 arobfantasticmp3networkedencoderv14bycovecrackslomalkaorg'

distance = 222
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 antechinusmediaeditorv40bydbzcrackslomalkaorg'

distance = 222
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 activepenv10713crackslomalkaorg'

distance = 223
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 aplusfileprotectionv27crackslomalkaorg'

distance = 223
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 activexgltextv110crackslomalkaorg'

distance = 223
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 nagger1262crackslomalkaorg'

distance = 223
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 allwebmenusv12patchcrackslomalkaorg'

distance = 236
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fastmenuv20keyfilecrackslomalkaorg'

distance = 237
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 adventnetwebnmsprofessionalv470crackslomalkaorg'

distance = 237
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 avigifv109byfritmocrackslomalkaorg'

distance = 237
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 activeskinocxv43patchbydceptioncrackslomalkaorg'

distance = 237
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fsecureantivirusforfirewallsv601crackslomalkaorg'

distance = 237
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 privatesitesv3012021crackslomalkaorg'

distance = 238
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fruityloopsv33fullcrackslomalkaorg'

distance = 238
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 akoffmusiccomposerv20byalexnbcrackslomalkaorg'

distance = 238
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 animatetetbloxv12crackslomalkaorg'

distance = 238
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 firstinmathscrackslomalkaorg'

distance = 256
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 raastrobaticsv102crackslomalkaorg'

distance = 256
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 eiconsv325crackslomalkaorg'

distance = 256
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 activefaxserverv388build195germancrackslomalkaorg'

distance = 257
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 namescannerv14newcrackslomalkaorg'

distance = 257
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 akeywordthingv10101regfilecrackslomalkaorg'

distance = 257
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 ebookhtmlcompilerpro212crackslomalkaorg'

distance = 257
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 activeskinv425byulises2kcrackslomalkaorg'

distance = 258
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 amfdailyplannerandpersonalinformationmanagerpimv938crackslomalkaorg'

distance = 258
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 activewhoisbrowserv202466byheritagecrackslomalkaorg'

distance = 258
spam score = 5
title = 's48 sms snagit smtp smtpto for snack sim bar 3 powereditv11byfreifall7crackslomalkaorg'

distance = 281
spam score = 5
title = 's48 sms snagit smtp smtpto for snack sim bar 3 favoripperv30crackslomalkaorg'

distance = 282
spam score = 5
title = 's48 sms snagit smtp smtpto for snack sim bar 3 postprueferv4000109germancrackslomalkaorg'

distance = 283
spam score = 7
title = 's48 sms snagit smtp smtpto for snack sim bar 3 aesopgifcreatorv102302serialbydbccrackslomalkaorg'

distance = 283
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 fathzipcontrolforwin32v45crackslomalkaorg'

distance = 283
spam score = 5
title = 's48 sms snagit smtp smtpto for snack sim bar 3 privacyinspectorv151byfffcrackslomalkaorg'

distance = 284
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 aimg2pdfv110crackslomalkaorg'

distance = 284
spam score = 5
title = 's48 sms snagit smtp smtpto for snack sim bar 3 adwarexeliminatorv20datecode20040908crackslomalkaorg'

distance = 284
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 purgem2000v302crackslomalkaorg'

distance = 284
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 futuremarkpcmark04prov110crackslomalkaorg'

distance = 285
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 privatenursecrackslomalkaorg'

distance = 341
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 privatedesktopv16bynatabeccrackslomalkaorg'

distance = 341
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 ahandyaddressbookserverv11crackslomalkaorg'

distance = 348
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 avimpegrmwmvjoinerv461crackslomalkaorg'

distance = 357
spam score = 7
title = 's48 sms snagit smtp smtpto for snack sim bar 3 actualtestscomoracle1z0501examcheatsheetv41404crackslomalkaorg'

distance = 358
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 aareavitovcddvdsvcdmpegconverterv40crackslomalkaorg'

distance = 360
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 appliedflowtechnologyaftfathomv5020030805winalldonglecrackedcrackslomalkaorg'

distance = 372
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 alarmmasterplusv496forwin9xment2kcrackslomalkaorg'

distance = 388
spam score = 6
title = 's48 sms snagit smtp smtpto for snack sim bar 3 adobephotoshopandimagereadycsv801tryoutmultilanguagefixedcrackslomalkaorg'

distance = 58
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend arfive112crackslomalkaorg'

distance = 62
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend ecapturerv206crackslomalkaorg'

distance = 64
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend ntrackstudiov301build1211crackslomalkaorg'

distance = 70
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend fortrancompilerv81crackslomalkaorg'

distance = 70
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend aboveandbeyond20031406crackslomalkaorg'

distance = 74
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend alarmclock2000v6080crackslomalkaorg'

distance = 76
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activeskinv422crackslomalkaorg'

distance = 82
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend aircheckv220crackslomalkaorg'

distance = 83
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend f22raptor1002100rcrackslomalkaorg'

distance = 84
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend antaresv901120crackslomalkaorg'

distance = 86
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend adayinthelifev151keygencrackslomalkaorg'

distance = 86
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend adwareawayv226crackslomalkaorg'

distance = 89
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend frigatev127crackslomalkaorg'

distance = 90
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activerefreshv136build551crackslomalkaorg'

distance = 91
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend accessfoldersv162crackslomalkaorg'

distance = 91
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend ntrackstudiov30crackslomalkaorg'

distance = 95
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend faxamaticva93701crackslomalkaorg'

distance = 96
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend freespacev100crackslomalkaorg'

distance = 97
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend acetranslatorv22crackslomalkaorg'

distance = 98
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend fobozv152crackslomalkaorg'

distance = 156
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend filerecoveryprov30build1219crackslomalkaorg'

distance = 156
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend achristmasatsantasv29crackslomalkaorg'

distance = 156
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend a1dvdaudioripperv1142crackslomalkaorg'

distance = 156
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activewhoisv212591crackslomalkaorg'

distance = 157
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend oddinfaust2000v55crackslomalkaorg'

distance = 157
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend finderskeepersv1crackslomalkaorg'

distance = 158
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend finalwayv131build20011010crackslomalkaorg'

distance = 158
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activexmanagerv13bypccrackslomalkaorg'

distance = 159
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend ppingtools26crackslomalkaorg'

distance = 161
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend afsmulticash105crackslomalkaorg'

distance = 177
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend algolabphotovectorv125crackslomalkaorg'

distance = 177
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend algebraoneononev40bydestinationcrackslomalkaorg'

distance = 178
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend powercryptov14crackslomalkaorg'

distance = 178
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend emailextractorexpressv210511serialcrackslomalkaorg'

distance = 178
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend fishsoftmosaicsaverv10crackslomalkaorg'

distance = 179
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend atomsyncprov201crackslomalkaorg'

distance = 179
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend animatedgifeditor95v10crackslomalkaorg'

distance = 179
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend fineprintenterprisev526germancrackslomalkaorg'

distance = 179
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend aplusfilenamingsystemv110crackslomalkaorg'

distance = 181
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend animagicgifanimatorv122apatchcrackslomalkaorg'

distance = 194
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend powervideoconverterv128crackslomalkaorg'

distance = 194
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend privacyinspectorv151byarcticcrackslomalkaorg'

distance = 195
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activexmanagerv13bytntcrackslomalkaorg'

distance = 195
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend foodservicesreportingsystemv141crackslomalkaorg'

distance = 195
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend folderlockv5crackslomalkaorg'

distance = 195
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend rdriveimagev111114crackslomalkaorg'

distance = 195
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend apolloversatileaudioanddataburnerv10crackslomalkaorg'

distance = 195
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend facefilterstandardv10crackslomalkaorg'

distance = 195
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend fileaudioprocessorv3470crackslomalkaorg'

distance = 198
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend halloweenslotscrackslomalkaorg'

distance = 211
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend powereditv203crackslomalkaorg'

distance = 211
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend anconiarocketsalesv15276crackslomalkaorg'

distance = 211
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend kasperskyantiviruspersonalv50xcrackbybadmentalcrackslomalkaorg'

distance = 212
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend emailextractorexpressv20byfhcfcrackslomalkaorg'

distance = 212
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activexmanagerv14byfhcfcrackslomalkaorg'

distance = 212
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend purgeiev601build610235crackslomalkaorg'

distance = 212
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend albumgeneratorandviewerv2030byenfusiacrackslomalkaorg'

distance = 213
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend oceanlifescreensaverv11crackslomalkaorg'

distance = 213
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend amichartv1455crackslomalkaorg'

distance = 213
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend kasperskyantiviruspersonalv50227keygenfilecrackslomalkaorg'

distance = 226
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend fprotantivirusforwindowsv307crackslomalkaorg'

distance = 226
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend aimtoolbarinternetedition30crackslomalkaorg'

distance = 227
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend spywaredoctorv310312serialbyart3amcrackslomalkaorg'

distance = 227
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend pacdoomv121bytntcrackslomalkaorg'

distance = 227
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend privacyguardv40crackslomalkaorg'

distance = 228
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend purchaseorderorganizerdeluxev22crackslomalkaorg'

distance = 228
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activexmanagerv14byamokcrackslomalkaorg'

distance = 228
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend privacyguardv20byhdhcrackslomalkaorg'

distance = 228
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend ecampaignv2961crackslomalkaorg'

distance = 228
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend emailextractorexpressv20byelilacrackslomalkaorg'

distance = 239
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend allalivemediasoftwarecrackslomalkaorg'

distance = 239
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend powerwebsitebuilderv150bydigeraticrackslomalkaorg'

distance = 239
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend privateeyev12bylashcrackslomalkaorg'

distance = 239
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend nerodvdvideoplugincrackslomalkaorg'

distance = 239
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend fastmenuv105bydbccrackslomalkaorg'

distance = 240
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend autoplaymenustudiov3001crackslomalkaorg'

distance = 241
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend puzzlechampionv1030215bytmgcrackslomalkaorg'

distance = 241
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activeskinv41bycorecrackslomalkaorg'

distance = 242
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend ashampoomp3audiocenterv150bycimcrackslomalkaorg'

distance = 242
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend tagandrenamev20xpfixedcrackslomalkaorg'

distance = 259
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend privatepixv14crackslomalkaorg'

distance = 260
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend privatepixv211byeminencecrackslomalkaorg'

distance = 261
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend powerarchiver2004v90033byrifcrackslomalkaorg'

distance = 261
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend avigifv105bylashcrackslomalkaorg'

distance = 262
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend fprotantivirusv312cbyfreeze1crackslomalkaorg'

distance = 262
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend facefilterstandardv10008192crackslomalkaorg'

distance = 263
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend posterv75acrackslomalkaorg'

distance = 263
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend proxyv240184crackslomalkaorg'

distance = 263
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend avigifv109bynucleoncrackslomalkaorg'

distance = 264
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend windowsxpservicepack2activatorcrackbyhjcrackslomalkaorg'

distance = 287
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend absolutetelnetclient184crackslomalkaorg'

distance = 287
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activemp3activexcontrol17crackslomalkaorg'

distance = 288
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend powerclock407crackslomalkaorg'

distance = 288
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend kasperskyantiviruspersonalprocrackslomalkaorg'

distance = 289
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend protectx402crackslomalkaorg'

distance = 289
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend activestatekomodoprofessionalv25178606crackslomalkaorg'

distance = 291
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend qdcatv211acrackslomalkaorg'

distance = 292
spam score = 3
title = 'p12 paraben s papercut paq quota papier calend protectxprofessionaleditionv411patchcrackslomalkaorg'

distance = 293
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend pcad2002trialbuild170050crackslomalkaorg'

distance = 293
spam score = 4
title = 'p12 paraben s papercut paq quota papier calend actualtestscomcisco9e0851examcheatsheetv102104crackslomalkaorg'

distance = 27
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh alignitv12crackslomalkaorg'

distance = 28
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh xexev12russiancrackslomalkaorg'

distance = 33
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh finditprov40bysevencrackslomalkaorg'

distance = 43
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh airnavv310crackslomalkaorg'

distance = 52
spam score = 15
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh alwaysontimev10112crackslomalkaorg'

distance = 54
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh g3bayv104crackslomalkaorg'

distance = 58
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activewhoisv212591crackslomalkaorg'

distance = 59
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh finetunev141crackslomalkaorg'

distance = 59
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh aspenv10crackslomalkaorg'

distance = 60
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh frigatev127crackslomalkaorg'

distance = 61
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh friendsbase102crackslomalkaorg'

distance = 64
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh ebackup14byeaglecrackslomalkaorg'

distance = 67
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh tabitv158crackslomalkaorg'

distance = 67
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh galaxyjourney3dv11crackslomalkaorg'

distance = 76
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh farv163crackslomalkaorg'

distance = 76
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh finditv107crackslomalkaorg'

distance = 77
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activeskinv421crackslomalkaorg'

distance = 78
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh aisbackupv180181crackslomalkaorg'

distance = 79
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh keygenslomalkaorg'

distance = 79
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh adayinthelifev15crackcrackslomalkaorg'

distance = 157
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh tabmailv12810crackslomalkaorg'

distance = 157
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh frostbowhomeinventory301crackslomalkaorg'

distance = 157
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh packplus210crackslomalkaorg'

distance = 157
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activestatetclprov1502crackslomalkaorg'

distance = 158
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh autoplayerv2034crackslomalkaorg'

distance = 158
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh arialsoundrecorderv116byorioncrackslomalkaorg'

distance = 158
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh fastmenuv104newcrackslomalkaorg'

distance = 158
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh gagexv45411crackslomalkaorg'

distance = 158
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh qrecovery98v126build190crackslomalkaorg'

distance = 158
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh filepulverizer5crackslomalkaorg'

distance = 175
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh adressesv30frenchcrackslomalkaorg'

distance = 175
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh findgraphv139crackslomalkaorg'

distance = 175
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh ebookhtmlcompilerpro212ieversioncrackslomalkaorg'

distance = 175
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh avconvertervideoconverterv2114crackslomalkaorg'

distance = 175
spam score = 17
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activerefreshv134build531crackslomalkaorg'

distance = 175
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh fastmenuv107crackslomalkaorg'

distance = 175
spam score = 15
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh auqiosoundstudiov20crackslomalkaorg'

distance = 176
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh acedvdbackupv1215bydustcrackslomalkaorg'

distance = 177
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh aspv26crackslomalkaorg'

distance = 177
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh alfaclockv170byrevengecrackslomalkaorg'

distance = 190
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh finalbuilderv205461crackslomalkaorg'

distance = 190
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh adailybackupv350crackslomalkaorg'

distance = 190
spam score = 15
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh antibosskeyv382crackslomalkaorg'

distance = 190
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh animatenaturescreensaverv101crackslomalkaorg'

distance = 190
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh allcleanerv22crackslomalkaorg'

distance = 192
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh hamhelper12crackslomalkaorg'

distance = 192
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh abfoutlookbackup22061crackslomalkaorg'

distance = 192
spam score = 15
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh allfcodersoftwareproductscrackslomalkaorg'

distance = 192
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh fritzefisch265crackslomalkaorg'

distance = 192
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh tab2desk2110crackslomalkaorg'

distance = 208
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh audioslimmerv1152crackslomalkaorg'

distance = 208
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh advancedregistrytracerv10acrackslomalkaorg'

distance = 208
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh nameityourwayniyowv141bycafecrackslomalkaorg'

distance = 208
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh appsprotectorxpbyfffcrackslomalkaorg'

distance = 208
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh fprotantivirusv312ccrackslomalkaorg'

distance = 208
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activexmanagerv14byphaze2002crackslomalkaorg'

distance = 208
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh ahandyaddressbookserverv10crackslomalkaorg'

distance = 208
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh addremoveplus2002v300146byeminencecrackslomalkaorg'

distance = 209
spam score = 16
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activerefresh131build509crackslomalkaorg'

distance = 209
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh xnetstatprofessionalv40crackslomalkaorg'

distance = 223
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh autosort13keygencrackslomalkaorg'

distance = 223
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh advancedmp3wmarecorderv376crackslomalkaorg'

distance = 223
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh arobfantasticmp3encoderv13bycorecrackslomalkaorg'

distance = 224
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh windowsxphomeeditionactivationcrackcrackslomalkaorg'

distance = 224
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activexmanagerv14byfhcfcrackslomalkaorg'

distance = 224
spam score = 15
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh adwareagentv41acrackslomalkaorg'

distance = 224
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh autoerrorhandler264crackslomalkaorg'

distance = 224
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh argusdistibutionnetworkv3128crackslomalkaorg'

distance = 224
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh foobar104crackslomalkaorg'

distance = 225
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh firehandemberprov394crackslomalkaorg'

distance = 241
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh ahsplitv10bymetamorfercrackslomalkaorg'

distance = 241
spam score = 15
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh ageneralpracticelibraryv2099crackslomalkaorg'

distance = 241
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh fastreportv24crackslomalkaorg'

distance = 241
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh accesspasswordrecoverv162crackslomalkaorg'

distance = 241
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh avigifv106bylashcrackslomalkaorg'

distance = 242
spam score = 15
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh adcreatorv121crackslomalkaorg'

distance = 242
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh oasisprov1300crackslomalkaorg'

distance = 242
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh qimage1102crackslomalkaorg'

distance = 242
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh xdvdripperv1180bytsrhcrackslomalkaorg'

distance = 242
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh alapimageportv132forquarkxpresscrackslomalkaorg'

distance = 264
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh serialslomalkaorg'

distance = 264
spam score = 15
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh ashampoowinoptimizerplatinumsuitev113bynhgcrackslomalkaorg'

distance = 264
spam score = 17
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activerefreshv136build551bytsrhcrackslomalkaorg'

distance = 264
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh xaudiovideojoinerv121126crackslomalkaorg'

distance = 265
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh vampirethemasqueraderedemptionv11crackslomalkaorg'

distance = 266
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh fprotantivirusv312dbyevidencecrackslomalkaorg'

distance = 266
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 266
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activeskinv423crackslomalkaorg'

distance = 266
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh fsecuresshclientv540japanesecrackslomalkaorg'

distance = 267
spam score = 16
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh actualtestscommicrosoft070015examcheatsheetv112003crackslomalkaorg'

distance = 290
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh alphanotesv10keygenbydbccrackslomalkaorg'

distance = 290
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh windowsxpactivationandreactivationbyruteamcrackslomalkaorg'

distance = 291
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh fotoslatev30126byhtbteamcrackslomalkaorg'

distance = 292
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh advancedrarpasswordrecoveryv10build45crackslomalkaorg'

distance = 293
spam score = 15
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh activeshopperaspcomponent10crackslomalkaorg'

distance = 293
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh aaerusiconcommanderv114crackslomalkaorg'

distance = 295
spam score = 13
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh aardvarkcompareforvb1088crackslomalkaorg'

distance = 295
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh atropossb20030909crackslomalkaorg'

distance = 295
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh alphaballv10trainercrackslomalkaorg'

distance = 295
spam score = 14
title = 'l19 lp ripper ls loupe 2000 dyna3d pro lottowh aggressorexploitgenerator085byfhcfcrackslomalkaorg'

distance = 20
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima ebookv1001crackslomalkaorg'

distance = 42
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima eiconsv415crackslomalkaorg'

distance = 55
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima arealvalidatorcrackslomalkaorg'

distance = 62
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima faxamaticv93901crackslomalkaorg'

distance = 63
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima pcpolicev100crackslomalkaorg'

distance = 64
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima r4v108crackslomalkaorg'

distance = 64
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima rstudio20crackslomalkaorg'

distance = 64
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima finditgrid153crackslomalkaorg'

distance = 65
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima emanagerv35b08crackslomalkaorg'

distance = 65
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima ecampaignv2961crackslomalkaorg'

distance = 67
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fireflyv101crackslomalkaorg'

distance = 70
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima acehtmlprov5011crackslomalkaorg'

distance = 71
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima galaxyjourney3dv11crackslomalkaorg'

distance = 72
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima activexmanagerv14crackslomalkaorg'

distance = 73
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima allconverterv402crackslomalkaorg'

distance = 73
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima accessadministratorprov34crackslomalkaorg'

distance = 75
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima filesplitprov20keygencrackslomalkaorg'

distance = 76
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima keygenslomalkaorg'

distance = 77
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima uwipev14crackslomalkaorg'

distance = 77
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima awiconsv903crackslomalkaorg'

distance = 144
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima abridgeinsertv11529crackslomalkaorg'

distance = 144
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima aatomictimesyncv340crackslomalkaorg'

distance = 145
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima atoumathv21crackslomalkaorg'

distance = 145
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima vthefileviewerv2000crackslomalkaorg'

distance = 145
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima findgraphv139crackslomalkaorg'

distance = 145
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima airmessengerprov406bytcacrackslomalkaorg'

distance = 146
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fsecureantivirusv54xcrackslomalkaorg'

distance = 146
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima ageneralpracticelibraryv20100crackslomalkaorg'

distance = 146
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima thesims2crackcrackslomalkaorg'

distance = 146
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima adotmessv30crackslomalkaorg'

distance = 164
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima finditv303crackslomalkaorg'

distance = 164
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fcutterv160keygencrackslomalkaorg'

distance = 164
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima pi2004editionsr1v8060014crackslomalkaorg'

distance = 164
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima agnitumoutpostfirewallprov1014201815crackslomalkaorg'

distance = 164
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima foreign31forpalmoscrackslomalkaorg'

distance = 164
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fruitmachinev13javacrackslomalkaorg'

distance = 164
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima avemariapokerv20crackslomalkaorg'

distance = 164
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima atdeditv1133crackslomalkaorg'

distance = 164
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima ubwdreamcatcherv610germancrackslomalkaorg'

distance = 164
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima eiconsv316crackslomalkaorg'

distance = 183
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fontsubstv141forpalmoscrackslomalkaorg'

distance = 183
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima arobfantasticmp3networkedencoderv14crackslomalkaorg'

distance = 183
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima glockeasymail20087crackslomalkaorg'

distance = 184
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima ecampaigncorporateeditionv4815crackslomalkaorg'

distance = 184
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima powerageskysimulatorv30crackslomalkaorg'

distance = 184
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima privatebookmarksv32bytexcrackslomalkaorg'

distance = 184
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima filemakerserverv7crackslomalkaorg'

distance = 184
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima purgeiev301crackslomalkaorg'

distance = 184
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima freespacev160crackslomalkaorg'

distance = 184
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima activewhoisv212591crackslomalkaorg'

distance = 196
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima advancedregistrytracerv162bytsrhcrackslomalkaorg'

distance = 197
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima emailalertv1019bylashcrackslomalkaorg'

distance = 197
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima pacdoom121crackslomalkaorg'

distance = 197
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima foratomicsynchronizationv11000crackcrackslomalkaorg'

distance = 197
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fireburnerv217bytctcrackslomalkaorg'

distance = 197
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima avigifv109crackslomalkaorg'

distance = 198
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima animalsfromafricascreensaverv13crackslomalkaorg'

distance = 198
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima accessanimationv160byeclipsecrackslomalkaorg'

distance = 198
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima alfaclockv160bydynamitecrackslomalkaorg'

distance = 199
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima adayinthelife15crackslomalkaorg'

distance = 213
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima ateramaxplusiiv93crackslomalkaorg'

distance = 213
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima windowsxpprocrackslomalkaorg'

distance = 213
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima friendsandfamilytrackerv10crackslomalkaorg'

distance = 213
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima activepenv10713crackslomalkaorg'

distance = 214
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima animagicgifanimatorlitev110crackslomalkaorg'

distance = 214
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima adsalertv10crackslomalkaorg'

distance = 215
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fasoftntrackstudio24biteditionv401691crackslomalkaorg'

distance = 215
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima ashampoowinoptimizerplatinumsuitev125crackslomalkaorg'

distance = 215
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima filesplitv23build412bytsrhcrackslomalkaorg'

distance = 215
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima activepdfportfolioprofessional35crackslomalkaorg'

distance = 229
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fullscreen2000rel010300crackslomalkaorg'

distance = 229
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima powereditv202acrackslomalkaorg'

distance = 230
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima adpurgerv100bfixedcrackslomalkaorg'

distance = 230
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima activebarxplookbuild25011crackslomalkaorg'

distance = 231
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima accessimagev400crackslomalkaorg'

distance = 231
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima axialisaxcursorv45crackslomalkaorg'

distance = 232
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima reallusionfacefilterv105181studioeditioncrackslomalkaorg'

distance = 232
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima appstrakav201bytexcrackslomalkaorg'

distance = 233
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima acevideoworkshopv1435crackslomalkaorg'

distance = 233
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima faxmailnetworkforwindowsvn96401crackslomalkaorg'

distance = 251
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima powerdvdv60byparadoxcrackslomalkaorg'

distance = 251
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fishfastinteractivesqlhelperv333229crackslomalkaorg'

distance = 251
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima audioslimmerv1152bydbzcrackslomalkaorg'

distance = 251
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima addressorganizer16bit21byfhcfcrackslomalkaorg'

distance = 251
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima halocombatevolvedprivateserverpatchbyfairlightcrackslomalkaorg'

distance = 252
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima animatedscreenv221spanishbyfhcfcrackslomalkaorg'

distance = 253
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima gdatadavideocrackslomalkaorg'

distance = 254
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima pacestarlanflowv4191790crackslomalkaorg'

distance = 254
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima alpineloopcoloradoscreensaver11crackslomalkaorg'

distance = 255
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima octetstringvdedirectorysuitev30solariscrackslomalkaorg'

distance = 280
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima namowebcanvassuitev110107trialchinesecrackslomalkaorg'

distance = 280
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima purgatioprov50acrackslomalkaorg'

distance = 281
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima emailextractorexpressv210511regfilecrackslomalkaorg'

distance = 283
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima posterv77acrackslomalkaorg'

distance = 283
spam score = 12
title = 'i14 imarkup pro imagesitegrabber imagewolf ima altarxonixv10bypizzacrackslomalkaorg'

distance = 284
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fsecureantivirusformicrosoftexchangewithspamcontrolv631crackslomalkaorg'

distance = 284
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fileviewactivexcontrolv41byfhcfcrackslomalkaorg'

distance = 285
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima privatedesktopv19bynatabeccrackslomalkaorg'

distance = 285
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima antiviruskasperskypersonalpro5xfixedcrackslomalkaorg'

distance = 286
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima powerarchiver2004v9031finalcrackslomalkaorg'

distance = 353
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima angelkeyswindowsmidicontrollersoftwarev20crackslomalkaorg'

distance = 355
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima powerageskysimulator20crackslomalkaorg'

distance = 360
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima argosoftftpserverforwindowsv1420crackslomalkaorg'

distance = 366
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima windows2003andwindowsxpsp2antiproductactivationcrackv12crackslomalkaorg'

distance = 368
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima aareavitovcddvdsvcdmpegconverterv40byorioncrackslomalkaorg'

distance = 377
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima ashampoouninstallerplatinumsuitev1000multilanguagecrackslomalkaorg'

distance = 388
spam score = 11
title = 'i14 imarkup pro imagesitegrabber imagewolf ima fprotantivirusforwindowsv311apatchbytntcrackslomalkaorg'

distance = 399
spam score = 10
title = 'i14 imarkup pro imagesitegrabber imagewolf ima postmortemencephalumreanimatorper10byamokcrackslomalkaorg'

distance = 1829
spam score = 69
title = 'center school'

distance = 33
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp kmailv39275crackslomalkaorg'

distance = 41
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp frigatev301658crackslomalkaorg'

distance = 42
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp alp19ecrackslomalkaorg'

distance = 51
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp r2v507hcrackslomalkaorg'

distance = 53
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp eplanpro30crackslomalkaorg'

distance = 56
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp ascv30crackslomalkaorg'

distance = 58
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp ebiurov1000crackslomalkaorg'

distance = 60
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp actualdrawingv5xcrackslomalkaorg'

distance = 62
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aaalogov110crackslomalkaorg'

distance = 67
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp albumprov81crackslomalkaorg'

distance = 70
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aprcalcv40111crackslomalkaorg'

distance = 77
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp adayinthelifev15crackslomalkaorg'

distance = 78
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp actualwebalbumv10crackslomalkaorg'

distance = 83
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp eiconsv325crackslomalkaorg'

distance = 90
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp famosroboticv611icrackslomalkaorg'

distance = 91
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp epop203123crackslomalkaorg'

distance = 94
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp accessimagev232crackslomalkaorg'

distance = 94
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp absolutememoryv14crackcrackslomalkaorg'

distance = 96
spam score = 9
title = 'b18 beyond compare bible build bibble betterjp accessimagev261bytntcrackslomalkaorg'

distance = 96
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp pacchapv091crackslomalkaorg'

distance = 154
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp auctionsentryv230crackslomalkaorg'

distance = 154
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp alphaballv12byorioncrackslomalkaorg'

distance = 155
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aptschedulerv135crackslomalkaorg'

distance = 155
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp favoripper30crackslomalkaorg'

distance = 156
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aprs251crackslomalkaorg'

distance = 156
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp ebackup10byfocccrackslomalkaorg'

distance = 157
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp pacdoomv121bylashcrackslomalkaorg'

distance = 157
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp autopilotv206crackslomalkaorg'

distance = 157
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp b3webwizardsv203146crackslomalkaorg'

distance = 157
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp findv261crackslomalkaorg'

distance = 175
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp filerenamerv109bydbzcrackslomalkaorg'

distance = 175
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp aipictureexplorer452063crackslomalkaorg'

distance = 175
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp gadugaduv4030crackslomalkaorg'

distance = 175
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp acetranslatorv22bytsrhcrackslomalkaorg'

distance = 175
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp animatedcursorv100ccrackslomalkaorg'

distance = 176
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp apollodvdcopy462crackslomalkaorg'

distance = 176
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp emageforwebv12134crackslomalkaorg'

distance = 176
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp arialaudioconverterv202bymp2kcrackslomalkaorg'

distance = 176
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp ghackerv20crackslomalkaorg'

distance = 177
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp fastmenuv106crackslomalkaorg'

distance = 191
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp amichartv150byorioncrackslomalkaorg'

distance = 192
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp foldermaker20crackslomalkaorg'

distance = 192
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp qacoachv2235crackslomalkaorg'

distance = 192
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp accessadministratorv141bytntcrackslomalkaorg'

distance = 193
spam score = 9
title = 'b18 beyond compare bible build bibble betterjp activerefreshv136build551bytsrhcrackslomalkaorg'

distance = 193
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp arealvalidatorv111serialbyamokcrackslomalkaorg'

distance = 193
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp rstudionetworkedition30crackslomalkaorg'

distance = 193
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp facemailv10bycovecrackslomalkaorg'

distance = 194
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp friendsbase10byelilacrackslomalkaorg'

distance = 194
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp antechinuscsharpeditorv6xgenericcrackslomalkaorg'

distance = 208
spam score = 9
title = 'b18 beyond compare bible build bibble betterjp activerefresh136build551crackslomalkaorg'

distance = 208
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aceutilities165crackslomalkaorg'

distance = 209
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp atlasducielv70crackslomalkaorg'

distance = 209
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp tagandrenamev20build2bytsrhcrackslomalkaorg'

distance = 209
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp filetimeedit2v206bydigeraticrackslomalkaorg'

distance = 209
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp editorv30crackslomalkaorg'

distance = 209
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp absoluteprotectprov232crackslomalkaorg'

distance = 210
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp arealvalidatorv111byfffcrackslomalkaorg'

distance = 210
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp editorv30bymp2kcrackslomalkaorg'

distance = 210
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp editorv30byf4cgcrackslomalkaorg'

distance = 222
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp freeramv165xpluscrackslomalkaorg'

distance = 222
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp advancedregistryspyv17byevidencecrackslomalkaorg'

distance = 222
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp akeywordthingv10101keygencrackslomalkaorg'

distance = 222
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp angeltuner11crackslomalkaorg'

distance = 223
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp appletslidingmenuwizardv10bydbccrackslomalkaorg'

distance = 223
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp ancestralauthorv20bcrackslomalkaorg'

distance = 224
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp folderguardprofessionalv60crackslomalkaorg'

distance = 224
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp aatomictimesyncv371crackslomalkaorg'

distance = 224
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp advancedtetric351crackslomalkaorg'

distance = 224
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp ecard37crackslomalkaorg'

distance = 238
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp absolutesecurityprov37serialbytntcrackslomalkaorg'

distance = 239
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp activestatetcldevkitv261crackslomalkaorg'

distance = 239
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp odbcexplorerv10bytnocrackslomalkaorg'

distance = 239
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp autorunarchitectv210crackslomalkaorg'

distance = 239
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp ativapronetmeterv316crackslomalkaorg'

distance = 239
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp fileslicerv20serialbytntcrackslomalkaorg'

distance = 239
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp pacdoomiiihalloweenv10crackslomalkaorg'

distance = 240
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp adobeindesigncev201crackslomalkaorg'

distance = 241
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aplusfileprotectionv2101crackslomalkaorg'

distance = 241
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp activestateperldevkitv411crackslomalkaorg'

distance = 259
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp appletmenuwizardv20bydbccrackslomalkaorg'

distance = 259
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp activestartupv112build57crackslomalkaorg'

distance = 259
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp ageofsails2v153betaupdatecrackslomalkaorg'

distance = 259
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp faststatsanalyzerv277crackslomalkaorg'

distance = 260
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp aatomictimesyncv340crackslomalkaorg'

distance = 260
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp advancedregistrycleanerv2110123crackslomalkaorg'

distance = 260
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp anfxv4323crackslomalkaorg'

distance = 261
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp asterixgallicwarstrainercrackslomalkaorg'

distance = 261
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp activexmanagerv13bycokecrackslomalkaorg'

distance = 262
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp nabocorpcam2pcv443crackslomalkaorg'

distance = 290
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp gadugaduallversionsbannerkiller2v14byunrealcrackslomalkaorg'

distance = 290
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp activestatevisualpythonforvs2002v1812082crackslomalkaorg'

distance = 291
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aesopgifcreatorv15349bynatabeccrackslomalkaorg'

distance = 292
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp akmailv30byskywalkercrackslomalkaorg'

distance = 293
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp fishfastinteractivesqlhelperv333229crackslomalkaorg'

distance = 293
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp activesizerbydatadynamicscrackslomalkaorg'

distance = 294
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp flashfxpv30build1015pl1lightcrackslomalkaorg'

distance = 297
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp galacticcivilizationsiidreadlordsplus5trainercrackslomalkaorg'

distance = 297
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp activeskinv425byulises2kcrackslomalkaorg'

distance = 298
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fsecuresshclientv51crackslomalkaorg'

distance = 348
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp avimpegrmwmvjoinerv461bytsrhcrackslomalkaorg'

distance = 353
spam score = 9
title = 'b18 beyond compare bible build bibble betterjp actualtestscomcitrix1y0118examcheatsheetv112203crackslomalkaorg'

distance = 358
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp acousticamp3towaveconvertorplusv203bythesupremecrackslomalkaorg'

distance = 359
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp namowebeditorv402byamokcrackslomalkaorg'

distance = 361
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp fastmenuv105bydbccrackslomalkaorg'

distance = 367
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp osadobephotoshopcs2tryouttofullactivationkeygenbyoscoriacrackslomalkaorg'

distance = 380
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp activeskincontrolocxv40crackslomalkaorg'

distance = 398
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp favoaudioconverterv50byfffcrackslomalkaorg'

distance = 418
spam score = 9
title = 'b18 beyond compare bible build bibble betterjp actualtestscommicrosoftmose2eexamcheatsheetv101304crackslomalkaorg'

distance = 46
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex gtunev220crackslomalkaorg'

distance = 48
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex p2cwv11crackslomalkaorg'

distance = 49
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex frommykitchen211crackslomalkaorg'

distance = 57
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex accesstosystemv30crackslomalkaorg'

distance = 61
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex editorv201crackslomalkaorg'

distance = 63
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex abfallkosten2004137crackslomalkaorg'

distance = 66
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex abovebeyond2000crackslomalkaorg'

distance = 68
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex qacoachv2238crackslomalkaorg'

distance = 69
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex autositegalleryv15crackslomalkaorg'

distance = 71
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex fivev272bynatabeccrackslomalkaorg'

distance = 78
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex g6utilitiesv17027crackslomalkaorg'

distance = 79
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex fa18hornetv30crackslomalkaorg'

distance = 79
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex archicadinternationalv80crackslomalkaorg'

distance = 80
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex address2000v550vcrackslomalkaorg'

distance = 81
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex adamtheinsidestorycrackslomalkaorg'

distance = 81
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex activefaxv385build0192crackslomalkaorg'

distance = 83
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex fcutterv160serialcrackslomalkaorg'

distance = 85
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex ripv109crackslomalkaorg'

distance = 87
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex fprotv312acrackslomalkaorg'

distance = 87
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex animatedscreenv60crackslomalkaorg'

distance = 154
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex freememprofessionalv52crackslomalkaorg'

distance = 154
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex aaarealrecorderv170byfhcfcrackslomalkaorg'

distance = 154
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex amiquotev169serialbyinfectedcrackslomalkaorg'

distance = 154
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex flashgetv096abylashcrackslomalkaorg'

distance = 155
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex fileprotectorv101crackslomalkaorg'

distance = 155
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex ebackup14byeaglecrackslomalkaorg'

distance = 155
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex aepryuscalculatorv1xcrackslomalkaorg'

distance = 156
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex puzzlegamesforwin31crackslomalkaorg'

distance = 157
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex fircfrenchcrackslomalkaorg'

distance = 157
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex arealvalidatorv111serialbyamokcrackslomalkaorg'

distance = 177
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex fileshredder2000v32v33crackslomalkaorg'

distance = 177
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex appointmentbooknetworkversionv351crackslomalkaorg'

distance = 177
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex fabioliveatbbcradio1crackslomalkaorg'

distance = 178
spam score = 11
title = 'z6 zealotsoft video all zeiterfassung zend ex activepagerv10crackslomalkaorg'

distance = 178
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex antechinusmediaeditorv40bytmgcrackslomalkaorg'

distance = 178
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex assetandequipmenttrackingsystemv15crackslomalkaorg'

distance = 178
spam score = 11
title = 'z6 zealotsoft video all zeiterfassung zend ex amazingblocksallversionscrackslomalkaorg'

distance = 178
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex fileslicer10crackslomalkaorg'

distance = 178
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex firmtoolsalbumcreatorprov33crackslomalkaorg'

distance = 178
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex protectx416crackslomalkaorg'

distance = 191
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex flashrenamerv461crackslomalkaorg'

distance = 191
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex forwardmailv277crackcrackslomalkaorg'

distance = 192
spam score = 11
title = 'z6 zealotsoft video all zeiterfassung zend ex allgregorybraunproductsuniversalkeygencrackslomalkaorg'

distance = 192
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex privateeyev12crackslomalkaorg'

distance = 192
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex allwebmenusv13build360byevccrackslomalkaorg'

distance = 193
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex windowsxpantiproductactivationcrackcrackslomalkaorg'

distance = 193
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex eiconsv316crackslomalkaorg'

distance = 193
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex nameityourwayniyowv130bycafecrackslomalkaorg'

distance = 193
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex pinnaclestudioplusv932crackslomalkaorg'

distance = 193
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex actualspyv171112repackedcrackslomalkaorg'

distance = 207
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex pinnaclestudioplusv93248unlockercrackslomalkaorg'

distance = 207
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex emailfactoryv12bytsrhcrackslomalkaorg'

distance = 208
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex emailalertv1019bylashcrackslomalkaorg'

distance = 208
spam score = 11
title = 'z6 zealotsoft video all zeiterfassung zend ex aceutilitiesv165newcrackslomalkaorg'

distance = 208
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex qcopy2002v10350bymaniacscrackslomalkaorg'

distance = 208
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex kasperskyantiviruspersonalv50121crackslomalkaorg'

distance = 208
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex tabmailv13workingcrackslomalkaorg'

distance = 209
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex aloecamv22keygencrackslomalkaorg'

distance = 209
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex aplusdvdrippercrackslomalkaorg'

distance = 209
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex activeskincontrolocxv30crackslomalkaorg'

distance = 222
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex fsecureinternetsecurity2005multilanguagecrackslomalkaorg'

distance = 222
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex activefile227crackslomalkaorg'

distance = 223
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex emailseekerv17crackslomalkaorg'

distance = 223
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex addremoveplus2004v410701byhereticcrackslomalkaorg'

distance = 223
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex puzzleinlaydeluxev10crackslomalkaorg'

distance = 223
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex animatedscreenv68keygencrackslomalkaorg'

distance = 224
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex fantasticwomenv11crackslomalkaorg'

distance = 224
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex atamav18byamokcrackslomalkaorg'

distance = 225
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex g6ftpserverallversionscrackslomalkaorg'

distance = 226
spam score = 11
title = 'z6 zealotsoft video all zeiterfassung zend ex activerefreshv20build613crackslomalkaorg'

distance = 242
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex adcutoffv131bcrackslomalkaorg'

distance = 242
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 242
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex activeskinv426crackslomalkaorg'

distance = 242
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex firegraphicv60612crackslomalkaorg'

distance = 242
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex pcad2002trialbuild170050crackslomalkaorg'

distance = 242
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex aalogv246crackslomalkaorg'

distance = 243
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex atlantisoceanmindv1514crackslomalkaorg'

distance = 243
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex addremoveplus2003v40bytombraidercrackslomalkaorg'

distance = 244
spam score = 8
title = 'z6 zealotsoft video all zeiterfassung zend ex posterdownloadercrackslomalkaorg'

distance = 245
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex kasperskyantiviruspersonalv50xfixedcrackslomalkaorg'

distance = 263
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex powerwmarecorderv11crackslomalkaorg'

distance = 263
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex avizthoughtmapperv11forwin2kxpcrackslomalkaorg'

distance = 263
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex folderguardprov55crackslomalkaorg'

distance = 264
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex tableditv201crackslomalkaorg'

distance = 265
spam score = 11
title = 'z6 zealotsoft video all zeiterfassung zend ex actualtestscomoracle1z0007examcheatsheetv120803crackslomalkaorg'

distance = 265
spam score = 12
title = 'z6 zealotsoft video all zeiterfassung zend ex activerefreshv136build551crackslomalkaorg'

distance = 265
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex actualtestscomcisco9e0431examcheatsheetv92704crackslomalkaorg'

distance = 266
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex fairstarsaudioconverterv131crackslomalkaorg'

distance = 266
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex pacestaredgediagrammerv4191790crackslomalkaorg'

distance = 266
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex firewalkerservernetenhancedv50crackslomalkaorg'

distance = 289
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex fprotantivirusv31xevaluationcrackslomalkaorg'

distance = 291
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex androidv11bynitrouscrackslomalkaorg'

distance = 291
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex advancedvideopokerv1301bylashcrackslomalkaorg'

distance = 291
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex filthypasswordgeneratornetwinmobile2003armcrackslomalkaorg'

distance = 291
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex namowebeditor5crackslomalkaorg'

distance = 292
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex nameityourwayniyowv141bydigeraticrackslomalkaorg'

distance = 292
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex poweraudioeditorv305crackslomalkaorg'

distance = 292
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex animatedoptionboxv100ccrackslomalkaorg'

distance = 292
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex pinnaclestudioplusv93248trialtofullparisacrackbyruteamcrackslomalkaorg'

distance = 292
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex axialisaxcdplayerv26crackslomalkaorg'

distance = 368
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex postworkquickiescriptspsp8vol2crackslomalkaorg'

distance = 372
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex amiracleinathoughtscreenflashscreensavercrackslomalkaorg'

distance = 374
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex autoplaymenubuilderv36build597bytsrhcrackslomalkaorg'

distance = 377
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex fsecureantivirusformimesweeperv55010270crackslomalkaorg'

distance = 377
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex privacyinspectorv151bysndcrackslomalkaorg'

distance = 383
spam score = 10
title = 'z6 zealotsoft video all zeiterfassung zend ex pacestarumldiagrammer417build1787trialcrackslomalkaorg'

distance = 384
spam score = 9
title = 'z6 zealotsoft video all zeiterfassung zend ex framerateconverterhqfrchqv201crackslomalkaorg'

distance = 34
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l frigatev127crackslomalkaorg'

distance = 43
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l qfolder95v31crackslomalkaorg'

distance = 64
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l gutecollectioncrackslomalkaorg'

distance = 67
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l ecampaigncorporateeditionv4811crackslomalkaorg'

distance = 68
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l p2cpascalcompilerv212ecrackslomalkaorg'

distance = 69
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l r2vv55crackslomalkaorg'

distance = 71
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l microsoftoffice2003genericcrackcrackslomalkaorg'

distance = 71
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l abcalculator10crackslomalkaorg'

distance = 72
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l filepulverizerv40crackslomalkaorg'

distance = 73
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l folderindexerv111crackslomalkaorg'

distance = 75
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l emailsv226crackslomalkaorg'

distance = 75
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l accessadministratorv33crackslomalkaorg'

distance = 79
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l spywaredoctorv300288crackslomalkaorg'

distance = 80
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l epop203123crackslomalkaorg'

distance = 82
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l qprov20120crackslomalkaorg'

distance = 82
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l accessimagev321crackslomalkaorg'

distance = 83
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l divxprov521crackslomalkaorg'

distance = 85
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l areslitev410crackslomalkaorg'

distance = 88
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l asfaleia2002v10crackslomalkaorg'

distance = 92
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l fifa2002keygencrackslomalkaorg'

distance = 158
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l folderindexerv130crackslomalkaorg'

distance = 159
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l acrobatreaderv51italiancrackslomalkaorg'

distance = 159
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l firepadpictureviewerv64crackslomalkaorg'

distance = 159
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l animshowstv604byfffcrackslomalkaorg'

distance = 159
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l fsecureantivirusv4051291polishcrackslomalkaorg'

distance = 159
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l r2v504crackslomalkaorg'

distance = 160
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l amusicalgeneratorv20288crackslomalkaorg'

distance = 161
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l admuncherv45build7000byicicrackslomalkaorg'

distance = 161
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l adressesv30frenchcrackslomalkaorg'

distance = 161
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l fsecureantivirusv54xcrackslomalkaorg'

distance = 177
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l addremove4goodv20byucucrackslomalkaorg'

distance = 177
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l allfcodersoftwareproductscrackslomalkaorg'

distance = 178
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l namowebeditorv55frenchcrackslomalkaorg'

distance = 178
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l autopilotv210byeminencecrackslomalkaorg'

distance = 178
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l animatedscreenv62crackslomalkaorg'

distance = 178
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l alparysoftvideolockv10crackslomalkaorg'

distance = 178
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l fruitmachinesimulatorcrackslomalkaorg'

distance = 178
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activewhoisv202466crackslomalkaorg'

distance = 179
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l finjansurfinguardprov570311crackslomalkaorg'

distance = 179
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l autotypingproeditionv13crackslomalkaorg'

distance = 196
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activexmanagerv13byamokcrackslomalkaorg'

distance = 196
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l abfoutlookbackup22061crackslomalkaorg'

distance = 196
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l adailybackupv350crackslomalkaorg'

distance = 196
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activemp3controlforwin32v20crackslomalkaorg'

distance = 197
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l emailextractorexpressv25build10021crackslomalkaorg'

distance = 197
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activepdfportfolioprofessional35crackslomalkaorg'

distance = 197
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l xcopymediacenterv2105crackslomalkaorg'

distance = 197
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l actualdrawingv51byaaocgcrackslomalkaorg'

distance = 197
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l amichartv1456bytsrhcrackslomalkaorg'

distance = 197
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l namowebeditorv40crackslomalkaorg'

distance = 210
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l powerclock416serialcrackslomalkaorg'

distance = 210
spam score = 9
title = 'l20 lview pro for 2001 lurawave palmos lunar l activerefresh131build509crackslomalkaorg'

distance = 210
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l xnetstatprofessionalv40crackslomalkaorg'

distance = 210
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l puzzleinlaydeluxev10crackslomalkaorg'

distance = 210
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l atomparktagslockprov141crackslomalkaorg'

distance = 210
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l gutecollectionbyrp2kcrackslomalkaorg'

distance = 210
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activeskincontrolocxv40crackslomalkaorg'

distance = 210
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activelaunchv124crackslomalkaorg'

distance = 210
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activetaskv10crackslomalkaorg'

distance = 210
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l aplusscreensavercreatorv34crackslomalkaorg'

distance = 227
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l fprotantivirusforwindowsv311bcrackslomalkaorg'

distance = 227
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l flamingpearindiainkv185byeclipsecrackslomalkaorg'

distance = 227
spam score = 10
title = 'l20 lview pro for 2001 lurawave palmos lunar l activerefresh136build551crackslomalkaorg'

distance = 228
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l adobeacrobatv70professionalkeygenbyparodoxcrackslomalkaorg'

distance = 228
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l pureiev501crackslomalkaorg'

distance = 228
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l angeliuxv155340crackslomalkaorg'

distance = 228
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l firehandemberv602bypccrackslomalkaorg'

distance = 228
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activexgltextv110crackslomalkaorg'

distance = 228
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l pacdoom121crackslomalkaorg'

distance = 228
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l emailviaphone10crackslomalkaorg'

distance = 243
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l ebookhtmlcompilerpro212crackslomalkaorg'

distance = 243
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l findflashv15byc0nspiracycrackslomalkaorg'

distance = 243
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l windowsxpactivationcrackv42crackslomalkaorg'

distance = 243
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l finalrecoveryv12updatedcrackslomalkaorg'

distance = 243
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l adpictureviewerv25build231crackslomalkaorg'

distance = 244
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l emanagerv35b08crackslomalkaorg'

distance = 244
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l avdvideoprocessorv731crackslomalkaorg'

distance = 244
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l ashampooaudiocdmp3studio33xxcrackslomalkaorg'

distance = 244
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l filestoragev26forbcb4crackslomalkaorg'

distance = 244
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l xdvdripperv1130crackslomalkaorg'

distance = 263
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l argosoftftpserverv1411crackslomalkaorg'

distance = 263
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activestateperldevkitdvk20crackslomalkaorg'

distance = 263
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l acousticamp3towaveconverterplusv226bysndcrackslomalkaorg'

distance = 264
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l avigifv107bytsrhcrackslomalkaorg'

distance = 264
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l alapimageportv132forquarkxpresscrackslomalkaorg'

distance = 265
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l firehandemberprov394crackslomalkaorg'

distance = 265
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l addremove4goodv20byfhcfcrackslomalkaorg'

distance = 265
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l gaelmindgeniusbusinessv2410crackslomalkaorg'

distance = 266
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l ebookhtmlcompilerpro212ieversioncrackslomalkaorg'

distance = 266
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l g6ftpserver20beta6and7crackslomalkaorg'

distance = 293
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l activepdfserverprofessionalv352crackslomalkaorg'

distance = 293
spam score = 9
title = 'l20 lview pro for 2001 lurawave palmos lunar l activeshopperaspcomponent10crackslomalkaorg'

distance = 293
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l fsecureantivirusforworkstationsv531winxpcrackslomalkaorg'

distance = 293
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l akalapasswordrevealerv100byfffcrackslomalkaorg'

distance = 295
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l firehandembermillenniumv511crackslomalkaorg'

distance = 295
spam score = 9
title = 'l20 lview pro for 2001 lurawave palmos lunar l ucertifymicrosoftm70210prepkitv80005crackslomalkaorg'

distance = 296
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l fabsoftreformenterprisev9003crackslomalkaorg'

distance = 296
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l aplusstealthwebsiteloggerv21crackslomalkaorg'

distance = 296
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l privatemessageplus202crackslomalkaorg'

distance = 296
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l arobfantasticmp3encoderv20crackslomalkaorg'

distance = 405
spam score = 7
title = 'l20 lview pro for 2001 lurawave palmos lunar l acousticamp3towaveconvertorplusv203byvncrackingcrackslomalkaorg'

distance = 414
spam score = 8
title = 'l20 lview pro for 2001 lurawave palmos lunar l awinsystemcleanerv115bycphvcrackslomalkaorg'

distance = 41
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl ascv30crackslomalkaorg'

distance = 49
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl pcad2002crackslomalkaorg'

distance = 49
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl eborderclient21crackslomalkaorg'

distance = 50
spam score = 16
title = 'l16 logixml lgx lockwin analyzer logbook logpl kchesselite25dcrackslomalkaorg'

distance = 56
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activequerycrackslomalkaorg'

distance = 58
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activewhoisv202466crackslomalkaorg'

distance = 65
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl thesims2crackcrackslomalkaorg'

distance = 69
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl eplanpro30crackslomalkaorg'

distance = 69
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl finditv400crackslomalkaorg'

distance = 70
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl r2v504crackslomalkaorg'

distance = 71
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl foobar104crackslomalkaorg'

distance = 72
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl footballv211crackslomalkaorg'

distance = 73
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl qfolder95v31crackslomalkaorg'

distance = 78
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl udeployv1750crackslomalkaorg'

distance = 79
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl p7dp7crackslomalkaorg'

distance = 80
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl ghackerv20crackslomalkaorg'

distance = 80
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl frigatev127crackslomalkaorg'

distance = 82
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl rwin2000keyboardswitch6001119crackslomalkaorg'

distance = 85
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl achristmasatsantasv29crackslomalkaorg'

distance = 85
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl fsecuresshclientv5456crackslomalkaorg'

distance = 152
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl tab2desk2110crackslomalkaorg'

distance = 152
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl andromedaseries3screenfilters16crackslomalkaorg'

distance = 153
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl finanswindowv20crackslomalkaorg'

distance = 153
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl addremove4goodv201byrevengecrackslomalkaorg'

distance = 153
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl aatomictimesyncv371crackslomalkaorg'

distance = 153
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl rwipeclean30build1056crackslomalkaorg'

distance = 153
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl fastmenuv107crackslomalkaorg'

distance = 153
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl ntrackstudiov301build1211crackslomalkaorg'

distance = 153
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl halloweenv28crackslomalkaorg'

distance = 153
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl aptschedulerv130crackslomalkaorg'

distance = 167
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl emailsv210crackslomalkaorg'

distance = 167
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl fprotantivirusforwindowsv309crackslomalkaorg'

distance = 168
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl abiseruceprov1012crackslomalkaorg'

distance = 168
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activeskinv426crackslomalkaorg'

distance = 168
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl tabmailv12810crackslomalkaorg'

distance = 168
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl fsecuresshclientv540japanesecrackslomalkaorg'

distance = 169
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl abracadabrav126bytnocrackslomalkaorg'

distance = 170
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl aardvarkpolisherforvb6080crackslomalkaorg'

distance = 170
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl uwipe28crackslomalkaorg'

distance = 170
spam score = 16
title = 'l16 logixml lgx lockwin analyzer logbook logpl ageneralpracticelibraryv20100crackslomalkaorg'

distance = 185
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl uanimatorv10keygencrackslomalkaorg'

distance = 185
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl finditv304crackbyeminencecrackslomalkaorg'

distance = 185
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl windowsxpactivationcrackv42crackslomalkaorg'

distance = 185
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl apollocom60crackslomalkaorg'

distance = 186
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl forecast1000crackslomalkaorg'

distance = 186
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl xaudiovideojoinerv121126crackslomalkaorg'

distance = 186
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl allkasperskyproductscrackslomalkaorg'

distance = 186
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl galaxyunfurledv103crackslomalkaorg'

distance = 186
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl addremoveplus2002v32crackslomalkaorg'

distance = 186
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl ecampaignprofessionaleditionv2944byfffcrackslomalkaorg'

distance = 198
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activemp3controlforwin32v20crackslomalkaorg'

distance = 199
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activestateperldevkitv411crackslomalkaorg'

distance = 199
spam score = 16
title = 'l16 logixml lgx lockwin analyzer logbook logpl aemailspamfilterv20crackslomalkaorg'

distance = 199
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl favoritessweeper10crackslomalkaorg'

distance = 200
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl adresbankv40crackslomalkaorg'

distance = 200
spam score = 13
title = 'l16 logixml lgx lockwin analyzer logbook logpl ecardxpress13crackslomalkaorg'

distance = 200
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl radminv22crackbyscgcrackslomalkaorg'

distance = 200
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl afsearchv865abydistinctcrackslomalkaorg'

distance = 200
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl albumexpressv26cbytccrackslomalkaorg'

distance = 200
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl animatetetbloxv13crackslomalkaorg'

distance = 216
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl abfoutlookbackup22061crackslomalkaorg'

distance = 216
spam score = 13
title = 'l16 logixml lgx lockwin analyzer logbook logpl aiswatermarkpicturesprotectorv23crackslomalkaorg'

distance = 216
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl animatedscreenv61crackbyevccrackslomalkaorg'

distance = 217
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl windowsxpactivationcrackcrackslomalkaorg'

distance = 217
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl firehandemberprov394crackslomalkaorg'

distance = 217
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl atscreenthief391365crackslomalkaorg'

distance = 217
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl focusphotoeditorv307crackslomalkaorg'

distance = 217
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl autorunassistantv26byutopiacrackslomalkaorg'

distance = 217
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl fsecureworkstationsuite43crackslomalkaorg'

distance = 217
spam score = 16
title = 'l16 logixml lgx lockwin analyzer logbook logpl alphatrisv330forwindowsme2000crackslomalkaorg'

distance = 232
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl akoffmusiccomposerv20keygenbytmgcrackslomalkaorg'

distance = 233
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl nortonantivirus2005completefixedcrackslomalkaorg'

distance = 233
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activexgltextv110crackslomalkaorg'

distance = 233
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl fileslicerv20build09001byeclipsecrackslomalkaorg'

distance = 233
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl pinnaclestudioplusv93248unlockercrackslomalkaorg'

distance = 233
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl abcomblockmanagerv1110forautocadgermancrackslomalkaorg'

distance = 233
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activexmanagerv14crackslomalkaorg'

distance = 234
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl fileshredder2000v31keygenbyevidencecrackslomalkaorg'

distance = 234
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl accessimagev260crackslomalkaorg'

distance = 234
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl aesopgifcreatorv15349byrp2kcrackslomalkaorg'

distance = 248
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl qrecovery98v126build190crackslomalkaorg'

distance = 249
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activepdfserverprofessionalv352crackslomalkaorg'

distance = 249
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl autoplaymenustudioprofessionalv3000crackslomalkaorg'

distance = 249
spam score = 17
title = 'l16 logixml lgx lockwin analyzer logbook logpl activerefreshv135build535crackslomalkaorg'

distance = 250
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl puzzlechampionv1030215byurgupcrackslomalkaorg'

distance = 250
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl argosoftftpserverv140crackslomalkaorg'

distance = 251
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl futuremarkpcmark04prov100crackbyfffcrackslomalkaorg'

distance = 252
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl flipoverv32serialbyngencrackslomalkaorg'

distance = 252
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl adobeillustratorinterfaceimproverv15crackslomalkaorg'

distance = 252
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activeskincontrolocxv42crackslomalkaorg'

distance = 278
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl namowebeditorv402byamokcrackslomalkaorg'

distance = 278
spam score = 16
title = 'l16 logixml lgx lockwin analyzer logbook logpl adobeincopycsv30tryoutmultilanguagecrackslomalkaorg'

distance = 278
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl allairehomesitev452loadercrackslomalkaorg'

distance = 279
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl xnetstatprofessionalv50bymadmanherculescrackslomalkaorg'

distance = 279
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl firehandembermillenniumv511crackslomalkaorg'

distance = 280
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl windows2003andwindowsxpsp2antiproductactivationcrackv12crackslomalkaorg'

distance = 280
spam score = 14
title = 'l16 logixml lgx lockwin analyzer logbook logpl privatedesktopv16bynatabeccrackslomalkaorg'

distance = 280
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl advancedrarpasswordrecoveryv11crackslomalkaorg'

distance = 282
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl activestateperldevkitv520520crackslomalkaorg'

distance = 282
spam score = 15
title = 'l16 logixml lgx lockwin analyzer logbook logpl adkillerv120byorioncrackslomalkaorg'

distance = 49
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi eborderclient20crackslomalkaorg'

distance = 54
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi ageofmythologyv3200442300crackslomalkaorg'

distance = 57
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi accesslockv13crackslomalkaorg'

distance = 61
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi g6renamerv151crackslomalkaorg'

distance = 65
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi qedesign2000v632crackslomalkaorg'

distance = 68
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi emailsv210crackslomalkaorg'

distance = 68
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi autositegalleryv15crackslomalkaorg'

distance = 73
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi ascv30crackslomalkaorg'

distance = 75
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi nod32allversionscrackslomalkaorg'

distance = 76
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi xenforcerv10abypccrackslomalkaorg'

distance = 78
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi foratomicsynchronizationv11000crackcrackslomalkaorg'

distance = 79
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi alarmv630crackslomalkaorg'

distance = 80
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi addressmanagerprov20crackslomalkaorg'

distance = 81
spam score = 7
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi fifa2004keygenbydeviancecrackslomalkaorg'

distance = 81
spam score = 7
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi ebusinessappletv40crackslomalkaorg'

distance = 83
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi filesave2000crackslomalkaorg'

distance = 84
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi ebookv1001crackslomalkaorg'

distance = 86
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi accessadministratorprov34crackslomalkaorg'

distance = 87
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi eiconsv415crackslomalkaorg'

distance = 87
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi emailtalkerv330crackslomalkaorg'

distance = 146
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi farmanagerv17041282crackslomalkaorg'

distance = 146
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi windows2003xpkeygencrackslomalkaorg'

distance = 146
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi fantasticwomenscreensaverv10crackslomalkaorg'

distance = 147
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi autorunassistantv282crackslomalkaorg'

distance = 148
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi okprintwatchv241crackslomalkaorg'

distance = 149
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi alltotrayv41crackslomalkaorg'

distance = 149
spam score = 7
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi stylexpv306keygenbyexclipsecrackslomalkaorg'

distance = 149
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi folderguardv5xprocrackslomalkaorg'

distance = 150
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi acronisallcrackslomalkaorg'

distance = 150
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi oberonsecuridesignv10crackslomalkaorg'

distance = 169
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi emailsv225serialbyfffcrackslomalkaorg'

distance = 169
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi filerescuev27crackslomalkaorg'

distance = 169
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi pshieldwatcherv15crackslomalkaorg'

distance = 169
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi activeskinv423crackslomalkaorg'

distance = 169
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi filesplitv222byucfcrackslomalkaorg'

distance = 170
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi activestatekomodov25076516crackslomalkaorg'

distance = 170
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi allthumbsprov32crackslomalkaorg'

distance = 170
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi firehandemberprov3519crackslomalkaorg'

distance = 171
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi gaeb90iov22015germancrackslomalkaorg'

distance = 171
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi facefilterstandardv10008192crackslomalkaorg'

distance = 184
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi advancedsoundrecorderv31crackbytsrhcrackslomalkaorg'

distance = 184
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi drdivxv106crackslomalkaorg'

distance = 184
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi fireburnerv217windowseditioncrackslomalkaorg'

distance = 184
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi activeskinv41bypooqcrackslomalkaorg'

distance = 184
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi antibosskeyv381crackslomalkaorg'

distance = 185
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi accalc2001crackslomalkaorg'

distance = 185
spam score = 7
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi fatcatpokerv357crackslomalkaorg'

distance = 185
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi fcutterv152crackslomalkaorg'

distance = 185
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi nameityourwayniyowv141bydigeraticrackslomalkaorg'

distance = 185
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi finaldatav101723crackslomalkaorg'

distance = 198
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi faxmailforwindowsvv96601crackslomalkaorg'

distance = 199
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi activestatekomodov301professionalcrackslomalkaorg'

distance = 199
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi activexmanagerv13bytntcrackslomalkaorg'

distance = 199
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi faxamaticvx93501crackslomalkaorg'

distance = 199
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi finanswindowv20crackslomalkaorg'

distance = 200
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi alarmclockv211crackslomalkaorg'

distance = 200
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi windowsxphomeeditionactivationcrackcrackslomalkaorg'

distance = 200
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi ageneralpracticelibraryv21121crackslomalkaorg'

distance = 200
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi alltotrayv44bymp2kcrackslomalkaorg'

distance = 200
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi fastmenuv20keygencrackslomalkaorg'

distance = 214
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi arcservev65forwinntcrackslomalkaorg'

distance = 214
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi androidnewsgroupdownloaderv46crackslomalkaorg'

distance = 214
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi assetandequipmenttrackingsystemv11crackslomalkaorg'

distance = 215
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi autosyncftpv11068crackslomalkaorg'

distance = 215
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi finalrecoveryv12crackslomalkaorg'

distance = 215
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi aaacolorpickerv10crackslomalkaorg'

distance = 215
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi aplusvideojoinerv438crackslomalkaorg'

distance = 215
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi emailhooverv154bytsrhcrackslomalkaorg'

distance = 215
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi reallusionfacefilterv105181studioeditioncrackslomalkaorg'

distance = 216
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi arclabmaillistcontrolleramlcv200crackslomalkaorg'

distance = 229
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi abcwareblobshopv123crackslomalkaorg'

distance = 229
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi aprcalcv40111bypukecrackslomalkaorg'

distance = 230
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi fileshredder2000v31byevidencecrackslomalkaorg'

distance = 231
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi adobegolivecsv70crackslomalkaorg'

distance = 231
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi flat2servv15build171byamokcrackslomalkaorg'

distance = 231
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi ntrackstudiov3111crackslomalkaorg'

distance = 232
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi editorial2v201crackslomalkaorg'

distance = 232
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi activestatevisualxsltforvs2002v1812494crackslomalkaorg'

distance = 232
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi activemp3activexcontrol17crackslomalkaorg'

distance = 232
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi autodialogsv21115crackslomalkaorg'

distance = 251
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi aistxsearchv278bytsrhcrackslomalkaorg'

distance = 251
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi abfallkostenverwaltung2003010026crackslomalkaorg'

distance = 251
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi atomsyncv202bynitrouscrackslomalkaorg'

distance = 251
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi advancedregistrycleanerv2110123crackslomalkaorg'

distance = 251
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi fabsoftshortcutv8104crackslomalkaorg'

distance = 251
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi avigifv107byjhtcrackslomalkaorg'

distance = 251
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi fprotantivirus312cbycrackdemon2003crackslomalkaorg'

distance = 251
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi efunsoftmastermind10bylashcrackslomalkaorg'

distance = 251
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi avirtspaghettiproxyserver30crackslomalkaorg'

distance = 252
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi finetunev150serialbyfhcfcrackslomalkaorg'

distance = 277
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi gadugaduallversionsbannerkiller2v14byunrealcrackslomalkaorg'

distance = 277
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi autotask2000v311patchcrackslomalkaorg'

distance = 277
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi xballv211plus1trainercrackslomalkaorg'

distance = 277
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi activeskincontrolocxv352crackslomalkaorg'

distance = 277
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi activestateperldevkitdvk20crackslomalkaorg'

distance = 278
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi acqurlv51bylinezer0crackslomalkaorg'

distance = 278
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi adobesoftwaremultikeygenv1013appscrackslomalkaorg'

distance = 279
spam score = 8
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi arobfantasticmp3networkedencoderv14bymanifestcrackslomalkaorg'

distance = 281
spam score = 7
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi imtoo3gpvideoconverterv2115build1201crackslomalkaorg'

distance = 281
spam score = 9
title = 'c87 ctrlview ct to 2000 dvd cucusoft cube avi anconiarocketsalesv15289crackslomalkaorg'

distance = 1907
spam score = 49
title = 'publications gaas and related materials'

distance = 17
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix fx2000v30crackslomalkaorg'

distance = 63
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix freshdownloadv430crackslomalkaorg'

distance = 65
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix adayinthelifev13byemcrackslomalkaorg'

distance = 67
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix activepenv10713crackslomalkaorg'

distance = 73
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix ascv30crackslomalkaorg'

distance = 74
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix aucprov10crackslomalkaorg'

distance = 75
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix fishv333431crackslomalkaorg'

distance = 75
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix adayinthelifev151keygencrackslomalkaorg'

distance = 78
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix admuncherv412crackslomalkaorg'

distance = 79
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix alphaballv13crackslomalkaorg'

distance = 79
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix fsecureantivirusv409crackslomalkaorg'

distance = 79
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix amusicalgeneratorv200288crackslomalkaorg'

distance = 79
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix fileprotectorv160crackslomalkaorg'

distance = 85
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix arkangelv10acrackslomalkaorg'

distance = 86
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix ebackup10byfocccrackslomalkaorg'

distance = 88
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix animateddesktopv12crackslomalkaorg'

distance = 90
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix associatev13bywktcrackslomalkaorg'

distance = 91
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix fcutterv160serialcrackslomalkaorg'

distance = 93
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix apthousekeeperv100crackslomalkaorg'

distance = 97
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix editorial2v201crackslomalkaorg'

distance = 158
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix ebusinesssolutionsv7000003crackslomalkaorg'

distance = 158
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix ppdforiev703crackslomalkaorg'

distance = 158
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix agentv20build646byrorcrackslomalkaorg'

distance = 158
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix r2extremeprov151crackslomalkaorg'

distance = 158
spam score = 12
title = 'c70 coolfocus designer hotstrip flyer dynamix activerefreshv136build551crackslomalkaorg'

distance = 158
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix amusicalgeneratorv30crackslomalkaorg'

distance = 159
spam score = 9
title = 'c70 coolfocus designer hotstrip flyer dynamix fileshareprov25crackslomalkaorg'

distance = 159
spam score = 12
title = 'c70 coolfocus designer hotstrip flyer dynamix activerefreshv134build531crackslomalkaorg'

distance = 159
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix abc2winv21hcrackslomalkaorg'

distance = 159
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix atoutmathv21bydbccrackslomalkaorg'

distance = 177
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix v12dbeformacromediadirectorv33crackslomalkaorg'

distance = 178
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix fairstarsrecorderv230crackslomalkaorg'

distance = 178
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix activewhoisbrowserv202466byheritagecrackslomalkaorg'

distance = 178
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix activefaxserverv388build195germancrackslomalkaorg'

distance = 178
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix powerarchiver2001v70208newcrackslomalkaorg'

distance = 178
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix addictv202crackslomalkaorg'

distance = 179
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix advancedmp3converterv203byfficrackslomalkaorg'

distance = 179
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix flexrestartv101crackslomalkaorg'

distance = 179
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix absolutesoundrecorderv300crackslomalkaorg'

distance = 179
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix activexmanagerv13bycokecrackslomalkaorg'

distance = 193
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix winrarallversionscrackslomalkaorg'

distance = 194
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix autorunassistantv242finalcrackslomalkaorg'

distance = 194
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix absolutesecurityprov39keygenbyaaocgcrackslomalkaorg'

distance = 194
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix p2cpluspascalcompiler2006ecrackslomalkaorg'

distance = 194
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix postmasterv271crackslomalkaorg'

distance = 194
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix focusphotoeditorv309crackslomalkaorg'

distance = 194
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix accessmanagerv60crackslomalkaorg'

distance = 194
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix qacenterenterprise4620011106crackslomalkaorg'

distance = 194
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix filesplitv222byinfernocrackslomalkaorg'

distance = 194
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix autopage25crackslomalkaorg'

distance = 209
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix filesharingfornetv150824crackslomalkaorg'

distance = 209
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix faststatsanalyzerv27xcrackslomalkaorg'

distance = 210
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix formbrowser17crackslomalkaorg'

distance = 210
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix ppingtools26crackslomalkaorg'

distance = 210
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix filenameprov206crackslomalkaorg'

distance = 210
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix activesizerbydatadynamicscrackslomalkaorg'

distance = 210
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix anawavegravityv2xcrackslomalkaorg'

distance = 211
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix finditv400byembracecrackslomalkaorg'

distance = 211
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix pushpagev16crackslomalkaorg'

distance = 211
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix accesspasswordrecoverv162crackslomalkaorg'

distance = 226
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix absolutesecurityprov39keygenbyfffcrackslomalkaorg'

distance = 226
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix activeskinv422crackcrackslomalkaorg'

distance = 226
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix privacyinspectorv131crackslomalkaorg'

distance = 226
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix powerarchiver2004v9031finalcrackslomalkaorg'

distance = 226
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix kasperskyantiviruspersonalprov5020keygenfilebyblackstarcrackslomalkaorg'

distance = 226
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix powerarchiver2003v85015crackslomalkaorg'

distance = 226
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix algorithmicartsbankstepv20crackslomalkaorg'

distance = 226
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix feuriov131crackslomalkaorg'

distance = 226
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix privatepixv200fixedcrackslomalkaorg'

distance = 227
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix windowsxpactivationcrackbyevildudecrackslomalkaorg'

distance = 242
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix microsoftoffice2003proserialnumbercrackslomalkaorg'

distance = 243
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix polyviewv365bytccrackslomalkaorg'

distance = 244
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix puzzlebrainstormv12crackslomalkaorg'

distance = 244
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix powerdefragv301serialbymrkrackercrackslomalkaorg'

distance = 244
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix adobeacrobatv70professionalkeygenbyparodoxcrackslomalkaorg'

distance = 244
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix actualtitlebuttonsv27crackslomalkaorg'

distance = 244
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix autoplaymenustudiov3001crackslomalkaorg'

distance = 245
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix avast4professionaleditionrepackcrackslomalkaorg'

distance = 245
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix activestatekomodov25076516crackslomalkaorg'

distance = 245
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix antihackv20build59byfhcfcrackslomalkaorg'

distance = 265
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix windowsxphomeeditioncrackslomalkaorg'

distance = 265
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix kasperskyantiviruspersonalv50xcrackslomalkaorg'

distance = 265
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix proxycapv201bytsrhcrackslomalkaorg'

distance = 265
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix aguarddogv10crackslomalkaorg'

distance = 265
spam score = 9
title = 'c70 coolfocus designer hotstrip flyer dynamix powervideoconverterv138crackslomalkaorg'

distance = 266
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix advancedpopupkiller2002v21crackslomalkaorg'

distance = 266
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix xinviteoutwarcomcrewinviterv12crackslomalkaorg'

distance = 266
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix privatebookmarksv32bytntcrackslomalkaorg'

distance = 267
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 267
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix antiviruskasperskypersonalpro5xcrackslomalkaorg'

distance = 292
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix ageofsails2v153betaupdatecrackslomalkaorg'

distance = 293
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix appletpasswordwizardv30bybr80crackslomalkaorg'

distance = 293
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix poweraudioeditorv305crackslomalkaorg'

distance = 293
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix emailalertv1019byimscrackslomalkaorg'

distance = 294
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix activefaxserverv387build194crackslomalkaorg'

distance = 295
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix namewizv31keygencrackslomalkaorg'

distance = 295
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix octetstringvdedirectorysuitev30linuxcrackslomalkaorg'

distance = 295
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix windows2003andxpandlhantiproductactivationv200crackslomalkaorg'

distance = 296
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix namowebeditor5bytwicecrackslomalkaorg'

distance = 296
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix pinnaclestudioplusv93multilanguagecrackslomalkaorg'

distance = 376
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix pacboyv11crackslomalkaorg'

distance = 380
spam score = 11
title = 'c70 coolfocus designer hotstrip flyer dynamix osadobephotoshopcs2tryouttofullactivationkeygenbyoscoriacrackslomalkaorg'

distance = 391
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix uleadvideostudiov900100englishtbybtofullcrackbybidjancrackslomalkaorg'

distance = 391
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix activeskincontrolocxv40byadhamdahabcrackslomalkaorg'

distance = 400
spam score = 10
title = 'c70 coolfocus designer hotstrip flyer dynamix postmortemencephalumreanimatorper10bydbccrackslomalkaorg'

distance = 34
spam score = 6
title = 'e37 esoft estimate nettools essential build ma farv281342crackslomalkaorg'

distance = 43
spam score = 7
title = 'e37 esoft estimate nettools essential build ma fishv333431crackslomalkaorg'

distance = 63
spam score = 7
title = 'e37 esoft estimate nettools essential build ma ecampaignv302crackslomalkaorg'

distance = 69
spam score = 7
title = 'e37 esoft estimate nettools essential build ma eplanpro35crackslomalkaorg'

distance = 77
spam score = 7
title = 'e37 esoft estimate nettools essential build ma eiconsv325crackslomalkaorg'

distance = 78
spam score = 7
title = 'e37 esoft estimate nettools essential build ma vmonitorv382crackslomalkaorg'

distance = 79
spam score = 7
title = 'e37 esoft estimate nettools essential build ma f12001keygencrackslomalkaorg'

distance = 80
spam score = 7
title = 'e37 esoft estimate nettools essential build ma adayinthelifev151keygencrackslomalkaorg'

distance = 83
spam score = 7
title = 'e37 esoft estimate nettools essential build ma abcdeeseditioncrackslomalkaorg'

distance = 83
spam score = 6
title = 'e37 esoft estimate nettools essential build ma acecapturev19byevidencecrackslomalkaorg'

distance = 83
spam score = 7
title = 'e37 esoft estimate nettools essential build ma adayatthebeachslots11crackslomalkaorg'

distance = 88
spam score = 6
title = 'e37 esoft estimate nettools essential build ma fa18hornetv30crackslomalkaorg'

distance = 88
spam score = 7
title = 'e37 esoft estimate nettools essential build ma astonshellv191crackslomalkaorg'

distance = 92
spam score = 7
title = 'e37 esoft estimate nettools essential build ma pcpolicev100crackslomalkaorg'

distance = 93
spam score = 7
title = 'e37 esoft estimate nettools essential build ma fircfrenchcrackslomalkaorg'

distance = 93
spam score = 6
title = 'e37 esoft estimate nettools essential build ma fanplayer181crackslomalkaorg'

distance = 94
spam score = 7
title = 'e37 esoft estimate nettools essential build ma ajcdiffv174crackslomalkaorg'

distance = 96
spam score = 7
title = 'e37 esoft estimate nettools essential build ma freshsystemv214crackslomalkaorg'

distance = 96
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activepagerv10crackslomalkaorg'

distance = 97
spam score = 7
title = 'e37 esoft estimate nettools essential build ma eiconsv415crackslomalkaorg'

distance = 158
spam score = 6
title = 'e37 esoft estimate nettools essential build ma privatejuke771crackslomalkaorg'

distance = 158
spam score = 6
title = 'e37 esoft estimate nettools essential build ma faststatsanalyzerv28crackslomalkaorg'

distance = 159
spam score = 7
title = 'e37 esoft estimate nettools essential build ma faxamaticvx93401crackslomalkaorg'

distance = 159
spam score = 7
title = 'e37 esoft estimate nettools essential build ma alienskyv121crackslomalkaorg'

distance = 159
spam score = 7
title = 'e37 esoft estimate nettools essential build ma table2000v1240forquarkxpresscrackslomalkaorg'

distance = 159
spam score = 6
title = 'e37 esoft estimate nettools essential build ma filesecurerv360crackslomalkaorg'

distance = 159
spam score = 6
title = 'e37 esoft estimate nettools essential build ma activeskinocxv4257crackslomalkaorg'

distance = 159
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activeskinv4273crackslomalkaorg'

distance = 160
spam score = 7
title = 'e37 esoft estimate nettools essential build ma ancestralauthorv22ccrackslomalkaorg'

distance = 160
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activeoptimizercrackslomalkaorg'

distance = 178
spam score = 7
title = 'e37 esoft estimate nettools essential build ma fircv11crackslomalkaorg'

distance = 178
spam score = 7
title = 'e37 esoft estimate nettools essential build ma accessfoldersv143betacrackslomalkaorg'

distance = 179
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activexmanagerv14bydesperatecrackslomalkaorg'

distance = 179
spam score = 7
title = 'e37 esoft estimate nettools essential build ma powerarchiver2002v80570crackslomalkaorg'

distance = 180
spam score = 7
title = 'e37 esoft estimate nettools essential build ma finjansurfinguardprov570311crackslomalkaorg'

distance = 180
spam score = 7
title = 'e37 esoft estimate nettools essential build ma aliasidataintegratorv36crackslomalkaorg'

distance = 180
spam score = 6
title = 'e37 esoft estimate nettools essential build ma admailer10017crackslomalkaorg'

distance = 180
spam score = 7
title = 'e37 esoft estimate nettools essential build ma albumcreatorprov30425crackslomalkaorg'

distance = 181
spam score = 7
title = 'e37 esoft estimate nettools essential build ma antares9crackslomalkaorg'

distance = 181
spam score = 6
title = 'e37 esoft estimate nettools essential build ma activeskinv421crackslomalkaorg'

distance = 193
spam score = 7
title = 'e37 esoft estimate nettools essential build ma antitrojanelitev231bysndcrackslomalkaorg'

distance = 193
spam score = 7
title = 'e37 esoft estimate nettools essential build ma antechinuscsharpeditorv42crackslomalkaorg'

distance = 193
spam score = 7
title = 'e37 esoft estimate nettools essential build ma ataniv222crackslomalkaorg'

distance = 193
spam score = 6
title = 'e37 esoft estimate nettools essential build ma astackv21crackslomalkaorg'

distance = 193
spam score = 6
title = 'e37 esoft estimate nettools essential build ma adayinthelifev151serialcrackslomalkaorg'

distance = 194
spam score = 7
title = 'e37 esoft estimate nettools essential build ma airboxv38build216crackslomalkaorg'

distance = 194
spam score = 7
title = 'e37 esoft estimate nettools essential build ma emailalertv10110byeminencecrackslomalkaorg'

distance = 194
spam score = 7
title = 'e37 esoft estimate nettools essential build ma fssuitefsmechanicv11crackslomalkaorg'

distance = 194
spam score = 7
title = 'e37 esoft estimate nettools essential build ma xhdlv3237crackslomalkaorg'

distance = 195
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activeskinv43crackslomalkaorg'

distance = 209
spam score = 7
title = 'e37 esoft estimate nettools essential build ma a1dvdaudioripperv1126crackslomalkaorg'

distance = 209
spam score = 7
title = 'e37 esoft estimate nettools essential build ma amfintelligentorgancrackslomalkaorg'

distance = 210
spam score = 7
title = 'e37 esoft estimate nettools essential build ma pacbomberv154crackbytsrhcrackslomalkaorg'

distance = 210
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activefilerecoveryv20crackslomalkaorg'

distance = 211
spam score = 7
title = 'e37 esoft estimate nettools essential build ma accessmanagerv60bytsrhcrackslomalkaorg'

distance = 211
spam score = 7
title = 'e37 esoft estimate nettools essential build ma freshmail3000jv201crackslomalkaorg'

distance = 212
spam score = 6
title = 'e37 esoft estimate nettools essential build ma filechopper32crackslomalkaorg'

distance = 212
spam score = 8
title = 'e37 esoft estimate nettools essential build ma actualwindowmenuv28crackslomalkaorg'

distance = 212
spam score = 7
title = 'e37 esoft estimate nettools essential build ma puzzlebrainstormv125crackslomalkaorg'

distance = 212
spam score = 6
title = 'e37 esoft estimate nettools essential build ma alarmmasterv43byfffcrackslomalkaorg'

distance = 224
spam score = 7
title = 'e37 esoft estimate nettools essential build ma observeranddistributedobserver62dcrackslomalkaorg'

distance = 224
spam score = 6
title = 'e37 esoft estimate nettools essential build ma flamingpearindiainkv185byeclipsecrackslomalkaorg'

distance = 225
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activeskincontrolocxv42crackslomalkaorg'

distance = 225
spam score = 6
title = 'e37 esoft estimate nettools essential build ma acdvideomagicv10sr1crackslomalkaorg'

distance = 225
spam score = 7
title = 'e37 esoft estimate nettools essential build ma archicryptshredderv157crackslomalkaorg'

distance = 226
spam score = 8
title = 'e37 esoft estimate nettools essential build ma activerefreshv135build537crackslomalkaorg'

distance = 227
spam score = 6
title = 'e37 esoft estimate nettools essential build ma fileslicerv20build09001byeclipsecrackslomalkaorg'

distance = 227
spam score = 6
title = 'e37 esoft estimate nettools essential build ma advancedvideopokerv1381bytnocrackslomalkaorg'

distance = 227
spam score = 6
title = 'e37 esoft estimate nettools essential build ma fastypetypingtutorialv6014crackslomalkaorg'

distance = 227
spam score = 7
title = 'e37 esoft estimate nettools essential build ma alarmmasterv142forpalmosbyelilacrackslomalkaorg'

distance = 245
spam score = 7
title = 'e37 esoft estimate nettools essential build ma g6utilitiesv170crackslomalkaorg'

distance = 245
spam score = 7
title = 'e37 esoft estimate nettools essential build ma flipoverv32serialbyngencrackslomalkaorg'

distance = 245
spam score = 7
title = 'e37 esoft estimate nettools essential build ma autopilotv210byrp2kcrackslomalkaorg'

distance = 245
spam score = 6
title = 'e37 esoft estimate nettools essential build ma emailextractorexpressv25build10021crackslomalkaorg'

distance = 245
spam score = 7
title = 'e37 esoft estimate nettools essential build ma eiconsv370byrp2kcrackslomalkaorg'

distance = 246
spam score = 7
title = 'e37 esoft estimate nettools essential build ma emailextractorexpressv21bydbccrackslomalkaorg'

distance = 246
spam score = 7
title = 'e37 esoft estimate nettools essential build ma fprotantivirusv31xevaluationcrackslomalkaorg'

distance = 246
spam score = 7
title = 'e37 esoft estimate nettools essential build ma osadobeillustratorcs2tryouttofullactivationkeygenbyoscarcrackslomalkaorg'

distance = 246
spam score = 6
title = 'e37 esoft estimate nettools essential build ma proximusroomarrangerv35crackslomalkaorg'

distance = 247
spam score = 7
title = 'e37 esoft estimate nettools essential build ma windowsxpkeygenkeychangecrackslomalkaorg'

distance = 263
spam score = 7
title = 'e37 esoft estimate nettools essential build ma namov55regfilebyneocoderzcrackslomalkaorg'

distance = 263
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activexmanagerv14byamokcrackslomalkaorg'

distance = 264
spam score = 6
title = 'e37 esoft estimate nettools essential build ma objecteeringumlenterpriseeditionv530workingcrackslomalkaorg'

distance = 264
spam score = 7
title = 'e37 esoft estimate nettools essential build ma antidote2000crackslomalkaorg'

distance = 264
spam score = 7
title = 'e37 esoft estimate nettools essential build ma adventnetqenginewebtestv40crackslomalkaorg'

distance = 265
spam score = 6
title = 'e37 esoft estimate nettools essential build ma activefaxserverv388build195germancrackslomalkaorg'

distance = 265
spam score = 6
title = 'e37 esoft estimate nettools essential build ma emailextractorexpressv20byevccrackslomalkaorg'

distance = 265
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activemp3controlforwin32v20crackslomalkaorg'

distance = 265
spam score = 6
title = 'e37 esoft estimate nettools essential build ma amigoeasyvideoconverterv509crackslomalkaorg'

distance = 265
spam score = 6
title = 'e37 esoft estimate nettools essential build ma findduplicatev22crackslomalkaorg'

distance = 292
spam score = 7
title = 'e37 esoft estimate nettools essential build ma ashampoouninstallersuitev1300crackslomalkaorg'

distance = 293
spam score = 7
title = 'e37 esoft estimate nettools essential build ma activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 293
spam score = 7
title = 'e37 esoft estimate nettools essential build ma aadvanceddialerv21crackslomalkaorg'

distance = 295
spam score = 8
title = 'e37 esoft estimate nettools essential build ma autoandboatcaremaintenancesoftwarev21crackslomalkaorg'

distance = 295
spam score = 7
title = 'e37 esoft estimate nettools essential build ma ubrechnungv206crackslomalkaorg'

distance = 296
spam score = 7
title = 'e37 esoft estimate nettools essential build ma windowsxpservicepack2activatorcrackslomalkaorg'

distance = 297
spam score = 6
title = 'e37 esoft estimate nettools essential build ma powerarchiver2002v80063germancrackslomalkaorg'

distance = 297
spam score = 7
title = 'e37 esoft estimate nettools essential build ma puzzleinlaydeluxev10crackslomalkaorg'

distance = 297
spam score = 7
title = 'e37 esoft estimate nettools essential build ma actualtestscomcitrix1y0962examcheatsheetv102903crackslomalkaorg'

distance = 298
spam score = 7
title = 'e37 esoft estimate nettools essential build ma animatedscreenv61keygencrackslomalkaorg'

distance = 359
spam score = 6
title = 'e37 esoft estimate nettools essential build ma argosoftmailserverprowithimapv1853crackslomalkaorg'

distance = 384
spam score = 6
title = 'e37 esoft estimate nettools essential build ma postguardv32multilannguagecrackslomalkaorg'

distance = 386
spam score = 7
title = 'e37 esoft estimate nettools essential build ma fprotantivirusv315bevafstopwupdatercrackslomalkaorg'

distance = 386
spam score = 7
title = 'e37 esoft estimate nettools essential build ma abylonlogonsav600111multilingualcrackslomalkaorg'

distance = 394
spam score = 6
title = 'e37 esoft estimate nettools essential build ma osadobephotoshopcs2tryouttofullactivationkeygenbyoscoriacrackslomalkaorg'

distance = 403
spam score = 7
title = 'e37 esoft estimate nettools essential build ma adobeacrobatv70professionaltryoutcrackbytimcrackslomalkaorg'

distance = 31
spam score = 12
title = 'n15 pro netscan build netop netscantools seria alignitv1xcrackslomalkaorg'

distance = 32
spam score = 11
title = 'n15 pro netscan build netop netscantools seria slomalkaorg'

distance = 38
spam score = 12
title = 'n15 pro netscan build netop netscantools seria xadventurev10crackslomalkaorg'

distance = 43
spam score = 12
title = 'n15 pro netscan build netop netscantools seria areaeditorv115crackslomalkaorg'

distance = 46
spam score = 12
title = 'n15 pro netscan build netop netscantools seria keygenslomalkaorg'

distance = 46
spam score = 11
title = 'n15 pro netscan build netop netscantools seria r2v504ecrackslomalkaorg'

distance = 56
spam score = 12
title = 'n15 pro netscan build netop netscantools seria tableditv201crackslomalkaorg'

distance = 64
spam score = 12
title = 'n15 pro netscan build netop netscantools seria eplanpro35crackslomalkaorg'

distance = 67
spam score = 12
title = 'n15 pro netscan build netop netscantools seria p7dp7crackslomalkaorg'

distance = 69
spam score = 11
title = 'n15 pro netscan build netop netscantools seria adayinthelife15crackslomalkaorg'

distance = 70
spam score = 12
title = 'n15 pro netscan build netop netscantools seria activexmanagerv13byserials2000crackslomalkaorg'

distance = 75
spam score = 11
title = 'n15 pro netscan build netop netscantools seria accessmanager60crackslomalkaorg'

distance = 76
spam score = 12
title = 'n15 pro netscan build netop netscantools seria filescannerprov15crackcrackslomalkaorg'

distance = 82
spam score = 12
title = 'n15 pro netscan build netop netscantools seria stylexpallversionskeygencrackslomalkaorg'

distance = 85
spam score = 12
title = 'n15 pro netscan build netop netscantools seria a1surfv20crackslomalkaorg'

distance = 85
spam score = 11
title = 'n15 pro netscan build netop netscantools seria fontviewer10crackslomalkaorg'

distance = 88
spam score = 11
title = 'n15 pro netscan build netop netscantools seria uwipe14crackslomalkaorg'

distance = 88
spam score = 12
title = 'n15 pro netscan build netop netscantools seria freememprofessionalv5001crackslomalkaorg'

distance = 89
spam score = 11
title = 'n15 pro netscan build netop netscantools seria f12000v10crackslomalkaorg'

distance = 90
spam score = 12
title = 'n15 pro netscan build netop netscantools seria tableeditorv104crackslomalkaorg'

distance = 154
spam score = 12
title = 'n15 pro netscan build netop netscantools seria accessimagev312byintensioncrackslomalkaorg'

distance = 154
spam score = 12
title = 'n15 pro netscan build netop netscantools seria accessadministratorprov22bylashcrackslomalkaorg'

distance = 154
spam score = 14
title = 'n15 pro netscan build netop netscantools seria activerefreshv22622crackslomalkaorg'

distance = 155
spam score = 12
title = 'n15 pro netscan build netop netscantools seria adressermd20017crackslomalkaorg'

distance = 155
spam score = 12
title = 'n15 pro netscan build netop netscantools seria ecampaignprofessionaleditionv2944byfffcrackslomalkaorg'

distance = 156
spam score = 12
title = 'n15 pro netscan build netop netscantools seria tagandrenamev15beta1crackslomalkaorg'

distance = 156
spam score = 12
title = 'n15 pro netscan build netop netscantools seria postmasterv263crackslomalkaorg'

distance = 156
spam score = 12
title = 'n15 pro netscan build netop netscantools seria powerwriterdemov125crackslomalkaorg'

distance = 156
spam score = 13
title = 'n15 pro netscan build netop netscantools seria activerefresh131build509crackslomalkaorg'

distance = 157
spam score = 12
title = 'n15 pro netscan build netop netscantools seria uwipev27crackslomalkaorg'

distance = 172
spam score = 11
title = 'n15 pro netscan build netop netscantools seria acxdiashowprov969germancrackslomalkaorg'

distance = 172
spam score = 12
title = 'n15 pro netscan build netop netscantools seria gzapperprofessionalv142crackslomalkaorg'

distance = 173
spam score = 12
title = 'n15 pro netscan build netop netscantools seria faxamaticv93901crackslomalkaorg'

distance = 173
spam score = 12
title = 'n15 pro netscan build netop netscantools seria ashampoouninstallersuitev131crackslomalkaorg'

distance = 174
spam score = 11
title = 'n15 pro netscan build netop netscantools seria privatepixv280crackslomalkaorg'

distance = 174
spam score = 11
title = 'n15 pro netscan build netop netscantools seria powerclock412crackslomalkaorg'

distance = 174
spam score = 12
title = 'n15 pro netscan build netop netscantools seria absolutetetrisv10crackslomalkaorg'

distance = 174
spam score = 12
title = 'n15 pro netscan build netop netscantools seria facemailv10bycovecrackslomalkaorg'

distance = 174
spam score = 12
title = 'n15 pro netscan build netop netscantools seria aspackv211dfixedcrackslomalkaorg'

distance = 175
spam score = 12
title = 'n15 pro netscan build netop netscantools seria parecettes2006v1000crackslomalkaorg'

distance = 189
spam score = 11
title = 'n15 pro netscan build netop netscantools seria animalsscreensaverv10crackslomalkaorg'

distance = 189
spam score = 12
title = 'n15 pro netscan build netop netscantools seria activefile227crackslomalkaorg'

distance = 189
spam score = 12
title = 'n15 pro netscan build netop netscantools seria animagicgifanimatorv106crackslomalkaorg'

distance = 190
spam score = 12
title = 'n15 pro netscan build netop netscantools seria octopusvs519dcrackslomalkaorg'

distance = 190
spam score = 11
title = 'n15 pro netscan build netop netscantools seria flashtextv10byeminencecrackslomalkaorg'

distance = 190
spam score = 12
title = 'n15 pro netscan build netop netscantools seria activeskinocxv425crackslomalkaorg'

distance = 190
spam score = 12
title = 'n15 pro netscan build netop netscantools seria microsoftoffice2003proserialnumbercrackslomalkaorg'

distance = 190
spam score = 12
title = 'n15 pro netscan build netop netscantools seria architecturalcalculator150crackslomalkaorg'

distance = 190
spam score = 12
title = 'n15 pro netscan build netop netscantools seria atomtime98v21acrackslomalkaorg'

distance = 190
spam score = 12
title = 'n15 pro netscan build netop netscantools seria powerarchiver2003v86002crackslomalkaorg'

distance = 205
spam score = 12
title = 'n15 pro netscan build netop netscantools seria accurevv38enterpriseunixcrackslomalkaorg'

distance = 205
spam score = 12
title = 'n15 pro netscan build netop netscantools seria nortonantivirus2005crackslomalkaorg'

distance = 206
spam score = 11
title = 'n15 pro netscan build netop netscantools seria powereditv212byacmecrackslomalkaorg'

distance = 206
spam score = 12
title = 'n15 pro netscan build netop netscantools seria accessanimationv170byamokcrackslomalkaorg'

distance = 206
spam score = 11
title = 'n15 pro netscan build netop netscantools seria privacyprotectorv410crackslomalkaorg'

distance = 206
spam score = 12
title = 'n15 pro netscan build netop netscantools seria activeskincomponent352crackslomalkaorg'

distance = 206
spam score = 12
title = 'n15 pro netscan build netop netscantools seria acdimagefoxv12crackslomalkaorg'

distance = 206
spam score = 12
title = 'n15 pro netscan build netop netscantools seria powerdvdv40bynkrhccrackslomalkaorg'

distance = 207
spam score = 12
title = 'n15 pro netscan build netop netscantools seria acdfotoangelov10retailcrackslomalkaorg'

distance = 207
spam score = 12
title = 'n15 pro netscan build netop netscantools seria p2cpluspascalcompiler20ecrackslomalkaorg'

distance = 219
spam score = 12
title = 'n15 pro netscan build netop netscantools seria airxonixv136englishcrackslomalkaorg'

distance = 219
spam score = 12
title = 'n15 pro netscan build netop netscantools seria actualdrawingv51byaaocgcrackslomalkaorg'

distance = 219
spam score = 12
title = 'n15 pro netscan build netop netscantools seria axcadv2006build102crackslomalkaorg'

distance = 219
spam score = 12
title = 'n15 pro netscan build netop netscantools seria actualtestscomcitrix1y0721examcheatsheetv50604crackslomalkaorg'

distance = 219
spam score = 12
title = 'n15 pro netscan build netop netscantools seria purgeiev502crackslomalkaorg'

distance = 220
spam score = 11
title = 'n15 pro netscan build netop netscantools seria totalcommanderv653regfilebytwtcrackslomalkaorg'

distance = 220
spam score = 11
title = 'n15 pro netscan build netop netscantools seria posterv75xcrackslomalkaorg'

distance = 220
spam score = 12
title = 'n15 pro netscan build netop netscantools seria windowsxpkeygencrackslomalkaorg'

distance = 220
spam score = 12
title = 'n15 pro netscan build netop netscantools seria activepdfportfolioprofessional35crackslomalkaorg'

distance = 220
spam score = 12
title = 'n15 pro netscan build netop netscantools seria packplus201crackslomalkaorg'

distance = 234
spam score = 11
title = 'n15 pro netscan build netop netscantools seria filestoragev26forbcb4crackslomalkaorg'

distance = 234
spam score = 12
title = 'n15 pro netscan build netop netscantools seria p2cpluspascalcompiler2006ecrackslomalkaorg'

distance = 234
spam score = 12
title = 'n15 pro netscan build netop netscantools seria airnavacarsdecoderv21crackslomalkaorg'

distance = 234
spam score = 12
title = 'n15 pro netscan build netop netscantools seria adobeacrobatv70professionalkeygenbyparodoxcrackslomalkaorg'

distance = 235
spam score = 12
title = 'n15 pro netscan build netop netscantools seria absolutehtmloptimizerv15byquartexcrackslomalkaorg'

distance = 235
spam score = 12
title = 'n15 pro netscan build netop netscantools seria powerarchiver2003v88beta1crackslomalkaorg'

distance = 235
spam score = 12
title = 'n15 pro netscan build netop netscantools seria apluscadcopyv20crackslomalkaorg'

distance = 235
spam score = 12
title = 'n15 pro netscan build netop netscantools seria powerarchiver2001v70201crackslomalkaorg'

distance = 235
spam score = 11
title = 'n15 pro netscan build netop netscantools seria poweraudioeditorv305crackslomalkaorg'

distance = 235
spam score = 11
title = 'n15 pro netscan build netop netscantools seria axetheadvancedhexeditorv21bysccrackslomalkaorg'

distance = 253
spam score = 11
title = 'n15 pro netscan build netop netscantools seria axialisaxcdplayerv260crackslomalkaorg'

distance = 253
spam score = 12
title = 'n15 pro netscan build netop netscantools seria ageofempiresfranaiscrackslomalkaorg'

distance = 253
spam score = 11
title = 'n15 pro netscan build netop netscantools seria amiquotev169crackbyinfectedcrackslomalkaorg'

distance = 253
spam score = 11
title = 'n15 pro netscan build netop netscantools seria familytreemakerv302crackslomalkaorg'

distance = 254
spam score = 12
title = 'n15 pro netscan build netop netscantools seria archivepowerathomev15byc4acrackslomalkaorg'

distance = 254
spam score = 12
title = 'n15 pro netscan build netop netscantools seria tntscreencapturev141build166crackslomalkaorg'

distance = 254
spam score = 11
title = 'n15 pro netscan build netop netscantools seria proxyinspectorforwingatev26ccrackslomalkaorg'

distance = 254
spam score = 11
title = 'n15 pro netscan build netop netscantools seria pacdoomiiihalloweenv10crackslomalkaorg'

distance = 255
spam score = 11
title = 'n15 pro netscan build netop netscantools seria powerwmarecorderv11crackslomalkaorg'

distance = 255
spam score = 13
title = 'n15 pro netscan build netop netscantools seria actualwindowguardv28crackslomalkaorg'

distance = 276
spam score = 12
title = 'n15 pro netscan build netop netscantools seria argosoftftpserverv1413crackslomalkaorg'

distance = 277
spam score = 11
title = 'n15 pro netscan build netop netscantools seria agnitumtauscanv165build1212crackslomalkaorg'

distance = 277
spam score = 11
title = 'n15 pro netscan build netop netscantools seria acdvideomagicv10sr2bybidjancrackslomalkaorg'

distance = 277
spam score = 12
title = 'n15 pro netscan build netop netscantools seria advancedquerytoolv30byorioncrackslomalkaorg'

distance = 277
spam score = 12
title = 'n15 pro netscan build netop netscantools seria avimpegrmwmvjoinerv421crackslomalkaorg'

distance = 278
spam score = 11
title = 'n15 pro netscan build netop netscantools seria fprotantivirusv312dbyfullmooncrackslomalkaorg'

distance = 280
spam score = 12
title = 'n15 pro netscan build netop netscantools seria efunsoftmastermind10bytntcrackslomalkaorg'

distance = 280
spam score = 12
title = 'n15 pro netscan build netop netscantools seria namowebeditorv602105trialfrenchcrackslomalkaorg'

distance = 280
spam score = 12
title = 'n15 pro netscan build netop netscantools seria advancedarchivepasswordrecoveryv101bylocklesscrackslomalkaorg'

distance = 280
spam score = 12
title = 'n15 pro netscan build netop netscantools seria puzzlebrainstormv125byraidcrackslomalkaorg'

distance = 350
spam score = 10
title = 'n15 pro netscan build netop netscantools seria powervideoconverterv138bycafecrackslomalkaorg'

distance = 350
spam score = 12
title = 'n15 pro netscan build netop netscantools seria appliedflowtechnologyaftimpulsev3020031009winalldonglecrackedcrackslomalkaorg'

distance = 353
spam score = 13
title = 'n15 pro netscan build netop netscantools seria actualtestscomprosoftciw1d0470examcheatsheetv70804crackslomalkaorg'

distance = 361
spam score = 12
title = 'n15 pro netscan build netop netscantools seria activestateperldevkitdvk20crackslomalkaorg'

distance = 361
spam score = 12
title = 'n15 pro netscan build netop netscantools seria activeskincontrolocxv40bycucrackslomalkaorg'

distance = 366
spam score = 11
title = 'n15 pro netscan build netop netscantools seria fathsoftfathcryptocxv24bylucidcrackslomalkaorg'

distance = 381
spam score = 11
title = 'n15 pro netscan build netop netscantools seria osadobephotoshopcs2tryouttofullactivationkeygenbyoscoriacrackslomalkaorg'

distance = 1346
spam score = 16
title = 'aurora media workshop v216 auroramediaworkshopv216crackslomalkaorg'

distance = 1353
spam score = 16
title = 'kagayaki iv 4 kagayakiiv4crackslomalkaorg'

distance = 43
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma fircv11crackslomalkaorg'

distance = 49
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma p7dp7crackslomalkaorg'

distance = 51
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma f1racingsimcrackslomalkaorg'

distance = 73
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma absolutetetris10crackslomalkaorg'

distance = 74
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma fcutterv152crackslomalkaorg'

distance = 75
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma xballv25crackslomalkaorg'

distance = 83
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma halcyon60501crackslomalkaorg'

distance = 84
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma emailsv222crackslomalkaorg'

distance = 84
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma activewhoisv212591crackslomalkaorg'

distance = 86
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma vampv1300crackslomalkaorg'

distance = 86
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma actualdrawingv31serialbyevidencecrackslomalkaorg'

distance = 87
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma eiconsv415crackslomalkaorg'

distance = 89
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma ppdforiev703crackslomalkaorg'

distance = 89
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma advancedaircraftanalysis22acrackslomalkaorg'

distance = 90
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma fonty98v216bylashcrackslomalkaorg'

distance = 90
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma atrexv80crackslomalkaorg'

distance = 91
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma filescannerprov13crackslomalkaorg'

distance = 92
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma archiveitallv100crackslomalkaorg'

distance = 92
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma amichartv1455crackslomalkaorg'

distance = 93
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma abracadabrav125crackslomalkaorg'

distance = 154
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma friendsv10crackslomalkaorg'

distance = 154
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma nortoninternetsecurity2005crackslomalkaorg'

distance = 155
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma fsecureantivirusv552crackslomalkaorg'

distance = 156
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma f22raptor1002100rcrackslomalkaorg'

distance = 157
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma aaaquicksearch302crackslomalkaorg'

distance = 157
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma fontsubstv142forpalmoscrackslomalkaorg'

distance = 158
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma finderskeepersv1crackslomalkaorg'

distance = 158
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma fineprintenterprisev522crackslomalkaorg'

distance = 159
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma farcrycrackslomalkaorg'

distance = 159
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma adayinthelifev151keygencrackslomalkaorg'

distance = 177
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma activeskinv426crackslomalkaorg'

distance = 177
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma ebusinessappletv40crackslomalkaorg'

distance = 178
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma avemariapokerv20crackslomalkaorg'

distance = 178
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma rdriveimagev111114crackslomalkaorg'

distance = 179
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma fobozv152crackslomalkaorg'

distance = 180
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma arobfantasticmp3networkedencoderv14crackslomalkaorg'

distance = 180
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma emailextractorexpressv21byevidencecrackslomalkaorg'

distance = 180
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma pi2004editionsr1v8060014crackslomalkaorg'

distance = 180
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma aerotagstagslockprov222crackslomalkaorg'

distance = 180
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma arialsoundrecorderv116crackslomalkaorg'

distance = 196
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma aplusfileprotectionv21crackslomalkaorg'

distance = 196
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma allcalcv220crackslomalkaorg'

distance = 196
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma facemailv10bytsrhcrackslomalkaorg'

distance = 196
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma allclearv50crackslomalkaorg'

distance = 196
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma folderguardprofessionalv71bytportcrackslomalkaorg'

distance = 196
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma freshuiv500crackslomalkaorg'

distance = 197
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma freshdownloadv540crackslomalkaorg'

distance = 198
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma activereports2professionalbydatadynamicscrackslomalkaorg'

distance = 198
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma animatedgifproducerv32crackslomalkaorg'

distance = 198
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma airplanv7951crackslomalkaorg'

distance = 212
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma asmeweldingprowrite41crackslomalkaorg'

distance = 212
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma p2cpluspascalcompiler12410ecrackslomalkaorg'

distance = 212
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma antennawebdesignstudiov1673bycafecrackslomalkaorg'

distance = 213
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma kasperskyantiviruspersonalprocrackslomalkaorg'

distance = 213
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma anydvd596xupdated2universalpatchcrackslomalkaorg'

distance = 213
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma activexmanagerv14crackslomalkaorg'

distance = 213
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma anagramizerv131crackslomalkaorg'

distance = 213
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma activerefreshv22622crackslomalkaorg'

distance = 213
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma ecampaigncorporateeditionv488crackslomalkaorg'

distance = 214
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma r0m4nscrackme1tutorialbyevidencecrackslomalkaorg'

distance = 229
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma ashampoomp3audiocenterv150crackslomalkaorg'

distance = 230
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma privacyprotectorv410crackslomalkaorg'

distance = 230
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma fastreamftpp2pv36b16crackslomalkaorg'

distance = 230
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma emailhunterv120crackslomalkaorg'

distance = 230
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma privacyguarderv30crackslomalkaorg'

distance = 230
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma editorebookcompilerv25crackslomalkaorg'

distance = 230
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma arealvalidatorv11crackslomalkaorg'

distance = 231
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma kasperskyantiviruspersonalv50227keygenfilecrackslomalkaorg'

distance = 231
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma appletmenuwizardv10byeltorocrackslomalkaorg'

distance = 231
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma eiconsv343patchcrackslomalkaorg'

distance = 247
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma antechinuscsharpeditorv61crackslomalkaorg'

distance = 247
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma argentumbackupv180crackslomalkaorg'

distance = 248
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma fatcatheartsv13crackslomalkaorg'

distance = 248
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma adayatthebeachslots11crackslomalkaorg'

distance = 248
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma powercardmakerv34bycafecrackslomalkaorg'

distance = 248
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma purchaseorderv15r5crackslomalkaorg'

distance = 248
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma actualtestscomoracle1z0026examcheatsheetv112203crackslomalkaorg'

distance = 249
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma halflife2byapecrackslomalkaorg'

distance = 249
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma aheadneroburningromultraeditionv6300crackslomalkaorg'

distance = 249
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma archimedeside68hc12relt99gcrackslomalkaorg'

distance = 268
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma ucertifymicrosoftm70221prepkitv80005crackslomalkaorg'

distance = 269
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma aardvarkprettyprinterforvb60106crackslomalkaorg'

distance = 269
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma acousticamp3towaveconverterplusv201crackslomalkaorg'

distance = 269
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma postmasterv271crackslomalkaorg'

distance = 269
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma activeskincontrolocxv40byadhamdahabcrackslomalkaorg'

distance = 269
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma puzzlechampionv1030215bytmgcrackslomalkaorg'

distance = 270
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma ashampoomp3audiocenterv150bycimcrackslomalkaorg'

distance = 270
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma absolutesoundrecorderv321crackslomalkaorg'

distance = 270
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma asserwareunitconverterproaucprov12crackslomalkaorg'

distance = 271
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma powercardmakerv344crackslomalkaorg'

distance = 294
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma efunsoftmastermind10bytntcrackslomalkaorg'

distance = 294
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma ativaprov305byfhcfcrackslomalkaorg'

distance = 294
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma tagandrenamev20xpfixedcrackslomalkaorg'

distance = 294
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma powervideoconverterv138byfffcrackslomalkaorg'

distance = 295
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma aspmagicfilecrackslomalkaorg'

distance = 295
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma activefaxserverv388build195germancrackslomalkaorg'

distance = 296
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma accessimagev312bydbccrackslomalkaorg'

distance = 297
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma akramaudioconverterv11crackslomalkaorg'

distance = 298
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma windowsxpantiproductactivationcrackcrackslomalkaorg'

distance = 300
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma actualtestscomcisco640910examcheatsheetv110603crackslomalkaorg'

distance = 435
spam score = 2
title = 'p13 paraben s paragon parallaxis v20 build ma osadobeillustratorcs2tryouttofullactivationkeygenbyoscarcrackslomalkaorg'

distance = 2
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil qprov20120crackslomalkaorg'

distance = 34
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil tagandm3uv13crackslomalkaorg'

distance = 43
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil xsqueezemev402crackslomalkaorg'

distance = 47
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil serialslomalkaorg'

distance = 56
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil fivesandthreesv13keygencrackslomalkaorg'

distance = 63
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil accessadministratorv14crackslomalkaorg'

distance = 65
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil ntrackstudiov3111crackslomalkaorg'

distance = 66
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil adcsv106crackcrackslomalkaorg'

distance = 69
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil qheal5216crackslomalkaorg'

distance = 72
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil eiconsv325crackslomalkaorg'

distance = 74
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil g6renamer2000v14crackcrackslomalkaorg'

distance = 77
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil filterscatalogv101crackslomalkaorg'

distance = 78
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil footballgenerationcrackslomalkaorg'

distance = 80
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil adressverwaltung2004v159crackslomalkaorg'

distance = 80
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil nailgun13crackslomalkaorg'

distance = 81
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil vamp3playerv2xgermancrackslomalkaorg'

distance = 81
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil eiconsv343keygencrackslomalkaorg'

distance = 85
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil argentumbackupv10crackslomalkaorg'

distance = 86
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil xvideojoinerv16crackslomalkaorg'

distance = 91
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil filesynchronizerv10crackslomalkaorg'

distance = 153
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil ebiurov1000crackslomalkaorg'

distance = 153
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil animatedscreenv68keygencrackslomalkaorg'

distance = 154
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil eiconsv415crackslomalkaorg'

distance = 154
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil activexmanagerv14byeminencecrackslomalkaorg'

distance = 154
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil fcutterv160crackslomalkaorg'

distance = 154
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil afterburn093betafor3dstudiomax2crackslomalkaorg'

distance = 154
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil fprotantivirusforwindowsv310crackslomalkaorg'

distance = 155
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil filematrixv71crackslomalkaorg'

distance = 155
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil acronismigrateeasyv60crackslomalkaorg'

distance = 156
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil a1monitorv222crackslomalkaorg'

distance = 173
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil automp3renamerv22crackslomalkaorg'

distance = 173
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil xsqueezemev404crackslomalkaorg'

distance = 174
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil adwizard12crackslomalkaorg'

distance = 174
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil activescreenlockpasswordrecoveryv16crackslomalkaorg'

distance = 174
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil fordracing3ripcrackslomalkaorg'

distance = 174
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil activegenderv25crackslomalkaorg'

distance = 174
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil aplusvideotoipodv30crackslomalkaorg'

distance = 175
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil filescavengerv20bcrackslomalkaorg'

distance = 175
spam score = 13
title = 'g26 guitar pro studio guesthouse box v26 buil achessexpertprofessionaleditionv371crackslomalkaorg'

distance = 175
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil efunsoftmastermind10bytntcrackslomalkaorg'

distance = 189
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil advancedreplacerv11byhscrackslomalkaorg'

distance = 189
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil admwinv605crackslomalkaorg'

distance = 189
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil aspackv211crackcrackslomalkaorg'

distance = 189
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil advancedquerytoolv511crackslomalkaorg'

distance = 189
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil asianviewerv11crackslomalkaorg'

distance = 190
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil aideonlinometerv17crackslomalkaorg'

distance = 190
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil filesecurerv351byarteamcrackslomalkaorg'

distance = 190
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil activebarxplookbuild25011crackslomalkaorg'

distance = 190
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil accurevv381linuxcrackslomalkaorg'

distance = 190
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil pacecalcv112crackslomalkaorg'

distance = 203
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil freemeterpro241crackslomalkaorg'

distance = 203
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil activeskinv41bypooqcrackslomalkaorg'

distance = 204
spam score = 13
title = 'g26 guitar pro studio guesthouse box v26 buil pcadallversionscrackslomalkaorg'

distance = 204
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil actualsearchandreplacev1225crackslomalkaorg'

distance = 204
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil ecard37crackslomalkaorg'

distance = 204
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil fsecuresshclientv5454crackslomalkaorg'

distance = 205
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil gadugaduv491crackslomalkaorg'

distance = 205
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil windowsxpprocrackslomalkaorg'

distance = 205
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil halloween2000v20crackslomalkaorg'

distance = 205
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil agsoftwarepasswordkeeperv217crackslomalkaorg'

distance = 221
spam score = 13
title = 'g26 guitar pro studio guesthouse box v26 buil activesmartscsiv231byssgcrackslomalkaorg'

distance = 221
spam score = 13
title = 'g26 guitar pro studio guesthouse box v26 buil ttachesv10r1crackslomalkaorg'

distance = 221
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil eplusmaxaltera100crackslomalkaorg'

distance = 221
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil atclockv11betacrackslomalkaorg'

distance = 221
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil avimpegrmwmvjoinerv421crackslomalkaorg'

distance = 221
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil airxonixv136serbiancrackslomalkaorg'

distance = 221
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil rdriveimage10build1013crackslomalkaorg'

distance = 221
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil alleditorv243byfffcrackslomalkaorg'

distance = 221
spam score = 13
title = 'g26 guitar pro studio guesthouse box v26 buil nod32allversionscrackslomalkaorg'

distance = 221
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil filescavengerv140acrackslomalkaorg'

distance = 236
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil rdriveimagev30b3011crackslomalkaorg'

distance = 237
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil activestatetcldevkitv261crackslomalkaorg'

distance = 237
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil protrackertennisv33crackslomalkaorg'

distance = 238
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil apollodatacontrolforvbv6108crackslomalkaorg'

distance = 239
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil emailextractorexpressv210511regfilecrackslomalkaorg'

distance = 239
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil animatedchartactivexv10crackslomalkaorg'

distance = 240
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil privatepixv280crackslomalkaorg'

distance = 240
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil p2cpluspascalcompiler20ecrackslomalkaorg'

distance = 240
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil pacdoomiiihalloweenv10crackslomalkaorg'

distance = 240
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil fairstarsaudioconverterv1407crackslomalkaorg'

distance = 259
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil pinnaclestudioplusv93multilanguagecrackslomalkaorg'

distance = 259
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil kasperskyantiviruspersonalv50xfixedcrackslomalkaorg'

distance = 260
spam score = 13
title = 'g26 guitar pro studio guesthouse box v26 buil fablockocxactivexcomponent10crackslomalkaorg'

distance = 260
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil activeskinv4273crackslomalkaorg'

distance = 260
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil adobeacrobatv70professionaltryoutcrackbytimcrackslomalkaorg'

distance = 260
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil namodeepsearchv306fullcrackslomalkaorg'

distance = 260
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil alphaballv14trainerbyfffcrackslomalkaorg'

distance = 260
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil adventnetagenttoolkitceditionv601crackslomalkaorg'

distance = 261
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil aplusfilenamingsystemv110crackslomalkaorg'

distance = 261
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil activexmanagerv14bydbccrackslomalkaorg'

distance = 284
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil glockadvancedadministrativetoolsv555crackslomalkaorg'

distance = 284
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil qawizardforwebwindowsandjavaapplicationsv223crackslomalkaorg'

distance = 284
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil abcwallpapermachinev2000434crackslomalkaorg'

distance = 286
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil powerarchiver2001v70crackslomalkaorg'

distance = 286
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil abcpixv219patchbydesperatecrackslomalkaorg'

distance = 287
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil animatedformeffect10fordelphi5crackslomalkaorg'

distance = 288
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil absolutistillustrixanimaldreamv10forpalmos5crackslomalkaorg'

distance = 290
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil privateencryptorv62byarncrackslomalkaorg'

distance = 290
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil appletmarqueewizardv35bysyntaxcrackslomalkaorg'

distance = 290
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil protexev18crackslomalkaorg'

distance = 367
spam score = 12
title = 'g26 guitar pro studio guesthouse box v26 buil namowebeditorv402trialbyamokcrackslomalkaorg'

distance = 383
spam score = 11
title = 'g26 guitar pro studio guesthouse box v26 buil acousticamp3towaveconverterplusv2341bysndcrackslomalkaorg'

distance = 1686
spam score = 93
title = 'horse rescue by breed'

distance = 17
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot qwwwcrackslomalkaorg'

distance = 37
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot eiconsv316crackslomalkaorg'

distance = 46
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot r4v108crackslomalkaorg'

distance = 54
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot adronv10crackslomalkaorg'

distance = 57
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot eplanpro35crackslomalkaorg'

distance = 60
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot anfxv5234crackslomalkaorg'

distance = 61
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot facemailv10crackslomalkaorg'

distance = 64
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot ventafaxv50crackslomalkaorg'

distance = 66
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot findflashv15crackslomalkaorg'

distance = 66
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot audiostreamerv200215crackslomalkaorg'

distance = 68
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot frigateprov326086crackslomalkaorg'

distance = 68
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot acqurlv34crackslomalkaorg'

distance = 72
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot adayinthelifev15crackcrackslomalkaorg'

distance = 72
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot emailseekerv17crackslomalkaorg'

distance = 74
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot associatev13byevidencecrackslomalkaorg'

distance = 75
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot financehelper2001v38crackslomalkaorg'

distance = 78
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot aisbackupv181186crackslomalkaorg'

distance = 81
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot fontabc22crackslomalkaorg'

distance = 82
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot axev30crackslomalkaorg'

distance = 84
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot ubsellerv218crackslomalkaorg'

distance = 153
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot allamericanginrummycrackslomalkaorg'

distance = 154
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot airnavselcaldecoderv10crackslomalkaorg'

distance = 154
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot adamtheinsidestorycrackslomalkaorg'

distance = 154
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot anfibiadeskmanprov55crackslomalkaorg'

distance = 154
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot stylexpv306keygenbyexclipsecrackslomalkaorg'

distance = 154
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot activeskinv423crackslomalkaorg'

distance = 154
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot agendamsdv410englishcrackslomalkaorg'

distance = 156
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot filescavengerv21crackslomalkaorg'

distance = 156
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot powerclock407crackslomalkaorg'

distance = 157
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot ecardxpress10crackslomalkaorg'

distance = 174
spam score = 14
title = 'v11 vidlizard videotoolbox pro vidilink videot antennawebdesignstudiov2xcrackslomalkaorg'

distance = 174
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot activewebcamv75multilingualcrackslomalkaorg'

distance = 174
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot rwipecleanv351095crackslomalkaorg'

distance = 174
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot abcwarearealv2000220crackslomalkaorg'

distance = 175
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot freshdownloadv60crackslomalkaorg'

distance = 175
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot xaudiovideoclipjoinerv121124crackslomalkaorg'

distance = 175
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot advanceduninstallerpro2002v31byrp2kcrackslomalkaorg'

distance = 175
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot activeskincomponent352crackslomalkaorg'

distance = 175
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot activetaskv10crackslomalkaorg'

distance = 176
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot p3shortcutsv10crackslomalkaorg'

distance = 192
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot emailextractorexpressv20byelilacrackslomalkaorg'

distance = 192
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot facefilterv109252standardeditioncrackslomalkaorg'

distance = 192
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot achristmasatsantasv272crackslomalkaorg'

distance = 193
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot antiviruskasperskypersonalpro5xfixedcrackslomalkaorg'

distance = 193
spam score = 14
title = 'v11 vidlizard videotoolbox pro vidilink videot activerefreshv136build551bytsrhcrackslomalkaorg'

distance = 193
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot xsqueezemev404crackslomalkaorg'

distance = 193
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot tablev203crackslomalkaorg'

distance = 193
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot adobeindesigncsv30byagaincrackslomalkaorg'

distance = 194
spam score = 11
title = 'v11 vidlizard videotoolbox pro vidilink videot faststatsanalyzerv274crackslomalkaorg'

distance = 194
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot afileattributemanagerv30crackslomalkaorg'

distance = 204
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot afskaufmann2000v1061crackslomalkaorg'

distance = 204
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot argosoftftpserverv1208crackslomalkaorg'

distance = 204
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot albatrossquickstartv20crackslomalkaorg'

distance = 204
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot absoluteftpv225build225crackslomalkaorg'

distance = 204
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot rdiomp3v2xxcrackslomalkaorg'

distance = 205
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot objectbarv16crackslomalkaorg'

distance = 205
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot filesearchforlanv11crackslomalkaorg'

distance = 205
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot aceposterv123bytbecrackslomalkaorg'

distance = 205
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot activewhoisv212583crackslomalkaorg'

distance = 205
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot atomsyncprov203crackslomalkaorg'

distance = 217
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot activeskincontrolv43crackslomalkaorg'

distance = 218
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot adsalertv15crackslomalkaorg'

distance = 218
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot alwaysontimev1017crackslomalkaorg'

distance = 219
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot galacticpatrolv166bydisruptioncrackslomalkaorg'

distance = 219
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot ecampaigncorporateeditionv4815crackslomalkaorg'

distance = 219
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot fastsendv2000006crackslomalkaorg'

distance = 219
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot autoandboatcaremaintenancesoftwarev25bynitrouscrackslomalkaorg'

distance = 220
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot activefaxserverv387build194crackslomalkaorg'

distance = 220
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot proxycapv20crackslomalkaorg'

distance = 220
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot emailextractorexpressv210511regfilecrackslomalkaorg'

distance = 236
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot purgatioprov70dgermancrackslomalkaorg'

distance = 236
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot purgem2000v300bydsicrackslomalkaorg'

distance = 236
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot windowsxpservicepack2activatorcrackbyhjcrackslomalkaorg'

distance = 236
spam score = 11
title = 'v11 vidlizard videotoolbox pro vidilink videot fastnetconnectionacceleratorv14byevidencecrackslomalkaorg'

distance = 237
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 237
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot privatebookmarksv32byeminencecrackslomalkaorg'

distance = 237
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot adrianakarembeuscreensavercrackslomalkaorg'

distance = 237
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot fprotantivirusforwindowsv310crackslomalkaorg'

distance = 238
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot fireiohci10crackslomalkaorg'

distance = 238
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot alarmmasterbybrigsoftcrackslomalkaorg'

distance = 252
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot axetheadvancedhexeditorv21bypccrackslomalkaorg'

distance = 252
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot privacyforwindowsv32bypccrackslomalkaorg'

distance = 253
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot fprotantivirusv31xevaluationcrackslomalkaorg'

distance = 253
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot afspowershop104crackslomalkaorg'

distance = 253
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot powerarchiver2002v80048rc2crackslomalkaorg'

distance = 253
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot abbyyfinereaderv60corporateeditionserialcrackslomalkaorg'

distance = 253
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot activescreenlockpasswordrecoveryv16crackslomalkaorg'

distance = 254
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot axialisiconworkshopv50corporateeditioncrackslomalkaorg'

distance = 254
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot aiplsingulatorv141keygenbytntcrackslomalkaorg'

distance = 254
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot activesizerbydatadynamicscrackslomalkaorg'

distance = 273
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot hailstormv30crackslomalkaorg'

distance = 273
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot privatepixv211bytntcrackslomalkaorg'

distance = 273
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot fablockocxactivexcomponent10crackslomalkaorg'

distance = 274
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot posterdrucker4040crackslomalkaorg'

distance = 274
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot animallogicmaxmanv13andabovefor3dsmaxcrackslomalkaorg'

distance = 275
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot privacydummyv10bynitrouscrackslomalkaorg'

distance = 275
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot fastreportprofessionalv303fordelphiandbcbretailcrackslomalkaorg'

distance = 275
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot qawizardforwebandwindowsapplicationsv221113crackslomalkaorg'

distance = 275
spam score = 14
title = 'v11 vidlizard videotoolbox pro vidilink videot albumgeneratorandviewerv2030byenfusiacrackslomalkaorg'

distance = 275
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot accurateburnv102crackslomalkaorg'

distance = 354
spam score = 12
title = 'v11 vidlizard videotoolbox pro vidilink videot activeskinocxv43patchbydceptioncrackslomalkaorg'

distance = 408
spam score = 13
title = 'v11 vidlizard videotoolbox pro vidilink videot pcad2001fulltrialfixedv2crackslomalkaorg'

distance = 1869
spam score = 33
title = 'litwa'

distance = 40
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl f12000v10crackslomalkaorg'

distance = 41
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl accessanimationv115crackslomalkaorg'

distance = 45
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl ascv30crackslomalkaorg'

distance = 47
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl ecleanv101crackslomalkaorg'

distance = 53
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl avkv3202crackslomalkaorg'

distance = 56
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl edomicrackslomalkaorg'

distance = 60
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl aaawavev3123crackslomalkaorg'

distance = 60
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl emanagerv35b08crackslomalkaorg'

distance = 71
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl ecampaignv30crackslomalkaorg'

distance = 73
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl emailsv222crackslomalkaorg'

distance = 73
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl activeskinv421crackslomalkaorg'

distance = 75
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl fircv11crackslomalkaorg'

distance = 76
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl vschedulerv2010crackslomalkaorg'

distance = 77
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl finditv400byembracecrackslomalkaorg'

distance = 78
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl accessdeniedv201crackslomalkaorg'

distance = 82
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl r2v507gcrackslomalkaorg'

distance = 82
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl xcutv10crackslomalkaorg'

distance = 86
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl finalfantasycrackslomalkaorg'

distance = 86
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl p2crocket11crackslomalkaorg'

distance = 88
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl animatedscreenv52crackslomalkaorg'

distance = 153
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl fsecureantivirusv406crackslomalkaorg'

distance = 154
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl flamingpearglitteratov102crackslomalkaorg'

distance = 154
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl filepreviewv131crackslomalkaorg'

distance = 154
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl eplanpro30crackslomalkaorg'

distance = 154
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl advancedavisplitterv126023crackslomalkaorg'

distance = 154
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl animalcloseupscrackslomalkaorg'

distance = 154
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl firegraphicv60600crackslomalkaorg'

distance = 155
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl tabitv158crackslomalkaorg'

distance = 155
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl activediary33crackslomalkaorg'

distance = 155
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl faxamaticva96018crackslomalkaorg'

distance = 171
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl gbee13crackslomalkaorg'

distance = 171
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl findduplicate101build112crackslomalkaorg'

distance = 172
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl spywaredoctorv300288crackslomalkaorg'

distance = 172
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl arealvalidatorcrackslomalkaorg'

distance = 172
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl emailalertv1019byimscrackslomalkaorg'

distance = 172
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl flashgetv096beta1crackslomalkaorg'

distance = 173
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl fileshredder28crackslomalkaorg'

distance = 173
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl activexmanagerv13byfhcfcrackslomalkaorg'

distance = 173
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl activewhoisv212583crackslomalkaorg'

distance = 173
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl allpilev31aciviltechcrackslomalkaorg'

distance = 185
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl gaeb2000iocrackslomalkaorg'

distance = 186
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl emailalertv10110byeminencecrackslomalkaorg'

distance = 186
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl fabsoftreformenterprisev9003crackslomalkaorg'

distance = 186
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl adreamlottov161multilingualcrackslomalkaorg'

distance = 187
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl autorunassistantv23patchbympcrackslomalkaorg'

distance = 187
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl uwipev25byevccrackslomalkaorg'

distance = 187
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl faxamaticvx93501crackslomalkaorg'

distance = 187
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl filesave2000crackslomalkaorg'

distance = 187
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl awiconsv620bylaxitycrackslomalkaorg'

distance = 187
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl arealvalidatorv111byfhcfcrackslomalkaorg'

distance = 201
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl asmweraserprov11crackslomalkaorg'

distance = 201
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl alphascubalogv36crackslomalkaorg'

distance = 201
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl filetoolsv12serialcrackslomalkaorg'

distance = 201
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl animallogicmayamanv128formayacrackslomalkaorg'

distance = 201
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl akoffmusiccomposerv20serialbyrp2kcrackslomalkaorg'

distance = 202
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl anfyv21crackslomalkaorg'

distance = 202
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl abcencrypt12crackslomalkaorg'

distance = 202
spam score = 9
title = 'w43 winiso winimage v53 realisty v38 wininbl actualtestscomoracle1z0025examcheatsheetv041404crackslomalkaorg'

distance = 202
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl advancedregistrytracerv14bytntcrackslomalkaorg'

distance = 202
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl activeskinv422crackcrackslomalkaorg'

distance = 219
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl aplusfileprotectionv26crackslomalkaorg'

distance = 220
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl amftraynoteplus30crackslomalkaorg'

distance = 220
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl filebuddy301crackslomalkaorg'

distance = 220
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl odderatimeofcommunications99v35crackslomalkaorg'

distance = 220
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl abcalculator11bypccrackslomalkaorg'

distance = 221
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl abisecureprov1017crackslomalkaorg'

distance = 221
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl emailviaphone11byamokcrackslomalkaorg'

distance = 221
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl fileshredder2000v37bynatabeccrackslomalkaorg'

distance = 221
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl auctioninformantv12crackslomalkaorg'

distance = 221
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl addremoveplus2002v300147vncrackingcrackslomalkaorg'

distance = 234
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl absolutesecurityprov37keygencrackslomalkaorg'

distance = 234
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl animatedblackjackv20byelilacrackslomalkaorg'

distance = 234
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl faststartv221byblizzardcrackslomalkaorg'

distance = 234
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl fastypev54crackslomalkaorg'

distance = 234
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl alfaclockv170crackslomalkaorg'

distance = 234
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl flashswitchv10beta11crackslomalkaorg'

distance = 234
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl qarbonviewletcamv102003crackslomalkaorg'

distance = 235
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl apersonaltodolistv10crackslomalkaorg'

distance = 235
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl emailextractorexpressv20byelilacrackslomalkaorg'

distance = 236
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl actualtestscomcitrix1y0930examcheatsheetv122603crackslomalkaorg'

distance = 256
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl powerdefragv301crackbymrkrackercrackslomalkaorg'

distance = 256
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl all4audiomp3makerv110byinsightcrackslomalkaorg'

distance = 257
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl asplogin2000serverlicensecrackslomalkaorg'

distance = 257
spam score = 6
title = 'w43 winiso winimage v53 realisty v38 wininbl fsecuresshclientv540japanesecrackslomalkaorg'

distance = 257
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl activexmanagerv13bycokecrackslomalkaorg'

distance = 257
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl pacdoom3halloweenpartyv21bytsrhcrackslomalkaorg'

distance = 258
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl protectxprofessionaleditionv411keygencrackslomalkaorg'

distance = 258
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl antareschateffects20serialbytcacrackslomalkaorg'

distance = 258
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl firegraphicxpv506361crackslomalkaorg'

distance = 258
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl picsgebhrenzhlerv5201crackslomalkaorg'

distance = 282
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl flamingpearsuperbladeprov110foradobephotoshopcrackslomalkaorg'

distance = 282
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl alltracksgoneprivacycopv250crackslomalkaorg'

distance = 282
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl accentmoneypasswordrecovery100byamokcrackslomalkaorg'

distance = 283
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl applicationmoverbypumqaracrackslomalkaorg'

distance = 283
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl fsecureantivirusforworkstationsv531winxpcrackslomalkaorg'

distance = 283
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl addremoveplus2004v41byfffcrackslomalkaorg'

distance = 283
spam score = 9
title = 'w43 winiso winimage v53 realisty v38 wininbl actualtestscomlotus190521examcheatsheetv93004crackslomalkaorg'

distance = 284
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl firestormdaoarchitecteditionv30203crackslomalkaorg'

distance = 284
spam score = 8
title = 'w43 winiso winimage v53 realisty v38 wininbl argosoftmailserverplusv1619patchbywktcrackslomalkaorg'

distance = 284
spam score = 7
title = 'w43 winiso winimage v53 realisty v38 wininbl windowsxpactivationcrackbyevildudecrackslomalkaorg'

distance = 30
spam score = 8
title = 'j4 jedi jcreator pro jeroboam knight build 2 tablev203crackslomalkaorg'

distance = 51
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 assignedit1111crackslomalkaorg'

distance = 52
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 r2v507gcrackslomalkaorg'

distance = 54
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 emailsv175crackslomalkaorg'

distance = 55
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 divxprov521crackslomalkaorg'

distance = 55
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 animatedscreenv68crackslomalkaorg'

distance = 59
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 falbumv101crackslomalkaorg'

distance = 66
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 accessanimationv200byintensioncrackslomalkaorg'

distance = 67
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 forwardmailv3065crackslomalkaorg'

distance = 68
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 namov308crackslomalkaorg'

distance = 69
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 halov100564crackslomalkaorg'

distance = 70
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 amusicalgeneratorv20288crackslomalkaorg'

distance = 70
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 ebookv1001crackslomalkaorg'

distance = 71
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 architecturalcalculator150crackslomalkaorg'

distance = 73
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 kmailv34214crackslomalkaorg'

distance = 78
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 fcutterv152crackslomalkaorg'

distance = 80
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 aisbackupv10535crackslomalkaorg'

distance = 81
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 abracadabrav12crackslomalkaorg'

distance = 83
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 eiconsv316crackslomalkaorg'

distance = 84
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 p2cpluspascal12407ecrackslomalkaorg'

distance = 162
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 findstring460crackslomalkaorg'

distance = 162
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 eiconsv334crackslomalkaorg'

distance = 162
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 activeskinv43crackslomalkaorg'

distance = 162
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 kasperskyantiviruspersonalcrackslomalkaorg'

distance = 162
spam score = 6
title = 'j4 jedi jcreator pro jeroboam knight build 2 alltotrayv40byfatalerrorcrackslomalkaorg'

distance = 162
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 actualdrawingv46byvirilitycrackslomalkaorg'

distance = 162
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 anfxv43crackslomalkaorg'

distance = 162
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 auctionstation2000v356crackslomalkaorg'

distance = 163
spam score = 8
title = 'j4 jedi jcreator pro jeroboam knight build 2 activexmanagerv13byserials2000crackslomalkaorg'

distance = 163
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 p7dp7crackslomalkaorg'

distance = 180
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 fsecureantivirusv54xcrackslomalkaorg'

distance = 181
spam score = 8
title = 'j4 jedi jcreator pro jeroboam knight build 2 adwareawayv21crackslomalkaorg'

distance = 182
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 alphatrisv310crackslomalkaorg'

distance = 182
spam score = 8
title = 'j4 jedi jcreator pro jeroboam knight build 2 emailhooverv154bytsrhcrackslomalkaorg'

distance = 182
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 eiconsv343patchcrackslomalkaorg'

distance = 182
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 bjigsawv701byorioncrackslomalkaorg'

distance = 182
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 aplusfileprotectionv2101crackslomalkaorg'

distance = 182
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 emailsv225serialbyfffcrackslomalkaorg'

distance = 182
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 acqurlv51bylinezer0crackslomalkaorg'

distance = 182
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 activevocabv30crackslomalkaorg'

distance = 199
spam score = 8
title = 'j4 jedi jcreator pro jeroboam knight build 2 auctionsentryv230crackslomalkaorg'

distance = 199
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 anfxv5248crackslomalkaorg'

distance = 199
spam score = 8
title = 'j4 jedi jcreator pro jeroboam knight build 2 animagicgifanimatorv122byamokcrackslomalkaorg'

distance = 200
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 apispy32v25crackslomalkaorg'

distance = 200
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 oounerasev10build254crackslomalkaorg'

distance = 201
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 rdiomp3v20b11crackslomalkaorg'

distance = 201
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 antechinuscsharpeditorv60crackslomalkaorg'

distance = 201
spam score = 6
title = 'j4 jedi jcreator pro jeroboam knight build 2 filesecurerv354bymadmanherculescrackslomalkaorg'

distance = 201
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 g6ftpserver20beta6and7crackslomalkaorg'

distance = 201
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 adobeaftereffectsv50crackslomalkaorg'

distance = 212
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 audiotimev202byipacrackslomalkaorg'

distance = 213
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 alivefileencryptionv130crackslomalkaorg'

distance = 213
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 fantamirrorv10crackslomalkaorg'

distance = 213
spam score = 6
title = 'j4 jedi jcreator pro jeroboam knight build 2 halflifev1106onlinepatchcrackslomalkaorg'

distance = 213
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 acousticamp3towaveconverterplusv224crackslomalkaorg'

distance = 213
spam score = 6
title = 'j4 jedi jcreator pro jeroboam knight build 2 filetypeswizardv11byeclipsecrackslomalkaorg'

distance = 213
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 adobeimagereadyv70crackslomalkaorg'

distance = 213
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 posterv75xv76xcrackslomalkaorg'

distance = 214
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 alarmmasterv142forpalmosbyeminencecrackslomalkaorg'

distance = 214
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 anfxv5234crackslomalkaorg'

distance = 225
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 assetsmanagerv103forpalmoscrackslomalkaorg'

distance = 225
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 pcad2002crackslomalkaorg'

distance = 225
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 fastbrowserprov51bycybercrackslomalkaorg'

distance = 225
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 aplusstealthwebsiteloggerv21crackslomalkaorg'

distance = 226
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 rwipeandcleanv30build0886crackslomalkaorg'

distance = 226
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 emailextractorexpressv21byorioncrackslomalkaorg'

distance = 226
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 g6utilitiesv170crackslomalkaorg'

distance = 227
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 thesims2crackcrackslomalkaorg'

distance = 227
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 ativaprov305bydsicrackslomalkaorg'

distance = 227
spam score = 8
title = 'j4 jedi jcreator pro jeroboam knight build 2 analysisknowledgesoftwareemaildatabasev399crackslomalkaorg'

distance = 243
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 amaraflashslideshowbuilderv11crackslomalkaorg'

distance = 243
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 acbrowserplusv21crackslomalkaorg'

distance = 243
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 activeskinv41bypooqcrackslomalkaorg'

distance = 243
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 eborderserversmallbushiness12crackslomalkaorg'

distance = 244
spam score = 6
title = 'j4 jedi jcreator pro jeroboam knight build 2 xvideojoinerv173crackslomalkaorg'

distance = 244
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 avvcsv3089crackslomalkaorg'

distance = 244
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 glockeasymailprofessional440build600crackslomalkaorg'

distance = 245
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 pacchapv091crackslomalkaorg'

distance = 245
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 arcservev6xenterpriseforwindowsntcrackslomalkaorg'

distance = 245
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 qbdatatransfermsaccessv200crackslomalkaorg'

distance = 266
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 alawarelairplanev15crackslomalkaorg'

distance = 266
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 privatepixv122crackslomalkaorg'

distance = 267
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 aliveinterneteraserv1028byfritmocrackslomalkaorg'

distance = 267
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 abcalculator11bypccrackslomalkaorg'

distance = 267
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 ashampoomovieshrinkandburnv10crackslomalkaorg'

distance = 267
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 windowsxpservicepack2byunknowncrackslomalkaorg'

distance = 267
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 abracadabrav125bychaoticdemonzcrackslomalkaorg'

distance = 268
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 anawavegravityv20crackslomalkaorg'

distance = 269
spam score = 8
title = 'j4 jedi jcreator pro jeroboam knight build 2 activexmanagerv13bypccrackslomalkaorg'

distance = 269
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 atoumathv21crackslomalkaorg'

distance = 300
spam score = 6
title = 'j4 jedi jcreator pro jeroboam knight build 2 filecompareutilityv131bytsrhcrackslomalkaorg'

distance = 301
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 fontshowv31byjhtcrackslomalkaorg'

distance = 301
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 filetimeedit2v206bydigeraticrackslomalkaorg'

distance = 301
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 apptrackerv210byblizzardcrackslomalkaorg'

distance = 302
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 windowsxpsp2activationcrackbyffgcrackslomalkaorg'

distance = 303
spam score = 6
title = 'j4 jedi jcreator pro jeroboam knight build 2 purchaseorderv131workingbyacmecrackslomalkaorg'

distance = 303
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 atafv511crackslomalkaorg'

distance = 303
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 qrecovery98v126build190crackslomalkaorg'

distance = 303
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 flashfxpv141build829betacrackslomalkaorg'

distance = 303
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 filesplitmagic60byelilacrackslomalkaorg'

distance = 362
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 acdmpowertoolsv102alllanguagesbybidjancrackslomalkaorg'

distance = 366
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 activeskincontrolocxv40byadhamdahabcrackslomalkaorg'

distance = 368
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 avmnetwaysisdnbyamokcrackslomalkaorg'

distance = 369
spam score = 8
title = 'j4 jedi jcreator pro jeroboam knight build 2 autoandboatcaremaintenancesoftwarev25bynitrouscrackslomalkaorg'

distance = 382
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 emailextractorv21build05011bytntcrackslomalkaorg'

distance = 386
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 adobephotoshopcs2keygenbyparodoxcrackslomalkaorg'

distance = 390
spam score = 6
title = 'j4 jedi jcreator pro jeroboam knight build 2 auroravideovcdsvcddvdconverterandcreatorv121bycafecrackslomalkaorg'

distance = 404
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 adobephotoshopcsandimagereadycsv80tryoutcrackslomalkaorg'

distance = 440
spam score = 7
title = 'j4 jedi jcreator pro jeroboam knight build 2 antiviraltoolkitproavpserversuite3xbuildxxxcrackslomalkaorg'

distance = 33
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fx2000v30crackslomalkaorg'

distance = 34
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fishv333431crackslomalkaorg'

distance = 39
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon uwipe27crackslomalkaorg'

distance = 54
spam score = 6
title = 'c9 capella build canasta canopus scan caphyon activerefreshv22622crackslomalkaorg'

distance = 55
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon ecampaignv2961crackslomalkaorg'

distance = 55
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon halflifev1016crackslomalkaorg'

distance = 58
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon financialadvisorv218crackslomalkaorg'

distance = 61
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon advancedbalancev10crackslomalkaorg'

distance = 63
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon ascv30crackslomalkaorg'

distance = 69
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon qacoachv2229crackslomalkaorg'

distance = 72
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon adayinthelifev13crackslomalkaorg'

distance = 72
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fitnessorganizerv110crackslomalkaorg'

distance = 74
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fridayv40251crackslomalkaorg'

distance = 77
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon finditprov40crackslomalkaorg'

distance = 79
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fineprintv502crackslomalkaorg'

distance = 82
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon aspasapv324crackslomalkaorg'

distance = 83
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon hamhelperv201keygencrackslomalkaorg'

distance = 84
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon flightmanagerv12crackslomalkaorg'

distance = 85
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon frapsv221crackslomalkaorg'

distance = 86
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon p7avantgardecrackslomalkaorg'

distance = 149
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon acedvdbackupv122crackslomalkaorg'

distance = 150
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon babylonpro5crackslomalkaorg'

distance = 151
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon foratomicsynchronizationv130crackslomalkaorg'

distance = 151
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon ebusinessappletv40crackslomalkaorg'

distance = 151
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon eborderclient20crackslomalkaorg'

distance = 151
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon gaeb90iov22015germancrackslomalkaorg'

distance = 152
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon gawebserverv1077crackslomalkaorg'

distance = 153
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon pacfishv110crackslomalkaorg'

distance = 153
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon adayinthelife15crackslomalkaorg'

distance = 153
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon aspasapv3122crackslomalkaorg'

distance = 169
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon activeskinv41bypooqcrackslomalkaorg'

distance = 170
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon awphelpv21patchcrackslomalkaorg'

distance = 170
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon farmanagerv17041282crackslomalkaorg'

distance = 170
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon antispyprov102crackslomalkaorg'

distance = 170
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon alarmv550bybpxcrackslomalkaorg'

distance = 170
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon alienattack10rforpalmoscrackslomalkaorg'

distance = 170
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon ageneralpracticelibraryv20100crackslomalkaorg'

distance = 170
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon arialsoundrecorderv116bypccrackslomalkaorg'

distance = 171
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon eiconsv316crackslomalkaorg'

distance = 171
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon gutecollectionbymp2kcrackslomalkaorg'

distance = 187
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon activeskincontrolocxv40crackslomalkaorg'

distance = 187
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon asprotect11keygencrackslomalkaorg'

distance = 187
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon filesave2000crackslomalkaorg'

distance = 188
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon actualtestscomnovell050640examcheatsheetv92904crackslomalkaorg'

distance = 188
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fcutterv160crackslomalkaorg'

distance = 188
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon attila34crackcrackslomalkaorg'

distance = 188
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon privacyinspectorv131crackslomalkaorg'

distance = 189
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fulldiskv46serialbyevidencecrackslomalkaorg'

distance = 189
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon windowsxphomeeditioncrackslomalkaorg'

distance = 189
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon altnmdaemonv680crackslomalkaorg'

distance = 204
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon abeautifulsunsetscreensaverv10crackslomalkaorg'

distance = 205
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon filescannerprov15patchcrackslomalkaorg'

distance = 205
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon editorial2v201crackslomalkaorg'

distance = 205
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon actualtestscommicrosoft070282examqandav091504crackslomalkaorg'

distance = 205
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon albummultimedialnyv20crackslomalkaorg'

distance = 206
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon advancedcallcenterv410600loadercrackslomalkaorg'

distance = 206
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon ubsellerv214crackslomalkaorg'

distance = 207
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon xsoftware123xpcspyv230crackslomalkaorg'

distance = 208
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon absoluteshieldinterneteraserprov322crackslomalkaorg'

distance = 209
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon androidnewsgroupdownloaderv46crackslomalkaorg'

distance = 221
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon privacyshredderv30crackslomalkaorg'

distance = 221
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon editorv30build1090crackslomalkaorg'

distance = 222
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon alphaballv14byorioncrackslomalkaorg'

distance = 222
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon acutefinderv10627bytnocrackslomalkaorg'

distance = 222
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon accessanimationv190bytmgcrackslomalkaorg'

distance = 223
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon aceposterv123byfffcrackslomalkaorg'

distance = 223
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon arobfantasticmp3encoderv13bycorecrackslomalkaorg'

distance = 223
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon facemailv10bycovecrackslomalkaorg'

distance = 223
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon animalcloseupscrackslomalkaorg'

distance = 223
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon allwebmenusv30build484byevccrackslomalkaorg'

distance = 237
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon frontplattendesigner10bytcacrackslomalkaorg'

distance = 237
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon fablockocxactivexcomponent11crackslomalkaorg'

distance = 237
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon g6ftpserverallversionscrackslomalkaorg'

distance = 237
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon oandodefragservereditionv65851crackslomalkaorg'

distance = 237
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon autopilotv210bypgccrackslomalkaorg'

distance = 237
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon advancedmp3homestudiov33crackslomalkaorg'

distance = 238
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon freshdiagnosev580byfffcrackslomalkaorg'

distance = 238
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon afscncpaldrehen10crackslomalkaorg'

distance = 238
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon foldercleanv13crackslomalkaorg'

distance = 238
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon forgetmeknotv160crackslomalkaorg'

distance = 259
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon acousticamp3towaveconverterplusv23xxcrackslomalkaorg'

distance = 260
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon a1clickultrapccleanerv10128crackslomalkaorg'

distance = 260
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon alapshadowcasterv322forquarkxpresscrackslomalkaorg'

distance = 260
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon argosoftmailserverplusv1613crackslomalkaorg'

distance = 260
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon admuncherv43dbyorioncrackslomalkaorg'

distance = 260
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon adobephotoshopcscrackslomalkaorg'

distance = 261
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fsecurevpnplusv550166winnt2kxpcrackslomalkaorg'

distance = 261
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon namowebeditorv304crackslomalkaorg'

distance = 262
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon adobephotoshopcs2keygenbyparodoxcrackslomalkaorg'

distance = 262
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon addremoveplus2002v310201newcrackslomalkaorg'

distance = 287
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon addremoveplus2002v300147vncrackingcrackslomalkaorg'

distance = 288
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon namowebeditor5bysccrackslomalkaorg'

distance = 288
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon windowsxpsp2keygenbyffgcrackslomalkaorg'

distance = 288
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon actualtestscomibm000191examcheatsheetv101503crackslomalkaorg'

distance = 289
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon allpurposelegaldocumentsv101byevidencecrackslomalkaorg'

distance = 289
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fingerdialv53crackslomalkaorg'

distance = 289
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon emailviaphone11byamokcrackslomalkaorg'

distance = 290
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon amiquotev164byroussdcrackslomalkaorg'

distance = 290
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon argosoftmailserverplusv1405crackslomalkaorg'

distance = 290
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon airmessengersnppv312crackslomalkaorg'

distance = 356
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon autoplaymenubuilderv40build682bysndcrackslomalkaorg'

distance = 359
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon actualtestscomcisco640801examcheatsheetv101803crackslomalkaorg'

distance = 360
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon acousticamp3towaveconverterplusv2341bysndcrackslomalkaorg'

distance = 363
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon activeskincontrolocxv42crackslomalkaorg'

distance = 364
spam score = 5
title = 'c9 capella build canasta canopus scan caphyon actualtestscommicrosoftmosaxpexamcheatsheetv32404crackslomalkaorg'

distance = 365
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon namowebeditorv50bycrackmanboycrackslomalkaorg'

distance = 365
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon pacestarumldiagrammer417build1787trialcrackslomalkaorg'

distance = 400
spam score = 4
title = 'c9 capella build canasta canopus scan caphyon fathsoftfathcryptocxv24bylucidcrackslomalkaorg'

distance = 1833
spam score = 27
title = 'paper local electrochemistry and scanning probe microscopy techniques to clarify intergranular cracking phenomena in weldable martensitic stainless steels corrosion 2009 march 2226 2009'

distance = 37
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu r2v504ecrackslomalkaorg'

distance = 48
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu activegenderv25crackslomalkaorg'

distance = 50
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu ecampaignv295crackslomalkaorg'

distance = 66
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu gagepack2000v558crackslomalkaorg'

distance = 70
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu tableditv201crackslomalkaorg'

distance = 72
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu appstrakav227crackslomalkaorg'

distance = 73
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu accessanimationv100bytntcrackslomalkaorg'

distance = 73
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu formpalv50crackslomalkaorg'

distance = 79
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu animatedscreenv521crackslomalkaorg'

distance = 79
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu ascv30crackslomalkaorg'

distance = 80
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu adamtheinsidestorycrackslomalkaorg'

distance = 81
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu a1worldexchangecalculatorv212crackslomalkaorg'

distance = 86
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu financialadvisorv251crackslomalkaorg'

distance = 87
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu fcutterv160keygencrackslomalkaorg'

distance = 89
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu privateeyev20crackslomalkaorg'

distance = 89
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu pacecalc112crackslomalkaorg'

distance = 91
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu tagandrenamev2174crackslomalkaorg'

distance = 91
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu animatedpuzzlescrackslomalkaorg'

distance = 92
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu atomtime98v21acrackslomalkaorg'

distance = 92
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu alignitv1xcrackslomalkaorg'

distance = 148
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu airstrike2v212crackslomalkaorg'

distance = 148
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu objectrescueprov40141crackslomalkaorg'

distance = 148
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu fapremierleaguestars2001byfhcfcrackslomalkaorg'

distance = 148
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu fabioliveatbbcradio1crackslomalkaorg'

distance = 149
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu fastbrowserprov402crackslomalkaorg'

distance = 149
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu qimagepro1004crackslomalkaorg'

distance = 149
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu atscreenthiefv362crackslomalkaorg'

distance = 150
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu folderguardprov55fixedcrackslomalkaorg'

distance = 150
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu g6renamer2000v14fullyworkingcrackslomalkaorg'

distance = 150
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu anfyv145fixedcrackslomalkaorg'

distance = 169
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu findgraphv1407crackslomalkaorg'

distance = 169
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu halflifeblueshiftkeygencrackslomalkaorg'

distance = 169
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu adpopupkillerv39crackslomalkaorg'

distance = 169
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu acroform20crackslomalkaorg'

distance = 169
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu aurorix2colorspotlightsv20crackslomalkaorg'

distance = 170
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu filepulverizerv40byevidencecrackslomalkaorg'

distance = 171
spam score = 16
title = 'n34 nvidia nuton nvdvd build nusphere phped mu activerefreshv135build535crackslomalkaorg'

distance = 171
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu adayinthelifev13byc0nspiracycrackslomalkaorg'

distance = 171
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu rstudiontfsnetworkv20crackslomalkaorg'

distance = 171
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu activestateperlaspxv110crackslomalkaorg'

distance = 183
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu packplus220crackslomalkaorg'

distance = 184
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu actualdrawingv51byaaocgcrackslomalkaorg'

distance = 184
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu fantasticwomenv11crackslomalkaorg'

distance = 184
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu qcad2xxxcrackslomalkaorg'

distance = 184
spam score = 15
title = 'n34 nvidia nuton nvdvd build nusphere phped mu autoplaymediastudiov5005professionalpart3crackslomalkaorg'

distance = 184
spam score = 15
title = 'n34 nvidia nuton nvdvd build nusphere phped mu allclear30crackslomalkaorg'

distance = 184
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu emailrobberv102build2602crackslomalkaorg'

distance = 184
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu abracadabrav126bytnocrackslomalkaorg'

distance = 185
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu flipalbumv31byinstructorcrackslomalkaorg'

distance = 185
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu flashfxpv22968betacrackslomalkaorg'

distance = 200
spam score = 15
title = 'n34 nvidia nuton nvdvd build nusphere phped mu avirtvoice40crackslomalkaorg'

distance = 200
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu stylexpallversionskeygencrackslomalkaorg'

distance = 201
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu ebackup10byfocccrackslomalkaorg'

distance = 201
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu admuncherv44finalcrackslomalkaorg'

distance = 201
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu acedvdbackupv121crackslomalkaorg'

distance = 201
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu adobephotoshopallcrackslomalkaorg'

distance = 201
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu gforcewinamppluginv253byunknowncrackslomalkaorg'

distance = 201
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu absolutesecuritystdv37crackslomalkaorg'

distance = 201
spam score = 15
title = 'n34 nvidia nuton nvdvd build nusphere phped mu antennawebdesignstudiov1673byblizzardcrackslomalkaorg'

distance = 202
spam score = 12
title = 'n34 nvidia nuton nvdvd build nusphere phped mu fileshredder2000v30byevidencecrackslomalkaorg'

distance = 212
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu activestatevisualxsltforvs2002v1812494crackslomalkaorg'

distance = 212
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu arealvalidatorcrackslomalkaorg'

distance = 212
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu activeskinv43crackslomalkaorg'

distance = 212
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu gzapperprofessionalv142crackslomalkaorg'

distance = 212
spam score = 12
title = 'n34 nvidia nuton nvdvd build nusphere phped mu powerbusinessusa20011steditioncrackslomalkaorg'

distance = 212
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu privacymakerv2420crackslomalkaorg'

distance = 212
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu alarmclock2000v6080crackslomalkaorg'

distance = 212
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu purgem2000v102crackslomalkaorg'

distance = 213
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu emailalertv10110bystreamcrackslomalkaorg'

distance = 213
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu accesslockv272crackslomalkaorg'

distance = 230
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu powerarchiver2003v88001betacrackslomalkaorg'

distance = 230
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu abcpixv21crackslomalkaorg'

distance = 230
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu arobfantasticmp3networkedencoderv14crackslomalkaorg'

distance = 231
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu arobfantasticmp3encoderv20crackslomalkaorg'

distance = 231
spam score = 12
title = 'n34 nvidia nuton nvdvd build nusphere phped mu appletcooltextwizardv10patchcrackslomalkaorg'

distance = 231
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu p2cpluspascalcompilerv2006ecrackslomalkaorg'

distance = 231
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu emailextractorexpressv25build10021crackslomalkaorg'

distance = 231
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu activestateperldevkitv411crackslomalkaorg'

distance = 231
spam score = 12
title = 'n34 nvidia nuton nvdvd build nusphere phped mu octetstringvdedirectorysuitev30macosxcrackslomalkaorg'

distance = 232
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu privacyshieldv3025crackslomalkaorg'

distance = 247
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu uwipev27crackslomalkaorg'

distance = 247
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu alltotrayv45byeatcrackslomalkaorg'

distance = 248
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu arielperformanceanalysissystemapas2000v40crackslomalkaorg'

distance = 248
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu acviewphotoalbumv100crackslomalkaorg'

distance = 248
spam score = 15
title = 'n34 nvidia nuton nvdvd build nusphere phped mu axialiscursorsv45bynemrod34crackslomalkaorg'

distance = 248
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu agendamsdv25038crackslomalkaorg'

distance = 248
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu fantamirrorv10crackslomalkaorg'

distance = 248
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu powercryptov13crackslomalkaorg'

distance = 249
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu fedgev102for3dsmaxv6xcrackslomalkaorg'

distance = 249
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu pacdoom3halloweenpartyv21bytsrhcrackslomalkaorg'

distance = 270
spam score = 12
title = 'n34 nvidia nuton nvdvd build nusphere phped mu advancedbatchconverter265regfilecrackslomalkaorg'

distance = 270
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu rdiomp3v22byamokcrackslomalkaorg'

distance = 270
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu acdvideomagicv10sr2bybidjancrackslomalkaorg'

distance = 271
spam score = 15
title = 'n34 nvidia nuton nvdvd build nusphere phped mu autorunactionmenuv312bytnocrackslomalkaorg'

distance = 272
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu fontshowv31byjhtcrackslomalkaorg'

distance = 272
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu purgeieprov201build21075crackslomalkaorg'

distance = 273
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu acdsystemsfotocanvasv10sr1crackslomalkaorg'

distance = 273
spam score = 13
title = 'n34 nvidia nuton nvdvd build nusphere phped mu activeskincontrolocxv22byeclipsecrackslomalkaorg'

distance = 273
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu airxonixv135fixedbyglupicrackslomalkaorg'

distance = 274
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu antidoteprismedruide2004keygencrackslomalkaorg'

distance = 340
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu arobfantasticmp3encoderv20regfilecrackslomalkaorg'

distance = 344
spam score = 14
title = 'n34 nvidia nuton nvdvd build nusphere phped mu activeskincontrolocxv40bycucrackslomalkaorg'

distance = 358
spam score = 12
title = 'n34 nvidia nuton nvdvd build nusphere phped mu filebackupwatcherv125bytsrhcrackslomalkaorg'

distance = 376
spam score = 15
title = 'n34 nvidia nuton nvdvd build nusphere phped mu actualtestscomprosoftciw1d0437examcheatsheetv011204crackslomalkaorg'

distance = 1797
spam score = 72
title = 'svcl cost sensitive learning'

distance = 1909
spam score = 38
title = 'cmap memb024 black sea east'

distance = 29
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 epop203123crackslomalkaorg'

distance = 46
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 slomalkaorg'

distance = 58
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 ebook12crackslomalkaorg'

distance = 64
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 akeywordthingv10101keygencrackslomalkaorg'

distance = 64
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 qacoachv2215crackslomalkaorg'

distance = 67
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 acepics201crackslomalkaorg'

distance = 71
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 xchat245fcrackslomalkaorg'

distance = 72
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 uanimationv10crackslomalkaorg'

distance = 73
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 activeskinv426crackslomalkaorg'

distance = 76
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 ntrackstudiov20crackslomalkaorg'

distance = 76
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 autotextv117crackslomalkaorg'

distance = 77
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 rwin2000keyboardswitchv6001119crackslomalkaorg'

distance = 78
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 ppdforiev703crackslomalkaorg'

distance = 80
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 animatedblackjackv10crackslomalkaorg'

distance = 81
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 fortrancompilerv81crackslomalkaorg'

distance = 84
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 fishv333431crackslomalkaorg'

distance = 87
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 advancedcallrecorderv130157crackslomalkaorg'

distance = 89
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 freshdownloadv712crackslomalkaorg'

distance = 90
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 ntrackstudiov202214pluginscrackslomalkaorg'

distance = 92
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 oasisprov1310crackslomalkaorg'

distance = 156
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 ebusinessappletv40crackslomalkaorg'

distance = 157
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 abroadv51forpalmoscrackslomalkaorg'

distance = 157
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 kasperskyantiviruspersonalv50121crackslomalkaorg'

distance = 157
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 activelaunchv124crackslomalkaorg'

distance = 158
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 alienlifeforms3dscreensaverv20crackslomalkaorg'

distance = 158
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 finditprov400bytsrhcrackslomalkaorg'

distance = 158
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 emailrobberv102build2602crackslomalkaorg'

distance = 158
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 uwipe10crackslomalkaorg'

distance = 158
spam score = 8
title = 'p15 passmark burnintest build passhat pro v30 activerefreshv22622crackslomalkaorg'

distance = 159
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 f12001keygencrackslomalkaorg'

distance = 174
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 acehighmp3recorderv15crackslomalkaorg'

distance = 175
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 activeskincontrolocxv40crackslomalkaorg'

distance = 175
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 allwebmenusv13build352crackslomalkaorg'

distance = 176
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 ngensilverscrackme1crackslomalkaorg'

distance = 176
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 halcyon60501crackslomalkaorg'

distance = 176
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 affirmativeactionpreprof103crackslomalkaorg'

distance = 177
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 editorebookcompilerv25crackslomalkaorg'

distance = 177
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 activeskincontrolocxv352crackslomalkaorg'

distance = 177
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 filesecurerv342crackslomalkaorg'

distance = 178
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 folderlockv4273bytsrhcrackslomalkaorg'

distance = 189
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 appletmarqueewizardv35byucccrackslomalkaorg'

distance = 190
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 find12crackslomalkaorg'

distance = 190
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 oddinfaust2000v55crackslomalkaorg'

distance = 190
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 arealvalidatorv111byfffcrackslomalkaorg'

distance = 190
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 p2cpascalcompilerv212ecrackslomalkaorg'

distance = 190
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 admuncherv417keygencrackslomalkaorg'

distance = 191
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 antechinusanimatorprofessionalv50crackslomalkaorg'

distance = 191
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 ageneralpracticelibraryv2099crackslomalkaorg'

distance = 191
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 argosoftmailserverprov1863crackslomalkaorg'

distance = 191
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 abcwallpapermachinev1100303crackslomalkaorg'

distance = 204
spam score = 9
title = 'p15 passmark burnintest build passhat pro v30 activerefreshv135build537crackslomalkaorg'

distance = 204
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 addressgrabberv23crackslomalkaorg'

distance = 204
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 flashfxpv20908finalcrackslomalkaorg'

distance = 204
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 accesslockv151byinfernocrackslomalkaorg'

distance = 205
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 nameityourwayniyowv141bycafecrackslomalkaorg'

distance = 206
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 activexmanagerv13byfhcfcrackslomalkaorg'

distance = 206
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 editorv30bymp2kcrackslomalkaorg'

distance = 206
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 fprotantivirusforwindowsv307crackslomalkaorg'

distance = 206
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 filescannerprov13crackslomalkaorg'

distance = 206
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 faststatsanalyzerv28crackslomalkaorg'

distance = 219
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 activezdeletenetv50010byeclipsecrackslomalkaorg'

distance = 219
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 facemailv10bytsrhcrackslomalkaorg'

distance = 219
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 aisaliveproxyv454439crackslomalkaorg'

distance = 219
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 advancedpichunterv155byenfusiacrackslomalkaorg'

distance = 219
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 eplusmaxaltera100crackslomalkaorg'

distance = 220
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 atlantiswordprocessorv1100loaderforwin9xcrackslomalkaorg'

distance = 220
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 animateboxbyxzerocrackslomalkaorg'

distance = 220
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 fairstarsaudioconverterv131crackslomalkaorg'

distance = 220
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 adobephotoshopcs2keygenbyparodoxcrackslomalkaorg'

distance = 221
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 acehighmp3recorderv15byimscrackslomalkaorg'

distance = 237
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 allairehomesitev401evaluationcrackslomalkaorg'

distance = 238
spam score = 8
title = 'p15 passmark burnintest build passhat pro v30 ucertifymicrosoftm70294prepkitv80005crackslomalkaorg'

distance = 238
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 anydvd596xupdated2universalpatchcrackslomalkaorg'

distance = 238
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 aftercamv202byelilacrackslomalkaorg'

distance = 238
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 emailfactoryv12bytsrhcrackslomalkaorg'

distance = 238
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 acdexpressclientv350crackslomalkaorg'

distance = 238
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 adayinthelifev13byc0nspiracycrackslomalkaorg'

distance = 239
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 fsecuantivirusformimesweeperv5419180crackslomalkaorg'

distance = 239
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 galaxyrebellionv141germanallaccesscheatcrackslomalkaorg'

distance = 239
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 windowsxpactivationandreactivationbyruteamcrackslomalkaorg'

distance = 256
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 focusphotoeditorv304crackslomalkaorg'

distance = 256
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 activestateperldevkitdvk20crackslomalkaorg'

distance = 257
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 amigo2000v110crackslomalkaorg'

distance = 257
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 objectbarv121crackslomalkaorg'

distance = 257
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 activeskinv4273crackslomalkaorg'

distance = 258
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 a1quicktrayv20bylocklesscrackslomalkaorg'

distance = 258
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 galacticpatrolv166bydisruptioncrackslomalkaorg'

distance = 258
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 arobfantasticmp3encoderv20regfilecrackslomalkaorg'

distance = 258
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 asserwareunitconverterproaucprov12crackslomalkaorg'

distance = 258
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 activestatetcldevkitv261crackslomalkaorg'

distance = 283
spam score = 8
title = 'p15 passmark burnintest build passhat pro v30 aesopbannermakergifcreatorv15349byfffcrackslomalkaorg'

distance = 283
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 fsecureworkstationsuite401crackslomalkaorg'

distance = 283
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 advancedrarpasswordrecoveryv111byaaocgcrackslomalkaorg'

distance = 285
spam score = 8
title = 'p15 passmark burnintest build passhat pro v30 acdmpowertoolsv102alllanguagesbybidjancrackslomalkaorg'

distance = 286
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 vacationrentaltrackerplusv123crackslomalkaorg'

distance = 286
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 fsprolabslockmypcv23bymp2kcrackslomalkaorg'

distance = 286
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 foodservicesreportingsystemv141crackslomalkaorg'

distance = 287
spam score = 6
title = 'p15 passmark burnintest build passhat pro v30 fprotantivirusforwindowsv311aloaderbytntcrackslomalkaorg'

distance = 287
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 aslvocab10forpalmoscrackslomalkaorg'

distance = 288
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 adobegolivecstryoutv700crackslomalkaorg'

distance = 359
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 windowsxpservicepack2activatorcrackbyhjcrackslomalkaorg'

distance = 374
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 acousticarichpowellsupersetartpackinstallerserialcrackslomalkaorg'

distance = 382
spam score = 7
title = 'p15 passmark burnintest build passhat pro v30 acousticamp3towaveconverterplusv222bynoesiscrackslomalkaorg'

distance = 1893
spam score = 80
title = 'buscacartas'

distance = 21
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit rstudio20crackslomalkaorg'

distance = 34
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit g6renamer2000v14crackcrackslomalkaorg'

distance = 36
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit findv260acrackslomalkaorg'

distance = 46
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit nod32crackslomalkaorg'

distance = 47
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit g6utilitiesv170crackslomalkaorg'

distance = 53
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit serialslomalkaorg'

distance = 62
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit aresv52crackslomalkaorg'

distance = 63
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit ppingtools20acrackslomalkaorg'

distance = 69
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit namo308crackslomalkaorg'

distance = 70
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit associatev13crackslomalkaorg'

distance = 77
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit g6renamerv151crackslomalkaorg'

distance = 78
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit antennav1231crackslomalkaorg'

distance = 84
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit arealvalidatorcrackslomalkaorg'

distance = 85
spam score = 19
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activerefreshv135build535crackslomalkaorg'

distance = 85
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit advancedbiorhythmsv210crackslomalkaorg'

distance = 87
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit aedtoolsv1062ccrackslomalkaorg'

distance = 87
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit emailsv222crackslomalkaorg'

distance = 87
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit ripv107crackslomalkaorg'

distance = 91
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit pacecalc112crackslomalkaorg'

distance = 92
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit accesslockv25crackslomalkaorg'

distance = 161
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit eiconsv370bycorecrackslomalkaorg'

distance = 162
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit antennawebdesignstudiov2078byucfcrackslomalkaorg'

distance = 162
spam score = 14
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit ebusinessappletv2102crackslomalkaorg'

distance = 163
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit archiveitallv100crackslomalkaorg'

distance = 163
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit aisbackupv10535crackslomalkaorg'

distance = 163
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit oandkprintwatchv240crackslomalkaorg'

distance = 164
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit animagicgifanimatorv122akeygencrackslomalkaorg'

distance = 164
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit xfilesscreensaverscrackslomalkaorg'

distance = 165
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit adsearchandreplacev15crackslomalkaorg'

distance = 165
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit actualdrawingv55byfffcrackslomalkaorg'

distance = 178
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit accessmanagerv51byfffcrackslomalkaorg'

distance = 178
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit namescannerv14crackslomalkaorg'

distance = 178
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit adr2000v131crackslomalkaorg'

distance = 178
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit advancedregistrytracerv160newcrackslomalkaorg'

distance = 179
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activeskinocxv4257crackslomalkaorg'

distance = 179
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit archicadv60r3crackslomalkaorg'

distance = 179
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit odbiorv104crackslomalkaorg'

distance = 179
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit alignitv207keygencrackslomalkaorg'

distance = 179
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit editorv201crackslomalkaorg'

distance = 179
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activefaxserverv388build195germancrackslomalkaorg'

distance = 194
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activewhoisbrowserv202466byheritagecrackslomalkaorg'

distance = 194
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit uanimatorv10serialbytntcrackslomalkaorg'

distance = 194
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit nameityourwayniyowv130bycafecrackslomalkaorg'

distance = 195
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit xsqueezemev313bydbccrackslomalkaorg'

distance = 195
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit folderguardprov53crackslomalkaorg'

distance = 195
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit archivesearchv111crackslomalkaorg'

distance = 196
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit fcutterv160serialcrackslomalkaorg'

distance = 196
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit p3shortcutsv10crackslomalkaorg'

distance = 197
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activepdfportfolioprofessional35crackslomalkaorg'

distance = 197
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit archivexpv4120037630crackslomalkaorg'

distance = 207
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit aplusfilenamingsystemv111crackslomalkaorg'

distance = 207
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit flextouchv11crackslomalkaorg'

distance = 207
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit gallerywizard10bypccrackslomalkaorg'

distance = 207
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit alockv38bytexcrackslomalkaorg'

distance = 208
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit ebackup10byelilacrackslomalkaorg'

distance = 208
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit aboutspades12crackslomalkaorg'

distance = 208
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit addremove4goodv20bydbccrackslomalkaorg'

distance = 208
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit filequestxpgoldv40crackslomalkaorg'

distance = 208
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit namewizv31keygencrackslomalkaorg'

distance = 209
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit xvideojoinerv173crackslomalkaorg'

distance = 225
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activexmanagerv14byamokcrackslomalkaorg'

distance = 225
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit fantasyleaguemanagerflmvd09crackslomalkaorg'

distance = 225
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit akmanportfoliomanagerv322crackslomalkaorg'

distance = 225
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit frapsv221crackslomalkaorg'

distance = 225
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit flashgetv096abylashcrackslomalkaorg'

distance = 226
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit ubwdreamcatcherv605crackslomalkaorg'

distance = 226
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit airbaloon20crackslomalkaorg'

distance = 226
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit emailseekerv17crackslomalkaorg'

distance = 226
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit animshowstv604bydbccrackslomalkaorg'

distance = 227
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit tabmailv20build426serialcrackslomalkaorg'

distance = 243
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit flstudioproducereditionv500crackslomalkaorg'

distance = 243
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit fileshredder2000v3xbyaaocgcrackslomalkaorg'

distance = 243
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit animatedblackjackv20byelilacrackslomalkaorg'

distance = 244
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit aplusstealthwebsiteloggerv21crackslomalkaorg'

distance = 244
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit anydvdv3921bysndcrackslomalkaorg'

distance = 244
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit autotask2000v230crackslomalkaorg'

distance = 244
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit puzzlechampionv1030215bytmgcrackslomalkaorg'

distance = 244
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activexmanagerv14byevidencecrackslomalkaorg'

distance = 245
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit luxorv10534ragamescrackbyffgcrackslomalkaorg'

distance = 245
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit flexiblesoftdialerv121crackslomalkaorg'

distance = 265
spam score = 18
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit actuateanalyticscubedesignerv80crackslomalkaorg'

distance = 265
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit alcohol120allversionpathcrackslomalkaorg'

distance = 265
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit alphen100serialbytntcrackslomalkaorg'

distance = 265
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activestartupv112build57crackslomalkaorg'

distance = 265
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit alcohol120v1953105patchbyalphamastercrackslomalkaorg'

distance = 265
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit fsecureantivirusv4051291polishcrackslomalkaorg'

distance = 265
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit finalrenderstage0v10for3dsmaxcrackslomalkaorg'

distance = 266
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit pacboyv11cheatscrackslomalkaorg'

distance = 266
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit acqurlv50serialbydbccrackslomalkaorg'

distance = 267
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit pacdoom3halloweenpartyv21crackslomalkaorg'

distance = 294
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit aiplsingulatorv141keygenbytntcrackslomalkaorg'

distance = 294
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 295
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit acdfotocanvasv11englishbybidjancrackslomalkaorg'

distance = 296
spam score = 17
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit aesopgifcreatorv100215bylashcrackslomalkaorg'

distance = 296
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit activexmanagerv14bydesperatecrackslomalkaorg'

distance = 296
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit privacyeraserv350bycimcrackslomalkaorg'

distance = 297
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit namowebeditorv50trialcrackslomalkaorg'

distance = 297
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit antechinusmediaeditorv40bytmgcrackslomalkaorg'

distance = 297
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit pacdoomiiihalloweenpartyv30plus7trainercrackslomalkaorg'

distance = 298
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit avafindv15218bysndcrackslomalkaorg'

distance = 368
spam score = 15
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit fprotantivirusforwindowsv311aloaderbytntcrackslomalkaorg'

distance = 414
spam score = 16
title = 'y3 your uninstaller pro 2003 yts 2004 yoursit avitovcdsvcddvdconverterv164crackslomalkaorg'

distance = 918
spam score = 8
title = 't28 the jmaker orion v20011106 journal v2001 ashampoouninstallersuitev1300crackslomalkaorg'

distance = 950
spam score = 8
title = 't28 the jmaker orion v20011106 journal v2001 advanceduninstallerpro2002v20byenfusiacrackslomalkaorg'

distance = 984
spam score = 9
title = 't28 the jmaker orion v20011106 journal v2001 ashampoouninstallersuiteplusv132bydigeraticrackslomalkaorg'

distance = 3
spam score = 2
title = 'c62 pro build compupic compupic compressed arc slomalkaorg'

distance = 43
spam score = 2
title = 'c62 pro build compupic compupic compressed arc qfolder95v32crackslomalkaorg'

distance = 55
spam score = 2
title = 'c62 pro build compupic compupic compressed arc p2cpluscompilerv218ecrackslomalkaorg'

distance = 59
spam score = 2
title = 'c62 pro build compupic compupic compressed arc absolutesecurityprov33crackslomalkaorg'

distance = 61
spam score = 2
title = 'c62 pro build compupic compupic compressed arc aceftpv2063procrackslomalkaorg'

distance = 64
spam score = 2
title = 'c62 pro build compupic compupic compressed arc adailybackupv361crackslomalkaorg'

distance = 68
spam score = 2
title = 'c62 pro build compupic compupic compressed arc b2bactivator10crackslomalkaorg'

distance = 69
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fileman230crackslomalkaorg'

distance = 73
spam score = 2
title = 'c62 pro build compupic compupic compressed arc acecapturev12crackslomalkaorg'

distance = 77
spam score = 2
title = 'c62 pro build compupic compupic compressed arc halloweenv19992crackslomalkaorg'

distance = 78
spam score = 2
title = 'c62 pro build compupic compupic compressed arc emailsv210crackslomalkaorg'

distance = 78
spam score = 2
title = 'c62 pro build compupic compupic compressed arc aisbackupv180181crackslomalkaorg'

distance = 84
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fitnessorganizerv110crackslomalkaorg'

distance = 85
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fireworksv301crackslomalkaorg'

distance = 88
spam score = 2
title = 'c62 pro build compupic compupic compressed arc finderskeepersv2024bymp2kcrackslomalkaorg'

distance = 89
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fingerdialv53crackslomalkaorg'

distance = 89
spam score = 2
title = 'c62 pro build compupic compupic compressed arc obalkyv201crackslomalkaorg'

distance = 90
spam score = 2
title = 'c62 pro build compupic compupic compressed arc filetimev243serialcrackslomalkaorg'

distance = 90
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activefile227crackslomalkaorg'

distance = 91
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fx2000v30crackslomalkaorg'

distance = 152
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activexmanagerv13bypccrackslomalkaorg'

distance = 152
spam score = 2
title = 'c62 pro build compupic compupic compressed arc halflifev1016crackslomalkaorg'

distance = 152
spam score = 2
title = 'c62 pro build compupic compupic compressed arc abcwareblobshopv123crackslomalkaorg'

distance = 153
spam score = 2
title = 'c62 pro build compupic compupic compressed arc animatedscreensaver22crackslomalkaorg'

distance = 153
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fileprotector2001sev2005crackslomalkaorg'

distance = 153
spam score = 2
title = 'c62 pro build compupic compupic compressed arc audiotoolsv25bycokecrackslomalkaorg'

distance = 153
spam score = 2
title = 'c62 pro build compupic compupic compressed arc atlargerecorderv110crackslomalkaorg'

distance = 154
spam score = 2
title = 'c62 pro build compupic compupic compressed arc aplusfileprotectionv2101crackslomalkaorg'

distance = 154
spam score = 2
title = 'c62 pro build compupic compupic compressed arc arealvalidatorv111byucfcrackslomalkaorg'

distance = 154
spam score = 2
title = 'c62 pro build compupic compupic compressed arc animatedblackjackv12crackslomalkaorg'

distance = 175
spam score = 2
title = 'c62 pro build compupic compupic compressed arc ebusinesssolutionsv7000003crackslomalkaorg'

distance = 175
spam score = 2
title = 'c62 pro build compupic compupic compressed arc flanker251crackslomalkaorg'

distance = 175
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activestatekomodov25076516crackslomalkaorg'

distance = 175
spam score = 2
title = 'c62 pro build compupic compupic compressed arc faxmachinev401byagaincrackslomalkaorg'

distance = 176
spam score = 2
title = 'c62 pro build compupic compupic compressed arc oberonsecuridesignv10crackslomalkaorg'

distance = 176
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fattureemagazzinov30crackslomalkaorg'

distance = 176
spam score = 2
title = 'c62 pro build compupic compupic compressed arc ubertecwinapppro20136708crackslomalkaorg'

distance = 176
spam score = 2
title = 'c62 pro build compupic compupic compressed arc animatedscreenv68keygencrackslomalkaorg'

distance = 176
spam score = 2
title = 'c62 pro build compupic compupic compressed arc feuriov1634professionalcrackslomalkaorg'

distance = 177
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fireviewerv64crackslomalkaorg'

distance = 189
spam score = 2
title = 'c62 pro build compupic compupic compressed arc qed201palmpilotcrackslomalkaorg'

distance = 189
spam score = 2
title = 'c62 pro build compupic compupic compressed arc apollodatabaseserverv6108crackslomalkaorg'

distance = 189
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activexmanagerv14byfffcrackslomalkaorg'

distance = 189
spam score = 2
title = 'c62 pro build compupic compupic compressed arc formulaxv12crackslomalkaorg'

distance = 189
spam score = 2
title = 'c62 pro build compupic compupic compressed arc filesharingfornetv1522june2004crackslomalkaorg'

distance = 190
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fcutterv160keygencrackslomalkaorg'

distance = 190
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activexmanagerv14bydbccrackslomalkaorg'

distance = 190
spam score = 2
title = 'c62 pro build compupic compupic compressed arc halworks22crackslomalkaorg'

distance = 190
spam score = 2
title = 'c62 pro build compupic compupic compressed arc adobeatmospherev10build41crackslomalkaorg'

distance = 191
spam score = 2
title = 'c62 pro build compupic compupic compressed arc advancedquerytoolv345crackslomalkaorg'

distance = 205
spam score = 2
title = 'c62 pro build compupic compupic compressed arc acousticav221byaaocgcrackslomalkaorg'

distance = 205
spam score = 2
title = 'c62 pro build compupic compupic compressed arc emailextractorexpressv21byeminencecrackslomalkaorg'

distance = 205
spam score = 2
title = 'c62 pro build compupic compupic compressed arc archivesearcherv12bytntcrackslomalkaorg'

distance = 206
spam score = 2
title = 'c62 pro build compupic compupic compressed arc androidnewsgroupdownloaderv46crackslomalkaorg'

distance = 206
spam score = 2
title = 'c62 pro build compupic compupic compressed arc animatedblackjackv20bypccrackslomalkaorg'

distance = 206
spam score = 2
title = 'c62 pro build compupic compupic compressed arc p2cpluspascalcompiler12410ecrackslomalkaorg'

distance = 207
spam score = 2
title = 'c62 pro build compupic compupic compressed arc absolutelyonlinev23build27crackslomalkaorg'

distance = 207
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activestatetclprov1502crackslomalkaorg'

distance = 208
spam score = 2
title = 'c62 pro build compupic compupic compressed arc ucertifymicrosoftm70296prepkitv80005crackslomalkaorg'

distance = 209
spam score = 2
title = 'c62 pro build compupic compupic compressed arc ecampaignv2961crackslomalkaorg'

distance = 221
spam score = 2
title = 'c62 pro build compupic compupic compressed arc pacbomberv154crackbytsrhcrackslomalkaorg'

distance = 221
spam score = 2
title = 'c62 pro build compupic compupic compressed arc freememprofessionalv43byfhcfcrackslomalkaorg'

distance = 221
spam score = 2
title = 'c62 pro build compupic compupic compressed arc asechartdirectorforphpv310forfreebsdcrackslomalkaorg'

distance = 221
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fsecuantivirusformimesweeperv5419180crackslomalkaorg'

distance = 221
spam score = 2
title = 'c62 pro build compupic compupic compressed arc amibroker345crackslomalkaorg'

distance = 222
spam score = 2
title = 'c62 pro build compupic compupic compressed arc amlpagesv830733crackslomalkaorg'

distance = 222
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activestatekomodov301professionalcrackslomalkaorg'

distance = 222
spam score = 2
title = 'c62 pro build compupic compupic compressed arc arealvalidatorv111serialbyfhcfcrackslomalkaorg'

distance = 223
spam score = 2
title = 'c62 pro build compupic compupic compressed arc tagandrenamev18beta4crackslomalkaorg'

distance = 223
spam score = 2
title = 'c62 pro build compupic compupic compressed arc akoffguitarassistantv101byfffcrackslomalkaorg'

distance = 238
spam score = 2
title = 'c62 pro build compupic compupic compressed arc antitrojanv55build377crackslomalkaorg'

distance = 238
spam score = 2
title = 'c62 pro build compupic compupic compressed arc actualtestscomcheckpoint156510examcheatsheetv120803crackslomalkaorg'

distance = 238
spam score = 2
title = 'c62 pro build compupic compupic compressed arc privatedesktopv16bynatabeccrackslomalkaorg'

distance = 238
spam score = 2
title = 'c62 pro build compupic compupic compressed arc arcosoftsketchpadviewer20crackslomalkaorg'

distance = 238
spam score = 2
title = 'c62 pro build compupic compupic compressed arc privatepixv141crackslomalkaorg'

distance = 238
spam score = 2
title = 'c62 pro build compupic compupic compressed arc atoutmathv21bydbccrackslomalkaorg'

distance = 239
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activepenv10713crackslomalkaorg'

distance = 239
spam score = 2
title = 'c62 pro build compupic compupic compressed arc folderguardv53aprofessionalcrackslomalkaorg'

distance = 239
spam score = 2
title = 'c62 pro build compupic compupic compressed arc aviassemblerv12byphamthaicrackslomalkaorg'

distance = 240
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activestatetcldevkitv261crackslomalkaorg'

distance = 259
spam score = 2
title = 'c62 pro build compupic compupic compressed arc advancedcabrepairv10bydanielcrackslomalkaorg'

distance = 259
spam score = 2
title = 'c62 pro build compupic compupic compressed arc autostitchv2185crackslomalkaorg'

distance = 259
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fsecureworkstationsuite401crackslomalkaorg'

distance = 259
spam score = 2
title = 'c62 pro build compupic compupic compressed arc allairecoldfusionstudiov452germantrialcrackslomalkaorg'

distance = 260
spam score = 2
title = 'c62 pro build compupic compupic compressed arc activestatevisualxsltforvs2002v1812494crackslomalkaorg'

distance = 261
spam score = 2
title = 'c62 pro build compupic compupic compressed arc adobephotoshopcs2v90keygenbyss2crackslomalkaorg'

distance = 261
spam score = 2
title = 'c62 pro build compupic compupic compressed arc appletbuttonfactoryv51byucccrackslomalkaorg'

distance = 261
spam score = 2
title = 'c62 pro build compupic compupic compressed arc kasperskyantiviruspersonalprov5020keygenfilebyblackstarcrackslomalkaorg'

distance = 262
spam score = 2
title = 'c62 pro build compupic compupic compressed arc namowebeditor5bytwicecrackslomalkaorg'

distance = 262
spam score = 2
title = 'c62 pro build compupic compupic compressed arc pcad2001fulltrialfixedv2crackslomalkaorg'

distance = 286
spam score = 2
title = 'c62 pro build compupic compupic compressed arc g6ftpserver20rc1keygencrackslomalkaorg'

distance = 287
spam score = 2
title = 'c62 pro build compupic compupic compressed arc fprotantivirusforwindowsv311bcrackslomalkaorg'

distance = 287
spam score = 2
title = 'c62 pro build compupic compupic compressed arc protectxprofessionaleditionv403crackslomalkaorg'

distance = 287
spam score = 2
title = 'c62 pro build compupic compupic compressed arc asprotectregistrycleanerv123crackslomalkaorg'

distance = 287
spam score = 2
title = 'c62 pro build compupic compupic compressed arc advancedattachmentsprocessorv130bytsrhcrackslomalkaorg'

distance = 287
spam score = 2
title = 'c62 pro build compupic compupic compressed arc ocloudsoftwaremaildirectprov20crackslomalkaorg'

distance = 288
spam score = 2
title = 'c62 pro build compupic compupic compressed arc atriseeveryfindv410crackslomalkaorg'

distance = 288
spam score = 2
title = 'c62 pro build compupic compupic compressed arc addresseverywherev23crackslomalkaorg'

distance = 288
spam score = 2
title = 'c62 pro build compupic compupic compressed arc acdpicaview32v131germanpatchbybidjancrackslomalkaorg'

distance = 289
spam score = 2
title = 'c62 pro build compupic compupic compressed arc addremoveplus2004v41crackslomalkaorg'

distance = 385
spam score = 2
title = 'c62 pro build compupic compupic compressed arc xinviteoutwarcomcrewinviterv12crackslomalkaorg'

distance = 387
spam score = 2
title = 'c62 pro build compupic compupic compressed arc acdfotovacv10spanishbybidjancrackslomalkaorg'

distance = 390
spam score = 2
title = 'c62 pro build compupic compupic compressed arc findandreplacetextinmultiplefilessoftwarev70crackslomalkaorg'

distance = 421
spam score = 2
title = 'c62 pro build compupic compupic compressed arc uleadvideostudiov900100englishtbybtofullcrackbybidjancrackslomalkaorg'

distance = 444
spam score = 2
title = 'c62 pro build compupic compupic compressed arc pinnaclestudioplusv93248trialtofullparisacrackbyruteamcrackslomalkaorg'

distance = 1910
spam score = 18
title = 'ggd ofb familybook index page'

distance = 47
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass eiconsv334crackslomalkaorg'

distance = 55
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass epop203123crackslomalkaorg'

distance = 58
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass fishv333431crackslomalkaorg'

distance = 66
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass tagcomposer20crackslomalkaorg'

distance = 67
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass eiconsv3xcrackslomalkaorg'

distance = 69
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass finemetronome2007v20crackslomalkaorg'

distance = 70
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass fivev272newcrackslomalkaorg'

distance = 72
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass farv360593crackslomalkaorg'

distance = 72
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass flashfxpv14xcrackslomalkaorg'

distance = 77
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass ebook12crackslomalkaorg'

distance = 79
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass adobeserialgeneratorv201crackslomalkaorg'

distance = 79
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass ecampaignv302crackslomalkaorg'

distance = 82
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass eiconsv316crackslomalkaorg'

distance = 84
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass xnetstatiiiv301crackslomalkaorg'

distance = 85
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass all2bmpv101crackslomalkaorg'

distance = 85
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass rmail11build9605crackslomalkaorg'

distance = 88
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass eiconsv325crackslomalkaorg'

distance = 88
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass abyssv20014democrackslomalkaorg'

distance = 89
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass octopodforc302crackslomalkaorg'

distance = 95
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass achristmasatsantasv29crackslomalkaorg'

distance = 156
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass ajscrollerv223crackslomalkaorg'

distance = 156
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass allkasperskyproductscrackslomalkaorg'

distance = 157
spam score = 4
title = 'm17 makems map 10 designer v10 cad malz kass ecardxpress10crackslomalkaorg'

distance = 157
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass pacboyv10crackslomalkaorg'

distance = 158
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass pacboyv11crackslomalkaorg'

distance = 158
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass autoptionv41serialcrackslomalkaorg'

distance = 158
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass analysisgroupv200016crackslomalkaorg'

distance = 159
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass folderlockv41newcrackslomalkaorg'

distance = 161
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass autocad2002crackslomalkaorg'

distance = 161
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass filtergatev403crackslomalkaorg'

distance = 175
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass alphascubalogv2668crackslomalkaorg'

distance = 175
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass formula202317donglecrackcrackslomalkaorg'

distance = 175
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass activetaskv10crackslomalkaorg'

distance = 175
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass qrecovery98v20crackslomalkaorg'

distance = 176
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass powervideoconverterv1311crackslomalkaorg'

distance = 177
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass hackmanv504crackslomalkaorg'

distance = 177
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass emailalertv1019bylashcrackslomalkaorg'

distance = 177
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass nortonantivirus2005completefixedcrackslomalkaorg'

distance = 177
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass activewhoisv202466crackslomalkaorg'

distance = 178
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass fantasymoon3dscreensaverv12crackslomalkaorg'

distance = 191
spam score = 7
title = 'm17 makems map 10 designer v10 cad malz kass activerefreshv135build535crackslomalkaorg'

distance = 192
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass actualdrawingv45crackslomalkaorg'

distance = 192
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass fsecureantivirusv4092220crackslomalkaorg'

distance = 192
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass emailextractorexpressv25build10021crackslomalkaorg'

distance = 193
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass privatenursecrackslomalkaorg'

distance = 193
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass adamtheinsidestorycrackslomalkaorg'

distance = 193
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass absolutesecurityv39crackslomalkaorg'

distance = 194
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass windows2003serveractivationcrackcrackslomalkaorg'

distance = 194
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass all4audiomp3makerv112byinfernocrackslomalkaorg'

distance = 194
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass pacbomberv154byfffcrackslomalkaorg'

distance = 209
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass freshdesktopv300crackslomalkaorg'

distance = 209
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass agentransack16bytntcrackslomalkaorg'

distance = 209
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass advancedrarenamerv12byaaocgcrackslomalkaorg'

distance = 210
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass airmessengerwctp10crackslomalkaorg'

distance = 210
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass amibrokerv4507professionaleditioncrackslomalkaorg'

distance = 210
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass animatedscreenv66bymp2kcrackslomalkaorg'

distance = 210
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass firstattackv16bykomacrackslomalkaorg'

distance = 210
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass ftpexpertv2062crackslomalkaorg'

distance = 211
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass fineprintv502crackslomalkaorg'

distance = 211
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass argosoftmailserverprov1839crackslomalkaorg'

distance = 226
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass emailsv226frenchcrackslomalkaorg'

distance = 226
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass accesslockv272byfffcrackslomalkaorg'

distance = 227
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass almerbackup48crackslomalkaorg'

distance = 227
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass fsecurevpnclient42crackslomalkaorg'

distance = 227
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass emailextractorexpressv21byorioncrackslomalkaorg'

distance = 227
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass faxamaticvv96514crackslomalkaorg'

distance = 228
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass f1racingsimcrackslomalkaorg'

distance = 228
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass activexmanagerv14byphaze2002crackslomalkaorg'

distance = 229
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass accesspasswordrecoverygenie220crackslomalkaorg'

distance = 229
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass attributemagicprov112byorioncrackslomalkaorg'

distance = 242
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass activeskinv425byulises2kcrackslomalkaorg'

distance = 242
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass aspelsaewinv25crackslomalkaorg'

distance = 242
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass g6ftpserver20rc1keygencrackslomalkaorg'

distance = 242
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass achessexpertprofessionaleditionv371crackslomalkaorg'

distance = 242
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass activewhoisv212587crackslomalkaorg'

distance = 243
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass anfibiawatchmanv61crackslomalkaorg'

distance = 243
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass abyssmediaintexmp3convertorv3016crackslomalkaorg'

distance = 243
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass rwipeandcleanv411135crackslomalkaorg'

distance = 243
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass ebusinessappletv40crackslomalkaorg'

distance = 244
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass vscribesystemstwangv30crackslomalkaorg'

distance = 262
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass acqurlv52bylinezer0crackslomalkaorg'

distance = 262
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass acdfotocanvasv302bybidjancrackslomalkaorg'

distance = 263
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass antechinuscsharpeditorv42cbyeclipsecrackslomalkaorg'

distance = 263
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass fsprofilesystemcryptographicprotectorv113crackslomalkaorg'

distance = 264
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass activeskincontrolocxv20crackslomalkaorg'

distance = 264
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass actualtestscomcheckpoint156310examcheatsheetv110803crackslomalkaorg'

distance = 264
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass addremoveplus2004v410701bytsrhcrackslomalkaorg'

distance = 264
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass finetunev150serialbytntcrackslomalkaorg'

distance = 264
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass windowsxpservicepack2activatorcrackslomalkaorg'

distance = 264
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass alltagstagebuch200109crackslomalkaorg'

distance = 288
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass actualsearchandreplacev245bytsrhcrackslomalkaorg'

distance = 289
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass fprotantivirusv312cbyfreeze1crackslomalkaorg'

distance = 289
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass fannystripteasescreensavercrackslomalkaorg'

distance = 289
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass powereditv212byacmecrackslomalkaorg'

distance = 290
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass abeechmmakerv14crackslomalkaorg'

distance = 290
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass stylexpv306keygenbyexclipsecrackslomalkaorg'

distance = 290
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass fastbrowserprov50byaaocgcrackslomalkaorg'

distance = 292
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass galacticcivilizationcrackslomalkaorg'

distance = 292
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass fablockocxactivexcomponent11crackslomalkaorg'

distance = 293
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass activexmanagerv13byfhcfcrackslomalkaorg'

distance = 348
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass flashimagebuilderv32bytsrhcrackslomalkaorg'

distance = 350
spam score = 6
title = 'm17 makems map 10 designer v10 cad malz kass atrisehtmlockv162byfreifall7crackslomalkaorg'

distance = 357
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass acdsystemsexpressmessagingserver101unlimitedcrackslomalkaorg'

distance = 374
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass gadwinsystemsgeformv1501067crackslomalkaorg'

distance = 379
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass abfoutlookexpressbackupv183219bysndcrackslomalkaorg'

distance = 386
spam score = 5
title = 'm17 makems map 10 designer v10 cad malz kass privatedesktopv19bynatabeccrackslomalkaorg'

distance = 1924
spam score = 47
title = 'melophus lathami gujarat'

distance = 18
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi ecampaignv297crackslomalkaorg'

distance = 33
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi fifa2002crackslomalkaorg'

distance = 56
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi ripstrikebackv201crackslomalkaorg'

distance = 59
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi almanacv2052crackslomalkaorg'

distance = 59
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi ecampaignv2961crackslomalkaorg'

distance = 61
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi airport2000crackslomalkaorg'

distance = 63
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi fsearchv14crackslomalkaorg'

distance = 64
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi f22raptor1000510crackslomalkaorg'

distance = 76
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi f22raptor1000500rcrackslomalkaorg'

distance = 81
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi filescannerprov15keygencrackslomalkaorg'

distance = 82
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi activeskinv422crackslomalkaorg'

distance = 84
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi achristmasatsantasv272crackslomalkaorg'

distance = 85
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi activefile227crackslomalkaorg'

distance = 85
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi almanacv300crackslomalkaorg'

distance = 87
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi absolutespadescrackslomalkaorg'

distance = 87
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi findyourmp3v102035byevidencecrackslomalkaorg'

distance = 87
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi qbeezkeycrackslomalkaorg'

distance = 87
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi eplanpro35crackslomalkaorg'

distance = 89
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi nkoderv2000crackslomalkaorg'

distance = 91
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi tableditv233acrackslomalkaorg'

distance = 159
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi amusicalgeneratorv30beta7crackslomalkaorg'

distance = 160
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi rdiomp3v20crackslomalkaorg'

distance = 160
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi filepulverizerv40crackslomalkaorg'

distance = 160
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi privateeyev12crackslomalkaorg'

distance = 160
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi eiconsv3xcrackslomalkaorg'

distance = 161
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi allchaossoftwaregenericcrackslomalkaorg'

distance = 161
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi activepenv10713crackslomalkaorg'

distance = 161
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi asmwoptimizerprov61crackslomalkaorg'

distance = 163
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi powerdvdv60byparadoxcrackslomalkaorg'

distance = 164
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi pmanv15javacrackslomalkaorg'

distance = 181
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi admuncherv43dbyk03akcrackslomalkaorg'

distance = 181
spam score = 6
title = 'a115 another 4 anonymous ant proxy anno anonymi activerefresh136build551crackslomalkaorg'

distance = 181
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi freshuiv590crackslomalkaorg'

distance = 181
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi flagimation103crackslomalkaorg'

distance = 181
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi animatedgifeditor95v14keygencrackslomalkaorg'

distance = 182
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi nortoninternetsecurity2005crackslomalkaorg'

distance = 182
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi adayinthelifev13crackslomalkaorg'

distance = 182
spam score = 6
title = 'a115 another 4 anonymous ant proxy anno anonymi coreldrawgraphicssuitev12crackslomalkaorg'

distance = 182
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi alapimposerprov261forquarkxpresscrackslomalkaorg'

distance = 182
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi adayinthelife15crackslomalkaorg'

distance = 197
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi absolutegemsv120germancrackslomalkaorg'

distance = 198
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi pacbomberv154bytsrhcrackslomalkaorg'

distance = 198
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi afixthumbprintcomparator1200crackslomalkaorg'

distance = 198
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi freshuiv620byimscrackslomalkaorg'

distance = 199
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi alarmmasterv40crackslomalkaorg'

distance = 199
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi achristmasatsantasv29newcrackslomalkaorg'

distance = 199
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi fixlinksv20crackslomalkaorg'

distance = 199
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi fabsoftreformenterprisev83014crackslomalkaorg'

distance = 199
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi privacymakerv2450crackslomalkaorg'

distance = 199
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi emailsv175crackslomalkaorg'

distance = 211
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi foxandhenv16crackslomalkaorg'

distance = 211
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi acousticav225acrackslomalkaorg'

distance = 211
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi pmanv10bandwjavacrackslomalkaorg'

distance = 211
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi aspmakerv401bycorecrackslomalkaorg'

distance = 212
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi accentofficepasswordrecoveryv210crackslomalkaorg'

distance = 212
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi fprotantivirusforwindowsv310crackslomalkaorg'

distance = 212
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi activeskinv41bycorecrackslomalkaorg'

distance = 212
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi powereditv11byfreifall7crackslomalkaorg'

distance = 213
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi ppingtoolsv25crackslomalkaorg'

distance = 213
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi poweradvisory1014crackslomalkaorg'

distance = 226
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi firedaemonprov19gabuild2199crackslomalkaorg'

distance = 226
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi qcollectorv211build9crackslomalkaorg'

distance = 227
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi pacbomberv154loaderbytsrhcrackslomalkaorg'

distance = 228
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi finditcal14crackslomalkaorg'

distance = 228
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi airmessengerprov406bylaxitycrackslomalkaorg'

distance = 228
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi acdimagefox12gercrackslomalkaorg'

distance = 228
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi advancedregistrytracerv167sr2byfffcrackslomalkaorg'

distance = 228
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi eiconsv343crackcrackslomalkaorg'

distance = 229
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi advancedquerytoolv330crackslomalkaorg'

distance = 229
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi powerarchiver2001v702englishcrackslomalkaorg'

distance = 244
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi privatepixv280crackslomalkaorg'

distance = 244
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 244
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi firehandemberv622crackslomalkaorg'

distance = 245
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi adcutoffv14crackslomalkaorg'

distance = 246
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi nortonantivirus2005completecrackslomalkaorg'

distance = 246
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi absolutepatiencev50acrackslomalkaorg'

distance = 246
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi privateshellv141321crackslomalkaorg'

distance = 247
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi fireburnerv20beta2crackslomalkaorg'

distance = 248
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi powerarchiver860crackslomalkaorg'

distance = 248
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi ecard37crackslomalkaorg'

distance = 263
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi ebackup14byeaglecrackslomalkaorg'

distance = 263
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi privatedesktopv16bynatabeccrackslomalkaorg'

distance = 263
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi powerarchiver2002v80530rc3crackslomalkaorg'

distance = 263
spam score = 6
title = 'a115 another 4 anonymous ant proxy anno anonymi antispamfilterv113523oct2003crackslomalkaorg'

distance = 264
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi hamhelperv121crackslomalkaorg'

distance = 264
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi flashfxpv144build857crackslomalkaorg'

distance = 264
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi activemp3controlforwin32v20crackslomalkaorg'

distance = 264
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi fsecureantivirusformicrosoftexchangewithspamcontrolv631crackslomalkaorg'

distance = 265
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi activestatekomodov301professionalcrackslomalkaorg'

distance = 265
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi powerarchiver2004v90100crackslomalkaorg'

distance = 289
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi fairstarsmp3recorderv102bysndcrackslomalkaorg'

distance = 289
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi privacyprotectorv260crackslomalkaorg'

distance = 289
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi emsdbextract2005forpostgresqlv2101crackslomalkaorg'

distance = 290
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi aceexpertv3xcrackslomalkaorg'

distance = 290
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi adwarexeliminatorv20datecode20040908crackslomalkaorg'

distance = 290
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi freshdiagnosev58crackslomalkaorg'

distance = 292
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi airandspacescenicreflectionsscreensaverv10crackslomalkaorg'

distance = 292
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi powerarchiver2004v90101crackslomalkaorg'

distance = 292
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi faqfactoryv10bylashcrackslomalkaorg'

distance = 294
spam score = 5
title = 'a115 another 4 anonymous ant proxy anno anonymi efunsoftmastermind10bylashcrackslomalkaorg'

distance = 66
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h autozip98v41crackslomalkaorg'

distance = 70
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h keygenslomalkaorg'

distance = 72
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h emailsv220crackslomalkaorg'

distance = 74
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h b2bactivator23byeminencecrackslomalkaorg'

distance = 79
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h xnetstatiiiv30crackslomalkaorg'

distance = 80
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h ecampaigncorporateeditionv2961crackslomalkaorg'

distance = 82
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h emailseekerv17newcrackslomalkaorg'

distance = 84
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h vampv1300crackslomalkaorg'

distance = 84
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h a1monitorv550crackslomalkaorg'

distance = 85
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h fate101crackslomalkaorg'

distance = 85
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h analyzer2000v310crackslomalkaorg'

distance = 88
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h acehtmlprov5build5002crackslomalkaorg'

distance = 88
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h faxmachinev209crackslomalkaorg'

distance = 88
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h address2000v550wcrackslomalkaorg'

distance = 90
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h finalrecoveryv12bymp2kcrackslomalkaorg'

distance = 91
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h emanagerv35b08crackslomalkaorg'

distance = 92
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h xhdl3118crackslomalkaorg'

distance = 95
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h v3mail121serialcrackslomalkaorg'

distance = 96
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h flashfxpv142build830crackslomalkaorg'

distance = 96
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h activewhoisv212583crackslomalkaorg'

distance = 158
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h powereditv12crackslomalkaorg'

distance = 159
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h acousticav221germancrackslomalkaorg'

distance = 159
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h flashfxpv21build924crackslomalkaorg'

distance = 159
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h privatepixv122crackslomalkaorg'

distance = 159
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h addressorganizer36abyfhcfcrackslomalkaorg'

distance = 159
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h f1racingsimcrackslomalkaorg'

distance = 159
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h arealvalidatorv11crackslomalkaorg'

distance = 160
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h ebookhtmlcompilerpro212ieversioncrackslomalkaorg'

distance = 161
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h atlantisv15crackslomalkaorg'

distance = 161
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h antigame501crackslomalkaorg'

distance = 178
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h activemessenger105crackslomalkaorg'

distance = 178
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h absolutememoryv12crackslomalkaorg'

distance = 178
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h amletov216forlightwavecrackslomalkaorg'

distance = 178
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h activetaskv10crackslomalkaorg'

distance = 178
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h privateidahoemail463crackslomalkaorg'

distance = 178
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h audiospherev15crackslomalkaorg'

distance = 178
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h alienshooterv12byeclipsecrackslomalkaorg'

distance = 179
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h airtime10crackslomalkaorg'

distance = 179
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h atommodelerscreensaverv10crackslomalkaorg'

distance = 179
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h xdvdripperv121bycimcrackslomalkaorg'

distance = 196
spam score = 7
title = 'd21 dietmp3 digi dictation die german editor h activerefreshv22622crackslomalkaorg'

distance = 196
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h folderguardprov55fixedcrackslomalkaorg'

distance = 196
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h activestateperldevkitv520520crackslomalkaorg'

distance = 197
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h adobeimagereadyv70crackcrackslomalkaorg'

distance = 197
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h apluscalcv11crackslomalkaorg'

distance = 197
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h andromedalensdocv131foradobephotoshopcrackslomalkaorg'

distance = 197
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h eiconsv370bycorecrackslomalkaorg'

distance = 197
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h fittodiskv22crackslomalkaorg'

distance = 198
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h qbiknetpatrolv111002crackslomalkaorg'

distance = 198
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h autoptiongraphicv40serialcrackslomalkaorg'

distance = 210
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h powerpostv13build25crackslomalkaorg'

distance = 210
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h fprotantivirusv312dbyfullmooncrackslomalkaorg'

distance = 210
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h animatedscreenv61serialbyfhcfcrackslomalkaorg'

distance = 210
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h poweradvisory1014crackslomalkaorg'

distance = 210
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h oasisprov1xcrackslomalkaorg'

distance = 210
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h posterprintery3000crackslomalkaorg'

distance = 210
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h allcalcv16xcrackslomalkaorg'

distance = 210
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h namowebcanvasv110107trialcrackslomalkaorg'

distance = 211
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h apollovcdburnerv123crackslomalkaorg'

distance = 211
spam score = 4
title = 'd21 dietmp3 digi dictation die german editor h fsecuresshclientv5454crackslomalkaorg'

distance = 223
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h activeskinv421byfyscrackerscrackslomalkaorg'

distance = 224
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h alphatrisv30serialcrackslomalkaorg'

distance = 224
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h kasperskyantiviruspersonalv50121crackslomalkaorg'

distance = 224
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h activemp3activexcontrol17crackslomalkaorg'

distance = 224
spam score = 6
title = 'd21 dietmp3 digi dictation die german editor h advancedvisualbasicsubclasser10crackslomalkaorg'

distance = 224
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h arealvalidator111crackslomalkaorg'

distance = 224
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h filemakerprov55v1v55v1dfixedcrackslomalkaorg'

distance = 224
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h eplusmaxaltera100crackslomalkaorg'

distance = 225
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h f22raptor1000510crackslomalkaorg'

distance = 225
spam score = 6
title = 'd21 dietmp3 digi dictation die german editor h actualwindowsmanagerv27fixedcrackslomalkaorg'

distance = 241
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h a1clickultrapccleanerv10130crackslomalkaorg'

distance = 241
spam score = 4
title = 'd21 dietmp3 digi dictation die german editor h xaudiovideojoinerv121126crackslomalkaorg'

distance = 241
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h eformez175crackslomalkaorg'

distance = 242
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h footballv211bylashcrackslomalkaorg'

distance = 242
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h nortonantivirus2005completecrackslomalkaorg'

distance = 242
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h powercardmakerv370crackslomalkaorg'

distance = 242
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h b2bactivator23bytntcrackslomalkaorg'

distance = 242
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h aspmakerv30build9loadercrackslomalkaorg'

distance = 242
spam score = 7
title = 'd21 dietmp3 digi dictation die german editor h activerefresh131build509crackslomalkaorg'

distance = 243
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h anasil2v22dbyamokcrackslomalkaorg'

distance = 263
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h alarmclockv110germancrackslomalkaorg'

distance = 263
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h rstudionetworkeditionv20build121047crackslomalkaorg'

distance = 263
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h pacestarumldiagrammerv417build1787crackslomalkaorg'

distance = 263
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h polyphonykeyboardmanagerv26crackslomalkaorg'

distance = 264
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h privateencryptorv62byarncrackslomalkaorg'

distance = 264
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h qverbgermanv101crackslomalkaorg'

distance = 264
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h filedirectoryregistrar20451crackslomalkaorg'

distance = 264
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h ebackup10byfocccrackslomalkaorg'

distance = 264
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h activestateperldevkitv411crackslomalkaorg'

distance = 265
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h privacyprotectorv410crackslomalkaorg'

distance = 296
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h ahandyaddressbookserverv12crackslomalkaorg'

distance = 296
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h fulldiskv50crackslomalkaorg'

distance = 296
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h fishfastinteractivesqlhelperv333229crackslomalkaorg'

distance = 296
spam score = 4
title = 'd21 dietmp3 digi dictation die german editor h fsecuresshclientv5457japanesecrackslomalkaorg'

distance = 297
spam score = 6
title = 'd21 dietmp3 digi dictation die german editor h actualtestscomcisco644101examcheatsheetv040204byjgtcrackslomalkaorg'

distance = 297
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h privacyfence30crackslomalkaorg'

distance = 298
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h facefilterv109252standardeditioncrackslomalkaorg'

distance = 298
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h powerdefragv200litecrackslomalkaorg'

distance = 298
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h atriseeveryfindv470bylashcrackslomalkaorg'

distance = 298
spam score = 5
title = 'd21 dietmp3 digi dictation die german editor h amapiv61crackslomalkaorg'

distance = 33
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl eplanpro30crackslomalkaorg'

distance = 34
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl emailsv222crackslomalkaorg'

distance = 40
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl andorv10crackslomalkaorg'

distance = 51
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl nod32crackslomalkaorg'

distance = 52
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl halflifev1107crackslomalkaorg'

distance = 64
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl adayinthelifev15crackcrackslomalkaorg'

distance = 65
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl footballv211crackslomalkaorg'

distance = 72
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl tableditv260dcrackslomalkaorg'

distance = 76
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl eiconsv325crackslomalkaorg'

distance = 76
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl ebook12crackslomalkaorg'

distance = 77
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl attackattackv130crackslomalkaorg'

distance = 77
spam score = 10
title = 't33 thumbsup build thundersetup v100 thumbspl apersonaltodolistv10crackslomalkaorg'

distance = 77
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl halflifev1010crackslomalkaorg'

distance = 77
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl fishguidecrackslomalkaorg'

distance = 78
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl amusicalgeneratorv30beta7crackslomalkaorg'

distance = 82
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl abfallkosten2003329crackslomalkaorg'

distance = 89
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl filescavengerv20bcrackslomalkaorg'

distance = 89
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl alittlevietnamesev12crackslomalkaorg'

distance = 91
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl frapsv221crackslomalkaorg'

distance = 94
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl acewinscreenv45crackslomalkaorg'

distance = 159
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl animatedscreenv61serialbytcacrackslomalkaorg'

distance = 160
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl fs2004simflyerscrackslomalkaorg'

distance = 160
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl acousticav21acrackslomalkaorg'

distance = 160
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl facefilterv105181studioeditioncrackslomalkaorg'

distance = 161
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl ppingtools26crackslomalkaorg'

distance = 162
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl admuncherv417keygencrackslomalkaorg'

distance = 162
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl findnblockv21crackslomalkaorg'

distance = 163
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl activepdfportfolioprofessional35crackslomalkaorg'

distance = 163
spam score = 13
title = 't33 thumbsup build thundersetup v100 thumbspl activerefreshv20build613crackslomalkaorg'

distance = 163
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl activepdfserverprofessionalv352crackslomalkaorg'

distance = 184
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl arithmoslottov102crackslomalkaorg'

distance = 184
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl alphaballv146crackslomalkaorg'

distance = 184
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl alignitv13crackslomalkaorg'

distance = 185
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl amigo2000v11byimscrackslomalkaorg'

distance = 185
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl ashampoosnapyav1532secrackslomalkaorg'

distance = 186
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl addresseverywherev25crackslomalkaorg'

distance = 186
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl albumprov20patch1crackslomalkaorg'

distance = 186
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl activestateperldevkitv411crackslomalkaorg'

distance = 186
spam score = 10
title = 't33 thumbsup build thundersetup v100 thumbspl flashconverter216bytntcrackslomalkaorg'

distance = 186
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl tagandrenamev20finalcrackslomalkaorg'

distance = 197
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl activefaxserverv387build194crackslomalkaorg'

distance = 197
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl flashfxpv143crackslomalkaorg'

distance = 197
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl fprotantivirusv312dbytsmacrackslomalkaorg'

distance = 197
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl ftpvoyagerv8002byevccrackslomalkaorg'

distance = 198
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl fileshredder2000v33crackslomalkaorg'

distance = 198
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl emailviaphone10crackslomalkaorg'

distance = 198
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl rdriveimage10build1013crackslomalkaorg'

distance = 198
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl automaintenanceprov80keygenbyevccrackslomalkaorg'

distance = 198
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl formshowv3xnewcrackslomalkaorg'

distance = 198
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl adoptadogcrackslomalkaorg'

distance = 213
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl privateeyev20crackslomalkaorg'

distance = 214
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl alarmclockv1201crackslomalkaorg'

distance = 214
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl addresseverywherev281byorioncrackslomalkaorg'

distance = 214
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl animfxv190crackslomalkaorg'

distance = 215
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl absolutememoryv14crackslomalkaorg'

distance = 215
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl animatedmenus2000v30finalfordelphiandbcbcrackslomalkaorg'

distance = 215
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl activeskincontrolocxv42crackslomalkaorg'

distance = 215
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl fruityloopsv356bydalpha3000crackslomalkaorg'

distance = 215
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl activexmanagerv14byeminencecrackslomalkaorg'

distance = 216
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl akeywordthingv10101regfilecrackslomalkaorg'

distance = 228
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl flipalbumv40regfilecrackslomalkaorg'

distance = 228
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl windowsxpactivatorcrackslomalkaorg'

distance = 229
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl fastypetypingtutorialv6014crackslomalkaorg'

distance = 229
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl accesstoaspformatafv450crackslomalkaorg'

distance = 229
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl airmessengermobilev175crackslomalkaorg'

distance = 229
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl aplusfilerenamingsystemv125crackslomalkaorg'

distance = 229
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl activepdfdocconverterv352crackslomalkaorg'

distance = 229
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl avastprofessionaleditionv41289crackslomalkaorg'

distance = 229
spam score = 10
title = 't33 thumbsup build thundersetup v100 thumbspl luxorv10534ragamescrackbyffgcrackslomalkaorg'

distance = 230
spam score = 10
title = 't33 thumbsup build thundersetup v100 thumbspl kasperskyantiviruspersonalv50227keygenfilecrackslomalkaorg'

distance = 248
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl firmtoolsalbumcreatorv32461crackslomalkaorg'

distance = 248
spam score = 13
title = 't33 thumbsup build thundersetup v100 thumbspl activerefreshv134build531crackslomalkaorg'

distance = 248
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl activeskinv421crackslomalkaorg'

distance = 249
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl addressorganizerdeluxe13crackslomalkaorg'

distance = 249
spam score = 10
title = 't33 thumbsup build thundersetup v100 thumbspl fastreamnetfileserver651981crackslomalkaorg'

distance = 249
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl fsecureantivirusformimesweeperv55010270crackslomalkaorg'

distance = 249
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl alphascubalogv3092byorioncrackslomalkaorg'

distance = 249
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl allimagineitlimitedproductskeygencrackslomalkaorg'

distance = 249
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl actualtestscomcitrix1y0222examcheatsheetv042104crackslomalkaorg'

distance = 250
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl admuncherv452build9048bydistinctcrackslomalkaorg'

distance = 265
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl alcohol120v1953105patchbyalphamastercrackslomalkaorg'

distance = 265
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl privatedesktopv19bynatabeccrackslomalkaorg'

distance = 265
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl appletpasswordwizardv30byamokcrackslomalkaorg'

distance = 266
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl uwipev20bynatabeccrackslomalkaorg'

distance = 266
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl akalaexelockv30bydbzcrackslomalkaorg'

distance = 267
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl pacboyv11plus3trainercrackslomalkaorg'

distance = 267
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl adobephotoshopcs2v90keygenbyss2crackslomalkaorg'

distance = 267
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl agendamsdv410spanishcrackslomalkaorg'

distance = 267
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl privacyguardv40crackslomalkaorg'

distance = 267
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl privatepixv290crackslomalkaorg'

distance = 291
spam score = 10
title = 't33 thumbsup build thundersetup v100 thumbspl puzzlebrainstormv12crackslomalkaorg'

distance = 291
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl avimpegasfwmvsplitterv231crackslomalkaorg'

distance = 292
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl archivexplorerv10crackslomalkaorg'

distance = 293
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl flashfxpv30build1015byarteamcrackslomalkaorg'

distance = 294
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl namowebeditorv304crackslomalkaorg'

distance = 294
spam score = 10
title = 't33 thumbsup build thundersetup v100 thumbspl powerageskysimulatorv30crackslomalkaorg'

distance = 294
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl emailextractorv21build05011bytntcrackslomalkaorg'

distance = 295
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl afllivepremiershipeditioncrackslomalkaorg'

distance = 295
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl activeshopperaspcomponent10crackslomalkaorg'

distance = 295
spam score = 12
title = 't33 thumbsup build thundersetup v100 thumbspl actualtestscomlotus190522examcheatsheetv121703crackslomalkaorg'

distance = 370
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl acxabetonedatenbankserienbriefv702germancrackslomalkaorg'

distance = 382
spam score = 10
title = 't33 thumbsup build thundersetup v100 thumbspl postworkquickiescriptspsp8vol2crackslomalkaorg'

distance = 388
spam score = 10
title = 't33 thumbsup build thundersetup v100 thumbspl acehighmp3wavwmaoggconverter310crackslomalkaorg'

distance = 398
spam score = 11
title = 't33 thumbsup build thundersetup v100 thumbspl activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 1736
spam score = 82
title = 'ebelarusorg tadiran telecom enters belarusian telecoms market'

distance = 26
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea ecampaignv297crackslomalkaorg'

distance = 47
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea eplanpro30crackslomalkaorg'

distance = 58
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea ebusinesssolutionsv5005crackslomalkaorg'

distance = 63
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea filepulverizer5crackslomalkaorg'

distance = 64
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea emailsv222crackslomalkaorg'

distance = 65
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea alphamania208crackslomalkaorg'

distance = 67
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea activepenv10713crackslomalkaorg'

distance = 69
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea axcursors45crackslomalkaorg'

distance = 69
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea a1surfv1120crackslomalkaorg'

distance = 73
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea acehtmlprov50crackslomalkaorg'

distance = 77
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea findback200302crackslomalkaorg'

distance = 78
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea fcutterv152crackslomalkaorg'

distance = 79
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea assistantv500crackslomalkaorg'

distance = 82
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea aureliov12crackslomalkaorg'

distance = 82
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea ecleanv101crackslomalkaorg'

distance = 84
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea alignitv211crackcrackslomalkaorg'

distance = 85
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea anagramgeniusv911crackslomalkaorg'

distance = 85
spam score = 18
title = 'x7 dvd xilisoft ripper audio se platinum crea activerefreshv134build531crackslomalkaorg'

distance = 87
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea animatedscreenv223crackslomalkaorg'

distance = 89
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea afxshutdownv101crackslomalkaorg'

distance = 153
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea kmlv35213crackslomalkaorg'

distance = 154
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea animatedscreensaver22crackslomalkaorg'

distance = 154
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea achristmasatsantasv29crackslomalkaorg'

distance = 155
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea qbzv17gcrackslomalkaorg'

distance = 156
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea activequerycrackslomalkaorg'

distance = 156
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea fastopenpro1110crackslomalkaorg'

distance = 156
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea freestyler1011crackslomalkaorg'

distance = 157
spam score = 17
title = 'x7 dvd xilisoft ripper audio se platinum crea allkasperskyproductscrackslomalkaorg'

distance = 158
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea akalapasswordrevealerv10031103crackslomalkaorg'

distance = 158
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea autorunassistantv24crackslomalkaorg'

distance = 175
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea luxorv10534ragamescrackbyffgcrackslomalkaorg'

distance = 175
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea abcpixv219serialbyevidencecrackslomalkaorg'

distance = 176
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea filematrixv71crackslomalkaorg'

distance = 176
spam score = 17
title = 'x7 dvd xilisoft ripper audio se platinum crea emailsv225serialbyfffcrackslomalkaorg'

distance = 177
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea albumexpressv25crackslomalkaorg'

distance = 177
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea alawarbacktoearthv10bypizzacrackslomalkaorg'

distance = 177
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea antechinusphpeditorv11bydesperatecrackslomalkaorg'

distance = 177
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea fontviewer10crackslomalkaorg'

distance = 177
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea atagcon10013crackslomalkaorg'

distance = 177
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea babnbeancrackslomalkaorg'

distance = 191
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea akalaexelockv320crackslomalkaorg'

distance = 192
spam score = 17
title = 'x7 dvd xilisoft ripper audio se platinum crea autoplaymediastudiov5004professionalcrackslomalkaorg'

distance = 192
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea acqurlv61newcrackslomalkaorg'

distance = 192
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea arkandroidv128crackslomalkaorg'

distance = 192
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea rwipeandcleanv551181crackslomalkaorg'

distance = 193
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea amichartv1455crackslomalkaorg'

distance = 193
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea emailfactoryv12bytsrhcrackslomalkaorg'

distance = 193
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea freshdiagnosev300bygaborcrackslomalkaorg'

distance = 194
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea ebookv1001crackslomalkaorg'

distance = 194
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea freemeterpro233crackslomalkaorg'

distance = 211
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea finditv304crackslomalkaorg'

distance = 211
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea fsecureantivirusformicrosoftexchangev631win20002003crackslomalkaorg'

distance = 211
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea absolutesecurityprov37keygencrackslomalkaorg'

distance = 211
spam score = 14
title = 'x7 dvd xilisoft ripper audio se platinum crea fileandfolderprotectorv189crackslomalkaorg'

distance = 211
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea protectx402crackslomalkaorg'

distance = 211
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea namowebeditorsuitev602105trialchinesecrackslomalkaorg'

distance = 211
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea allwebmenusprov31build500crackslomalkaorg'

distance = 211
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea aaaftpeasyv40bydbccrackslomalkaorg'

distance = 212
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea aplusfileprotectionv27crackslomalkaorg'

distance = 212
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea gallacticbattlegroundscrackslomalkaorg'

distance = 226
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea aheadneroburningromultraeditionv6600crackslomalkaorg'

distance = 226
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea fsecuresshclientv5323crackslomalkaorg'

distance = 226
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea flexiblesoftdialerxppro412crackslomalkaorg'

distance = 227
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea antitrojanv55multilanguagecrackslomalkaorg'

distance = 227
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea absolutesecuritystdv37crackslomalkaorg'

distance = 227
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea uwipev27bypukecrackslomalkaorg'

distance = 227
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea rmail11build9605crackslomalkaorg'

distance = 227
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea appletbuttonfactoryv51byucccrackslomalkaorg'

distance = 227
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea pacdoomv21crackslomalkaorg'

distance = 227
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea actualdrawingv55updatedcrackslomalkaorg'

distance = 241
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea flipoverv32serialbyngencrackslomalkaorg'

distance = 241
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea tagandrenamev18beta3crackslomalkaorg'

distance = 241
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea adotmessv30crackslomalkaorg'

distance = 242
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea abrosoftfantamorph31crackslomalkaorg'

distance = 242
spam score = 14
title = 'x7 dvd xilisoft ripper audio se platinum crea filesharingfornetv15crackslomalkaorg'

distance = 242
spam score = 17
title = 'x7 dvd xilisoft ripper audio se platinum crea absolutetelnetv174crackslomalkaorg'

distance = 243
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea microsoftoffice2003genericcrackcrackslomalkaorg'

distance = 243
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea atlantisoceanmindv10030crackslomalkaorg'

distance = 243
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 243
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea pcad2001fulltrialfixedv2crackslomalkaorg'

distance = 263
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea faxmailforwindowsv93701crackslomalkaorg'

distance = 263
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea activewhoisbrowserv202466byheritagecrackslomalkaorg'

distance = 263
spam score = 14
title = 'x7 dvd xilisoft ripper audio se platinum crea fileandfolderprotectorv189keygenbysndcrackslomalkaorg'

distance = 263
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea alltotrayv462byfficrackslomalkaorg'

distance = 263
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea activeskincontrolv43crackslomalkaorg'

distance = 264
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea animateddesktopv12patchbyfffcrackslomalkaorg'

distance = 264
spam score = 17
title = 'x7 dvd xilisoft ripper audio se platinum crea arobfantasticmp3encoderv13byciacrackslomalkaorg'

distance = 265
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea activeskincontrolocxv40bycucrackslomalkaorg'

distance = 265
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea fileslicerv20serialbytntcrackslomalkaorg'

distance = 265
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea acdexpressv315servercrackslomalkaorg'

distance = 286
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea windowsxpkeygenkeychangecrackslomalkaorg'

distance = 286
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea argentumbackupv180bylashcrackslomalkaorg'

distance = 287
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea admuncherv44crackslomalkaorg'

distance = 287
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea adobegolivev50trialcrackslomalkaorg'

distance = 287
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea amigodvdripperv2821crackslomalkaorg'

distance = 288
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea absolutesecurityprov39keygenbycorecrackslomalkaorg'

distance = 288
spam score = 16
title = 'x7 dvd xilisoft ripper audio se platinum crea tabmailv25byngencrackslomalkaorg'

distance = 288
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea activewhoisv202466crackslomalkaorg'

distance = 288
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea flamingpearaetherize10crackslomalkaorg'

distance = 289
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea fireburnerv217bytctcrackslomalkaorg'

distance = 412
spam score = 15
title = 'x7 dvd xilisoft ripper audio se platinum crea osadobephotoshopcs2tryouttofullactivationkeygenbyoscoriacrackslomalkaorg'

distance = 420
spam score = 14
title = 'x9 converter xilisoft mp3 wav video psp mov i a1dvdripperprofessionalv11060328crackslomalkaorg'

distance = 424
spam score = 10
title = 'a34 ace dvd extractor audio backup se clock pr a1dvdaudioripperv1121crackslomalkaorg'

distance = 436
spam score = 9
title = 'd49 dvd region copy free audio master extracto xdvdrippersev121crackslomalkaorg'

distance = 452
spam score = 8
title = 'd17 dfx for winamp audio dexster devplanner en xdvdrippersev121crackslomalkaorg'

distance = 472
spam score = 5
title = 'a5 a1 ripper dvd professional audio ultra pc ashampoouninstallersuiteplusv132secrackslomalkaorg'

distance = 560
spam score = 10
title = 'a34 ace dvd extractor audio backup se clock pr fsecureantivirusforworkstationsv531winxpcrackslomalkaorg'

distance = 1930
spam score = 24
title = ''

distance = 39
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu address2000v550scrackslomalkaorg'

distance = 41
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fishv333431crackslomalkaorg'

distance = 44
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu ecampaignv2961crackslomalkaorg'

distance = 44
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu slomalkaorg'

distance = 52
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu accessdeniedv320crackslomalkaorg'

distance = 54
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fridayv40251crackslomalkaorg'

distance = 60
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu aprcalcv40112crackslomalkaorg'

distance = 62
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu rexcel10build1019crackslomalkaorg'

distance = 67
spam score = 10
title = 'c74 copytocd dvd copynook copytodvd multilangu archivepro2000v1127crackslomalkaorg'

distance = 77
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu farmanagerv17041282crackslomalkaorg'

distance = 79
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu eiconsv316crackslomalkaorg'

distance = 84
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu aboveandbeyond9817procrackslomalkaorg'

distance = 84
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu eborderclient20crackslomalkaorg'

distance = 85
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu tabazarv25crackslomalkaorg'

distance = 87
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu amlpagesv830733crackslomalkaorg'

distance = 87
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu addressexv421crackslomalkaorg'

distance = 88
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fonttrax20003crackslomalkaorg'

distance = 89
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu activewhoisv212591crackslomalkaorg'

distance = 90
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu acevideoworkshopv1440crackslomalkaorg'

distance = 91
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu filerenamerv10byfffcrackslomalkaorg'

distance = 149
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu amusicalgeneratorv30crackslomalkaorg'

distance = 149
spam score = 10
title = 'c74 copytocd dvd copynook copytodvd multilangu aspasapv327crackslomalkaorg'

distance = 149
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fitnessorganizerv110crackslomalkaorg'

distance = 149
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu edomicrackslomalkaorg'

distance = 149
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu filesave2000crackslomalkaorg'

distance = 150
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu agendapr900v1711114crackslomalkaorg'

distance = 150
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu astonshellv191crackslomalkaorg'

distance = 150
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu actualsearchandreplacev247crackslomalkaorg'

distance = 151
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu autodialogsv21115crackslomalkaorg'

distance = 151
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu acehightexttospeechreader160crackslomalkaorg'

distance = 168
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu namowebeditorv50bycrackmanboycrackslomalkaorg'

distance = 168
spam score = 10
title = 'c74 copytocd dvd copynook copytodvd multilangu pacdoomdangerousadventuresv121crackslomalkaorg'

distance = 168
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fileshredder2000v31byevidencecrackslomalkaorg'

distance = 168
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu atomtime98v21bbylocklesscrackslomalkaorg'

distance = 168
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fsecureantivirusv552crackslomalkaorg'

distance = 168
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu focusphotoeditorv309crackslomalkaorg'

distance = 168
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fullmotionvideov599crackslomalkaorg'

distance = 168
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu privacyguarderv30crackslomalkaorg'

distance = 168
spam score = 11
title = 'c74 copytocd dvd copynook copytodvd multilangu activerefreshv134build531crackslomalkaorg'

distance = 169
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu asmwpcoptimizerprov7002625crackslomalkaorg'

distance = 182
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu activeskincontrolocxv22byeclipsecrackslomalkaorg'

distance = 183
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu powerarchiver2001v70208newcrackslomalkaorg'

distance = 183
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu ubertecwinapppro20136708crackslomalkaorg'

distance = 183
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu namowebeditorv304crackslomalkaorg'

distance = 183
spam score = 10
title = 'c74 copytocd dvd copynook copytodvd multilangu activeskinv43crackslomalkaorg'

distance = 184
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu admuncherv412crackslomalkaorg'

distance = 184
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu r2extremeprov151crackslomalkaorg'

distance = 184
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu g6utillitiesv17crackslomalkaorg'

distance = 184
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu emailsv225serialbyfffcrackslomalkaorg'

distance = 184
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu animatedscreenv61serialbydbccrackslomalkaorg'

distance = 199
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu asksamv512637crackslomalkaorg'

distance = 199
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu remoteadministratorv22serialbyffgcrackslomalkaorg'

distance = 199
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu atropossbv703crackslomalkaorg'

distance = 200
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu absoluteshieldinterneteraserprov325crackslomalkaorg'

distance = 200
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu filetypeswizardv10crackslomalkaorg'

distance = 200
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu nortonantivirus2005completecrackslomalkaorg'

distance = 200
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu actualtestscomcisco640801examcheatsheetv101803crackslomalkaorg'

distance = 201
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu acousticav221bylashcrackslomalkaorg'

distance = 201
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu apluscadcopyv20crackslomalkaorg'

distance = 201
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu astongolfv14javacrackslomalkaorg'

distance = 214
spam score = 10
title = 'c74 copytocd dvd copynook copytodvd multilangu glockadvancedadministrativetoolsv555crackslomalkaorg'

distance = 214
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu filesplitmagic50crackslomalkaorg'

distance = 215
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu advancedmp3converterv203byfficrackslomalkaorg'

distance = 215
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu alphablackzeropropercrackslomalkaorg'

distance = 215
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu privateeyev12crackslomalkaorg'

distance = 215
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu fireburnerv217windowseditioncrackslomalkaorg'

distance = 216
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu facemailv10bycovecrackslomalkaorg'

distance = 216
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu filepreviewv131crackslomalkaorg'

distance = 216
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu gaeb90iov22015germancrackslomalkaorg'

distance = 217
spam score = 10
title = 'c74 copytocd dvd copynook copytodvd multilangu stylexpallversionskeygencrackslomalkaorg'

distance = 234
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu ashampoostartuptunerv131crackslomalkaorg'

distance = 234
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu windowsxpservicepack2byunknowncrackslomalkaorg'

distance = 235
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu a138winwindowsprogrammv200crackslomalkaorg'

distance = 235
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu kasperskyantiviruspersonalcrackslomalkaorg'

distance = 235
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu animagicgifanimatorv122byucfcrackslomalkaorg'

distance = 235
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu arcsoftscannstitchdeluxev1199crackslomalkaorg'

distance = 235
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu arealvalidatorv111serialbyfhcfcrackslomalkaorg'

distance = 235
spam score = 10
title = 'c74 copytocd dvd copynook copytodvd multilangu advancedattachmentsprocessorv130crackslomalkaorg'

distance = 235
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu windows2003andxpandlhantiproductactivationv200crackslomalkaorg'

distance = 235
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu pacestarlanflowv4171787crackslomalkaorg'

distance = 253
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu autostitchv2185crackslomalkaorg'

distance = 253
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu qed201palmpilotcrackslomalkaorg'

distance = 253
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu privacyshredderv216bylomcrackslomalkaorg'

distance = 253
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu activefaxserverv388build195germancrackslomalkaorg'

distance = 254
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu powerwmarecorderv11crackslomalkaorg'

distance = 254
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu ageneralpracticelibraryv2099crackslomalkaorg'

distance = 254
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu asposepdfv15crackslomalkaorg'

distance = 255
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu powereditv212crackslomalkaorg'

distance = 255
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu poweraudioeditorv305fixedcrackslomalkaorg'

distance = 256
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fprotantivirusv312cbyfreeze1crackslomalkaorg'

distance = 281
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu adobephotoshopcs2keygenbyparodoxcrackslomalkaorg'

distance = 281
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu favoaudioeditorv50bycafecrackslomalkaorg'

distance = 282
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu findandreplacetextinmultiplefilessoftwarev70crackslomalkaorg'

distance = 282
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu uwipev27bynatabeccrackslomalkaorg'

distance = 284
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu fprotantivirusforwindowsv311apatchbytntcrackslomalkaorg'

distance = 284
spam score = 10
title = 'c74 copytocd dvd copynook copytodvd multilangu activeshopperaspcomponent10crackslomalkaorg'

distance = 284
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu atomtimeprov31acrackslomalkaorg'

distance = 285
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fprotantivirusforwindowsv308bfixedcrackslomalkaorg'

distance = 286
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu fileslicerv20keygenbyucfcrackslomalkaorg'

distance = 286
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu argosoftmailserverv1866crackslomalkaorg'

distance = 394
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu activeskinv41bypooqcrackslomalkaorg'

distance = 411
spam score = 8
title = 'c74 copytocd dvd copynook copytodvd multilangu postmortemencephalumreanimatorper10bydbccrackslomalkaorg'

distance = 442
spam score = 9
title = 'c74 copytocd dvd copynook copytodvd multilangu osadobephotoshopcs2tryouttofullactivationkeygenbyoscoriacrackslomalkaorg'

distance = 1928
spam score = 45
title = 'calidris ferruginea gujarat'

distance = 1940
spam score = 47
title = 'hydrocoloeus minutus gujarat'

distance = 48
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli alp19ecrackslomalkaorg'

distance = 50
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli namebase301crackslomalkaorg'

distance = 52
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli babynamesv101crackslomalkaorg'

distance = 57
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli addressex421crackslomalkaorg'

distance = 63
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli appplusv30crackslomalkaorg'

distance = 68
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli r2v507hcrackslomalkaorg'

distance = 71
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli fireburnerv217crackslomalkaorg'

distance = 71
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli qacoachv2235crackslomalkaorg'

distance = 74
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli faxamaticvv96514crackslomalkaorg'

distance = 80
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli adayinthelifev15crackslomalkaorg'

distance = 80
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli autopilotv206crackslomalkaorg'

distance = 82
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli animatedcursorv100ccrackslomalkaorg'

distance = 84
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli advanceduninstallerpro2003v6crackslomalkaorg'

distance = 85
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli attilav34crackslomalkaorg'

distance = 85
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli activeskinv426crackslomalkaorg'

distance = 91
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli accessmanagerv30crackslomalkaorg'

distance = 92
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli frapsv221crackslomalkaorg'

distance = 92
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli vampv150crackslomalkaorg'

distance = 92
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli areaeditorv130crackslomalkaorg'

distance = 92
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli fixurlaub2001v10crackslomalkaorg'

distance = 163
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli activeskinv43crackslomalkaorg'

distance = 163
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli flextouch10crackslomalkaorg'

distance = 163
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli emailseekerv15crackslomalkaorg'

distance = 163
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli gadwinsystemsdiagramstudiov3602405crackslomalkaorg'

distance = 163
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli axialisaxviewer35003frenchcrackslomalkaorg'

distance = 163
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli flashsaverv40byphaze2002crackslomalkaorg'

distance = 163
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli tab2desk2120crackslomalkaorg'

distance = 163
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli accesscodeanalyzer111crackslomalkaorg'

distance = 164
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli airmessengersnppv31crackslomalkaorg'

distance = 164
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli absolutetelnetv350crackslomalkaorg'

distance = 182
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli emailsv226crackslomalkaorg'

distance = 182
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli emailsv225keygenbyfffcrackslomalkaorg'

distance = 182
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli afsonlineshop2000crackslomalkaorg'

distance = 182
spam score = 11
title = 'b28 blowfish 2000 block blobshop v10 v22 bli activerefresh131build509crackslomalkaorg'

distance = 182
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli farv163crackslomalkaorg'

distance = 183
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli qheal5216crackslomalkaorg'

distance = 183
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli nameityourwayniyowv140crackslomalkaorg'

distance = 184
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli purgem2000v300bydsicrackslomalkaorg'

distance = 184
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli powercardmakerv34keygencrackslomalkaorg'

distance = 184
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli privatesitesv3012021crackslomalkaorg'

distance = 200
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli allelectrosoft32bitsv94901crackslomalkaorg'

distance = 200
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli activefaxserverv387build194crackslomalkaorg'

distance = 200
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli qimagepro1003crackslomalkaorg'

distance = 201
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli uhefilterscapevstv11crackslomalkaorg'

distance = 201
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli pacificwarv1012trainercrackslomalkaorg'

distance = 201
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli puntotekv15goldcrackslomalkaorg'

distance = 201
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli abovebeyond9817crackslomalkaorg'

distance = 201
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli activeprofile12crackslomalkaorg'

distance = 201
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli fsecuresshclientv540japanesecrackslomalkaorg'

distance = 201
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli ahapasswordandinfomanager402crackslomalkaorg'

distance = 214
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli activestatekomodov25076516crackslomalkaorg'

distance = 215
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli animatedscreenv61serialbytcacrackslomalkaorg'

distance = 215
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli formpilotprov126crackslomalkaorg'

distance = 215
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli arobfantasticmp3encoderv20crackcrackslomalkaorg'

distance = 215
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli privacydummyv10bynitrouscrackslomalkaorg'

distance = 215
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli albumgeneratorandviewerv2031crackslomalkaorg'

distance = 215
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli animatedscreenv68byfffcrackslomalkaorg'

distance = 216
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli aplusexameprepv40crackslomalkaorg'

distance = 216
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli acdpicaviewv20spanishbybidjancrackslomalkaorg'

distance = 216
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli auctionsentryv251crackslomalkaorg'

distance = 227
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli atmospheredeluxev521crackslomalkaorg'

distance = 227
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli antechinusphpeditorv20crackslomalkaorg'

distance = 227
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli akalaexelockv30byimscrackslomalkaorg'

distance = 227
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli powerdefragv301newcrackslomalkaorg'

distance = 228
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli alteros3d23build2302keygencrackslomalkaorg'

distance = 228
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli famosroboticv611icrackslomalkaorg'

distance = 228
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli privacyguardv20byhdhcrackslomalkaorg'

distance = 228
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli fastmenuv104newcrackslomalkaorg'

distance = 228
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli atomicemailloggerv144crackslomalkaorg'

distance = 228
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli puzzlebrainstormv125crackslomalkaorg'

distance = 244
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli algolabphotovectorv110crackslomalkaorg'

distance = 244
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli addressexpressv103byaircrackslomalkaorg'

distance = 244
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli activepdfdocconverterv352crackslomalkaorg'

distance = 244
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli pushftpv2011byeminencecrackslomalkaorg'

distance = 245
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli asterixgallicwarstrainercrackslomalkaorg'

distance = 246
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli privatepixv200fixedcrackslomalkaorg'

distance = 246
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli aceutilitiesv165bytsrhcrackslomalkaorg'

distance = 246
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli eborderserversmallbushiness12crackslomalkaorg'

distance = 246
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli fasoftntrackstudiov31crackslomalkaorg'

distance = 247
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli pacchapv091crackslomalkaorg'

distance = 264
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli fsprofilesystemcryptographicprotectorv104crackcrackslomalkaorg'

distance = 264
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli windowsxpactivatekeygenbyruteamcrackslomalkaorg'

distance = 265
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli appsprotectorxpv10v11crackslomalkaorg'

distance = 265
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli alienskineyecandy31crackslomalkaorg'

distance = 265
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli fathsendmailbyfhcfcrackslomalkaorg'

distance = 265
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli adpopupkillerv20crackslomalkaorg'

distance = 265
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli fileshredder2000v33bylashcrackslomalkaorg'

distance = 265
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli activeskincomponent352crackslomalkaorg'

distance = 266
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli fprotantivirusv31xevaluationcrackslomalkaorg'

distance = 266
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli freshuibusinesseditionv721crackslomalkaorg'

distance = 296
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli powerarchiver2003v86002bytnocrackslomalkaorg'

distance = 296
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli emailfactoryv12bytsrhcrackslomalkaorg'

distance = 296
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli airforcefightersscreensaver21crackslomalkaorg'

distance = 297
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli filthypasswordgeneratornetwinmobile2003armcrackslomalkaorg'

distance = 298
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli adobephotoshopcs2keygenbyparodoxcrackslomalkaorg'

distance = 298
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli agnitumoutpostfirewallv21build3034009byhtbteamcrackslomalkaorg'

distance = 298
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli ashampoophotoilluminator2seeyaplugincrackslomalkaorg'

distance = 298
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli autoplaymenubuilderv32crackslomalkaorg'

distance = 298
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli favoaudioconverterv50byfffcrackslomalkaorg'

distance = 299
spam score = 9
title = 'b28 blowfish 2000 block blobshop v10 v22 bli powerclock416keygencrackslomalkaorg'

distance = 419
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli aareavitovcddvdsvcdmpegv40crackslomalkaorg'

distance = 422
spam score = 10
title = 'b28 blowfish 2000 block blobshop v10 v22 bli puremotionnoisereductionv101foreditstudiocrackslomalkaorg'

distance = 1874
spam score = 24
title = ''

distance = 63
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp ebook12crackslomalkaorg'

distance = 72
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp addressex421crackslomalkaorg'

distance = 102
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp attributemagicprov223crackslomalkaorg'

distance = 115
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fsecureantivirusv409crackslomalkaorg'

distance = 123
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp associatethisv123109crackslomalkaorg'

distance = 126
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp av4customermanagementsystemprov5680crackslomalkaorg'

distance = 129
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp absolutedelete2003v10crackslomalkaorg'

distance = 132
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp animatedscreenv41crackslomalkaorg'

distance = 133
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp rdriveimage20b2006crackslomalkaorg'

distance = 133
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp halocecrackslomalkaorg'

distance = 138
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp emailseekerv17crackslomalkaorg'

distance = 140
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp acutemyfiles10crackslomalkaorg'

distance = 143
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp animatedgifeditor95v14crackslomalkaorg'

distance = 150
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp find12crackslomalkaorg'

distance = 153
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp emailviaphone11byamokcrackslomalkaorg'

distance = 155
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp alienskineyecandy31crackslomalkaorg'

distance = 158
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp gabrielv19crackslomalkaorg'

distance = 158
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp freeripv290multilanguagecrackslomalkaorg'

distance = 158
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp adslogmanagerv2007crackslomalkaorg'

distance = 158
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp p2cpluspascalcompiler12410ecrackslomalkaorg'

distance = 169
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp ageofempiresfranaiscrackslomalkaorg'

distance = 174
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp emailsv220crackslomalkaorg'

distance = 174
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp qimagepro1003crackslomalkaorg'

distance = 177
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fordstreetracingripcrackslomalkaorg'

distance = 177
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp accesspasswordrecoverygeniev16020050612crackslomalkaorg'

distance = 177
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp antechinusmediaeditorv40crackslomalkaorg'

distance = 181
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp emailsv225keygenbyfffcrackslomalkaorg'

distance = 181
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp nameityourwayniyowv140crackslomalkaorg'

distance = 182
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp alarmnotesv30crackslomalkaorg'

distance = 183
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp editorebookcompilerv30crackslomalkaorg'

distance = 191
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp almostalladingsoftwareproductscrackslomalkaorg'

distance = 191
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp findwordbusinessv231210crackslomalkaorg'

distance = 195
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp activemessenger105crackslomalkaorg'

distance = 196
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp findflashv15byc0nspiracycrackslomalkaorg'

distance = 199
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp pshieldwatcherv15crackslomalkaorg'

distance = 200
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp alphaballv13windowsfixbyfffcrackslomalkaorg'

distance = 202
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp animagicgifanimatorv122crackslomalkaorg'

distance = 202
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp asposepdfv14weboemcrackslomalkaorg'

distance = 202
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp faqgeniev110crackslomalkaorg'

distance = 205
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp adayinthelifev13bycsccrackslomalkaorg'

distance = 210
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp emailextractorexpressv21byevidencecrackslomalkaorg'

distance = 212
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp aplusfileprotectionv27crackslomalkaorg'

distance = 212
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp antihack20build59crackslomalkaorg'

distance = 212
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp xfilesscreensaverscrackslomalkaorg'

distance = 212
spam score = 10
title = 'b18 beyond compare bible build bibble betterjp activerefreshv136build551crackslomalkaorg'

distance = 212
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aplusexameprepv40crackslomalkaorg'

distance = 213
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aelitabootadminv2xcrackslomalkaorg'

distance = 214
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aucprov12bytnocrackslomalkaorg'

distance = 215
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fantasyleaguemanagerflmvd10crackslomalkaorg'

distance = 215
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp emailsv225serialbyfffcrackslomalkaorg'

distance = 220
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fotoballoonv10crackslomalkaorg'

distance = 220
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp namebase301crackslomalkaorg'

distance = 222
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp arobfantasticmp3networkedencoderv14crackslomalkaorg'

distance = 223
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aplusfileprotectionv21crackslomalkaorg'

distance = 224
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp afsmulticash105crackslomalkaorg'

distance = 224
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp astv101crackslomalkaorg'

distance = 225
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp efunsoftmastermind10bylashcrackslomalkaorg'

distance = 226
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp freshuiv620byngencrackslomalkaorg'

distance = 227
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp adobeimagestylerv10byciacrackslomalkaorg'

distance = 228
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp aktiplannerv111crackslomalkaorg'

distance = 232
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp asmwpcoptimizerprov631byfffcrackslomalkaorg'

distance = 232
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp favoriteshortcutsv1320crackslomalkaorg'

distance = 232
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp accessmanagerforwindowsv44bytsrhcrackslomalkaorg'

distance = 239
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp nortonantivirus2005completefixedcrackslomalkaorg'

distance = 240
spam score = 9
title = 'b18 beyond compare bible build bibble betterjp autorundesignspecialty6065crackslomalkaorg'

distance = 244
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp activepdfdocconverterv352crackslomalkaorg'

distance = 245
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp autorunassistantv293bysndcrackslomalkaorg'

distance = 245
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp luxorv10534ragamescrackbyffgcrackslomalkaorg'

distance = 245
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp activeskinv4273crackslomalkaorg'

distance = 248
spam score = 9
title = 'b18 beyond compare bible build bibble betterjp actualtestscomcisco642432examcheatsheetv51404crackslomalkaorg'

distance = 252
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp asplitv10bydfcrackslomalkaorg'

distance = 252
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp forteagentv20build32640crackslomalkaorg'

distance = 253
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp activestatetclprov1502crackslomalkaorg'

distance = 255
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fprotantivirusv312cbyfreezecrackslomalkaorg'

distance = 256
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 256
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp akilysv1100frenchcrackslomalkaorg'

distance = 259
spam score = 9
title = 'b18 beyond compare bible build bibble betterjp asposeprojectv117netcrackslomalkaorg'

distance = 262
spam score = 9
title = 'b18 beyond compare bible build bibble betterjp actualdrawingv35bybidjancrackslomalkaorg'

distance = 262
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp halobyeldiablocrackslomalkaorg'

distance = 262
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp ataniv221byfffcrackslomalkaorg'

distance = 271
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp fsecureantivirusformicrosoftexchangewithspamcontrolv631crackslomalkaorg'

distance = 273
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp autorunassistantv29byenfusiacrackslomalkaorg'

distance = 273
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp rwipecleanv351098crackslomalkaorg'

distance = 274
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp uhefilterscapevstv11crackslomalkaorg'

distance = 274
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp filescannerprov16001bytntcrackslomalkaorg'

distance = 275
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp akashidefoldersv2101crackslomalkaorg'

distance = 275
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp rstudionetworkedition20build121047crackslomalkaorg'

distance = 276
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp appsprotectorxpv10v11crackslomalkaorg'

distance = 276
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fsecureantivirusv54xcrackslomalkaorg'

distance = 279
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fathcryptcontrolforwin32v20crackslomalkaorg'

distance = 287
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp a1dvdaudioripperv1141crackslomalkaorg'

distance = 290
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fsecuresshserverv5238crackslomalkaorg'

distance = 292
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp adobeacrobatv70professionaltryoutcrackbytimcrackslomalkaorg'

distance = 293
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp editorv30build1090crackslomalkaorg'

distance = 293
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp ativapronetmeterv317byelilacrackslomalkaorg'

distance = 299
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp privacyfence10crackslomalkaorg'

distance = 299
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fprotantivirusforwindowsv311abysparkcrackslomalkaorg'

distance = 301
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp fantasoftmonkeyshinescrackslomalkaorg'

distance = 307
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp filthypasswordgeneratornetwinmobile2003armcrackslomalkaorg'

distance = 312
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 330
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp purgem2000v206crackslomalkaorg'

distance = 333
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp addremoveplus2002v311223bytsrhcrackslomalkaorg'

distance = 333
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp apracticalguidetoenterprisearchitectureebookcrackslomalkaorg'

distance = 336
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp appsenseperformancesuitedatecode07072003crackslomalkaorg'

distance = 350
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp animallogicmaxman13andabovefor3dstudiomaxcrackslomalkaorg'

distance = 354
spam score = 7
title = 'b18 beyond compare bible build bibble betterjp amigoeasyvideoconverterv3830crackslomalkaorg'

distance = 370
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp argosoftmailserverplusv1619keygencrackslomalkaorg'

distance = 374
spam score = 8
title = 'b18 beyond compare bible build bibble betterjp ashampoophotoilluminator2seeyaplugincrackslomalkaorg'

distance = 42
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte ntrackstudiov211crackslomalkaorg'

distance = 50
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte activewhoisv212587crackslomalkaorg'

distance = 50
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte ebook12crackslomalkaorg'

distance = 52
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte audiotoolsv320crackslomalkaorg'

distance = 55
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte areslitev410crackslomalkaorg'

distance = 58
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte adayinthelifev151serialcrackslomalkaorg'

distance = 61
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte autoprofilv60crackslomalkaorg'

distance = 62
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte acepics201crackslomalkaorg'

distance = 62
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte ascv30crackslomalkaorg'

distance = 75
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte falbumv101crackslomalkaorg'

distance = 76
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte uwipev28crackslomalkaorg'

distance = 77
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte eborderclient20crackslomalkaorg'

distance = 77
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte allkasperskyproductscrackslomalkaorg'

distance = 77
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte p7dp7crackslomalkaorg'

distance = 77
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte hackmanv501newcrackslomalkaorg'

distance = 78
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte ebusinesssolutionsv5006crackslomalkaorg'

distance = 78
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte freshdiagnosev400crackslomalkaorg'

distance = 83
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte octopusvs519dcrackslomalkaorg'

distance = 85
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte packit14crackslomalkaorg'

distance = 88
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte windowsxpactivationcrackv42crackslomalkaorg'

distance = 150
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte aplusfilenamingsystemv110crackslomalkaorg'

distance = 150
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte f12001keygencrackslomalkaorg'

distance = 150
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte arcsoftfunhousecrackslomalkaorg'

distance = 150
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte adronv102bypizzacrackslomalkaorg'

distance = 151
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte filescavengerv140ccrackslomalkaorg'

distance = 151
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte adclosev17crackslomalkaorg'

distance = 152
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte activexmanagerv14crackslomalkaorg'

distance = 153
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte findnprint32bit30crackslomalkaorg'

distance = 153
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte asposepdfv19crackslomalkaorg'

distance = 154
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte emailseekerv17newcrackslomalkaorg'

distance = 171
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte angelart12crackslomalkaorg'

distance = 171
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte f1racingsimcrackslomalkaorg'

distance = 172
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte ntrackstudiov20crackslomalkaorg'

distance = 172
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte adayinthelifev151keygencrackslomalkaorg'

distance = 172
spam score = 5
title = 'p68 powertcp tool powerzip web bid ppc reporte kasperskyantiviruspersonalv50227keygenfilecrackslomalkaorg'

distance = 172
spam score = 7
title = 'p68 powertcp tool powerzip web bid ppc reporte actualtitlebuttonsv25crackslomalkaorg'

distance = 172
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte argentummyfilesv200byrealistycrackslomalkaorg'

distance = 172
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte flashfxpv20908finalcrackslomalkaorg'

distance = 172
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte accessimagev250byfhcfcrackslomalkaorg'

distance = 173
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte activescreenlockpasswordrecoveryv16crackslomalkaorg'

distance = 190
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte arealvalidatorv111byfffcrackslomalkaorg'

distance = 191
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte ataniv382crackslomalkaorg'

distance = 191
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte flashfxpv21build924crackslomalkaorg'

distance = 191
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte kasperskyantiviruspersonalv50121crackslomalkaorg'

distance = 191
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte windowsxpactivationcrackcrackslomalkaorg'

distance = 192
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte fsecureantivirusv552crackslomalkaorg'

distance = 192
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte activewhoisbrowserv202466crackslomalkaorg'

distance = 192
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte eiconsv343patchcrackslomalkaorg'

distance = 193
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte areaeditorv18crackslomalkaorg'

distance = 193
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte asteriskpasswordrevealv20crackslomalkaorg'

distance = 207
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte packplus171frenchcrackslomalkaorg'

distance = 207
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte accessmanagerv24bydarkfuturecrackslomalkaorg'

distance = 207
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte amichartv1455crackslomalkaorg'

distance = 208
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte appletnavigationfactoryv20byc4acrackslomalkaorg'

distance = 208
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte emailextractorexpressv20byelilacrackslomalkaorg'

distance = 209
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte editorebookcompilerv25crackslomalkaorg'

distance = 209
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte amusicalgeneratorv30beta7crackslomalkaorg'

distance = 209
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte ajcctnmv610forpocketpccrackslomalkaorg'

distance = 209
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte airmessengermobilev175crackslomalkaorg'

distance = 209
spam score = 7
title = 'p68 powertcp tool powerzip web bid ppc reporte antennawebdesignstudiov2185crackslomalkaorg'

distance = 221
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte gawebserverv1077crackslomalkaorg'

distance = 221
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte aerialviewsworldcitiesscreensaverv10crackslomalkaorg'

distance = 221
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte alltagstagebuchv2004060939crackslomalkaorg'

distance = 221
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte ecampaignprofessionaleditionv2944bynitrouscrackslomalkaorg'

distance = 222
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte amibrokerprofessionaleditionv45011crackslomalkaorg'

distance = 222
spam score = 7
title = 'p68 powertcp tool powerzip web bid ppc reporte adobeillustratorv100timelimitcrackcrackslomalkaorg'

distance = 222
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte absolutistmahjongv10forpocketpccrackslomalkaorg'

distance = 222
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte rdiomp3v21byamokcrackslomalkaorg'

distance = 222
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte findstring460crackslomalkaorg'

distance = 222
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte absolutedelete2003v10byscfcrackslomalkaorg'

distance = 236
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte vacationrentaltrackerplusv123crackslomalkaorg'

distance = 236
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte atomsyncprov201crackslomalkaorg'

distance = 236
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte powerarchiver2001v702greekcrackslomalkaorg'

distance = 237
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte filespy100bycorecrackslomalkaorg'

distance = 237
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte activeskincontrolocxv40byadhamdahabcrackslomalkaorg'

distance = 237
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte activeskincontrolv43crackslomalkaorg'

distance = 237
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte alphacontrolsv341fordelphiv567crackslomalkaorg'

distance = 237
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte arealvalidatorv111serialbyamokcrackslomalkaorg'

distance = 238
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte accessreporterv747crackslomalkaorg'

distance = 238
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte autotask2000v241bydesperatecrackslomalkaorg'

distance = 253
spam score = 7
title = 'p68 powertcp tool powerzip web bid ppc reporte alapimposerprov11foradobeindesigncrackslomalkaorg'

distance = 254
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte pcad2001fulltrialfixedv2crackslomalkaorg'

distance = 254
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte filequest1101keygencrackslomalkaorg'

distance = 254
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte advancedrarpasswordrecoveryv120bycimcrackslomalkaorg'

distance = 256
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte aspackv211dupdatedcrackslomalkaorg'

distance = 256
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte adayatthebeachslots11crackslomalkaorg'

distance = 257
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte puzzleblastv10bypizzacrackslomalkaorg'

distance = 258
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte apersonaltodolistv10crackslomalkaorg'

distance = 258
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte alparysofthandsfreescreensaverv10build94330611crackslomalkaorg'

distance = 259
spam score = 7
title = 'p68 powertcp tool powerzip web bid ppc reporte ashampoomp3studiodeluxev1035secrackcrackslomalkaorg'

distance = 285
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte acousticamp3towaveconvertorplusv203bytntcrackslomalkaorg'

distance = 285
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte alivemp3wavconverterstandardv2329bycimcrackslomalkaorg'

distance = 286
spam score = 7
title = 'p68 powertcp tool powerzip web bid ppc reporte antennawebdesignstudiov21086multilanguagecrackslomalkaorg'

distance = 286
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte powerwebsitebuilderv150bydigeraticrackslomalkaorg'

distance = 287
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte activeskinocxv43patchbydceptioncrackslomalkaorg'

distance = 287
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte atrisehtmlockv180byl1nkteamcrackslomalkaorg'

distance = 288
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte advancedrarpasswordrecoveryv111bytntcrackslomalkaorg'

distance = 288
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte emailextractorexpressv20byevccrackslomalkaorg'

distance = 288
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte namowebeditorv50byaaocgcrackslomalkaorg'

distance = 289
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte addremoveplus2002v30bydbccrackslomalkaorg'

distance = 374
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte appletpasswordwizardv20byskywalkercrackslomalkaorg'

distance = 377
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte asserwareunitconverterproaucprov12crackslomalkaorg'

distance = 387
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte agentcyseagentcyselfextractinginstallerv101byeminencecrackslomalkaorg'

distance = 402
spam score = 6
title = 'p68 powertcp tool powerzip web bid ppc reporte auroravideovcdsvcddvdconverterandcreatorv121byvirilitycrackslomalkaorg'

distance = 1790
spam score = 2
title = 'learning and literacy tools including frederick and more'

distance = 1791
spam score = 4
title = 'learning and literacy tools including frederick and more'

distance = 33
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma epop203123crackslomalkaorg'

distance = 62
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma divxprov521crackslomalkaorg'

distance = 63
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma arealvalidator111crackslomalkaorg'

distance = 63
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma arealvalidatorv111crackslomalkaorg'

distance = 75
spam score = 5
title = 'm10 magic utilities magicdraw 2003 2004 uml ma advancedwebrankingv32crackslomalkaorg'

distance = 75
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma g3bayv104crackslomalkaorg'

distance = 75
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma r4professional120crackslomalkaorg'

distance = 77
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma findduplicatev22crackslomalkaorg'

distance = 77
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma asksamprov612797crackslomalkaorg'

distance = 78
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma fivev272newcrackslomalkaorg'

distance = 81
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma freshdiagnosev620crackslomalkaorg'

distance = 84
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma adayinthelifev15crackcrackslomalkaorg'

distance = 88
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma all2bmpv101crackslomalkaorg'

distance = 92
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma autosizev230crackslomalkaorg'

distance = 92
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma hackmanv504crackslomalkaorg'

distance = 93
spam score = 7
title = 'm10 magic utilities magicdraw 2003 2004 uml ma absoluteviewv12023crackslomalkaorg'

distance = 94
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma eiconsv370bycorecrackslomalkaorg'

distance = 94
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma xnetstatprov40crackslomalkaorg'

distance = 94
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma animatedscreenv61keygencrackslomalkaorg'

distance = 95
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma fireburnerv208crackslomalkaorg'

distance = 158
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma alittlevietnamesev12crackslomalkaorg'

distance = 158
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma applicationtimerv11crackslomalkaorg'

distance = 158
spam score = 5
title = 'm10 magic utilities magicdraw 2003 2004 uml ma advancedvideopokerv1362bymp2kcrackslomalkaorg'

distance = 158
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma agtransform116crackslomalkaorg'

distance = 159
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma autopilotv210build784crackslomalkaorg'

distance = 159
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma antiviruspersonalprov45094crackslomalkaorg'

distance = 160
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma acetranslatorv30080crackslomalkaorg'

distance = 160
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma aliensvspredator2keygencrackslomalkaorg'

distance = 160
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma flashsoft106crackslomalkaorg'

distance = 160
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma formularyv121crackslomalkaorg'

distance = 177
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma faxmailnetworkforwindowsvv96601crackslomalkaorg'

distance = 177
spam score = 8
title = 'm10 magic utilities magicdraw 2003 2004 uml ma activerefreshv20build613crackslomalkaorg'

distance = 177
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma efunsoftmastermind10bylashcrackslomalkaorg'

distance = 177
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma fastmenuv104bytntcrackslomalkaorg'

distance = 177
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma argosoftnewsserverv1022crackslomalkaorg'

distance = 178
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma accessftpv21crackslomalkaorg'

distance = 178
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma autumnmotivesscreensaverv10crackslomalkaorg'

distance = 178
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma p2psharespyv10crackslomalkaorg'

distance = 178
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma activexmanagerv14bydesperatecrackslomalkaorg'

distance = 179
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma packplus201crackslomalkaorg'

distance = 193
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma fprotantivirusforwindowsv309crackslomalkaorg'

distance = 194
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma nagsawayv11crackslomalkaorg'

distance = 194
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma emailalertv1019bylashcrackslomalkaorg'

distance = 194
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma armadillosoftwareprotectionsystemv183crackslomalkaorg'

distance = 194
spam score = 5
title = 'm10 magic utilities magicdraw 2003 2004 uml ma freewebmanager20crackslomalkaorg'

distance = 194
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma activefaxserverv387build194crackslomalkaorg'

distance = 194
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma activexmanagerv14bydbccrackslomalkaorg'

distance = 195
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma alarmmasterv30crackslomalkaorg'

distance = 195
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma adcsv106serialcrackslomalkaorg'

distance = 195
spam score = 7
title = 'm10 magic utilities magicdraw 2003 2004 uml ma arlesimagewebpagecreatorv583crackslomalkaorg'

distance = 209
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma eiconsv3xcrackslomalkaorg'

distance = 210
spam score = 8
title = 'm10 magic utilities magicdraw 2003 2004 uml ma activerefreshv136build551crackslomalkaorg'

distance = 210
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma ajcdiffv13crackslomalkaorg'

distance = 210
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma abrosoftfantamorphdeluxeeditionv36crackslomalkaorg'

distance = 210
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma advancedcallcenterv2310448crackslomalkaorg'

distance = 210
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma fastraqmailtraq1151167crackslomalkaorg'

distance = 210
spam score = 7
title = 'm10 magic utilities magicdraw 2003 2004 uml ma namtukmyscreencaptureactivexv101crackslomalkaorg'

distance = 211
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma avirtgatewaysuite42crackslomalkaorg'

distance = 211
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma flashimagebuilderv30bytntcrackslomalkaorg'

distance = 211
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma adressen2000v12crackslomalkaorg'

distance = 226
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma apolloaudiodataburnerv118crackslomalkaorg'

distance = 226
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma aiwrad72crackslomalkaorg'

distance = 226
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma emailtalkerv40crackslomalkaorg'

distance = 226
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma galleon3dscreensaverv11crackslomalkaorg'

distance = 227
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma avidsoftimagebehaviorv20forlinuxcrackslomalkaorg'

distance = 227
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma arcsoftmediacardcompanionv10crackslomalkaorg'

distance = 227
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma activeskinv422crackcrackslomalkaorg'

distance = 228
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma advancedaircraftanalysis22acrackslomalkaorg'

distance = 228
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma arealvalidatorv111byfhcfcrackslomalkaorg'

distance = 228
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma arobfantasticmp3networkedencoder14crackslomalkaorg'

distance = 245
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma powerdvdv60byparadoxcrackslomalkaorg'

distance = 245
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma kasperskyantiviruspersonalv50227keygenfilecrackslomalkaorg'

distance = 245
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma albumwrap10bytmgcrackslomalkaorg'

distance = 245
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma ashampoosnapyacrackslomalkaorg'

distance = 245
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma alivemp3wavconverterstandardv2216crackslomalkaorg'

distance = 246
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma fishfastinteractivesqlhelperv333229crackslomalkaorg'

distance = 246
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma agnitumoutpostfirewallprov212923816307crackslomalkaorg'

distance = 246
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma achristmasatsantasv29crackslomalkaorg'

distance = 246
spam score = 5
title = 'm10 magic utilities magicdraw 2003 2004 uml ma fotostationprov45crackslomalkaorg'

distance = 248
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma arobfantasticmp3encoderv13bycorecrackslomalkaorg'

distance = 267
spam score = 5
title = 'm10 magic utilities magicdraw 2003 2004 uml ma purchaseorderv131workingbyacmecrackslomalkaorg'

distance = 267
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma activeskinv43crackslomalkaorg'

distance = 267
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma absolutesecurityv39crackslomalkaorg'

distance = 268
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma stylexpv306keygenbyexclipsecrackslomalkaorg'

distance = 268
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma faxamaticvv96514crackslomalkaorg'

distance = 268
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma alteros3dv15keygenbydesperatecrackslomalkaorg'

distance = 268
spam score = 5
title = 'm10 magic utilities magicdraw 2003 2004 uml ma xaudiovideojoinerv1211127crackslomalkaorg'

distance = 268
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma autotask2000v220crackslomalkaorg'

distance = 268
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma advancedmp3soundrecorderv16bybokivcrackslomalkaorg'

distance = 269
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma alphacontrolsv347fordelphicrackslomalkaorg'

distance = 295
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma actualtestscomcisco640811examcheatsheetv110403crackslomalkaorg'

distance = 296
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma activestateperldevkitv411crackslomalkaorg'

distance = 296
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma gadugaduallversionsbannerkiller2v14byunrealcrackslomalkaorg'

distance = 297
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma activexmanagerv14byfffcrackslomalkaorg'

distance = 297
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma atscreenthiefv352bycphvcrackslomalkaorg'

distance = 297
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma fathftpcontrolforwin32v15crackslomalkaorg'

distance = 298
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma acousticamp3towaveconverterplusv228crackslomalkaorg'

distance = 298
spam score = 5
title = 'm10 magic utilities magicdraw 2003 2004 uml ma fsecureantivirusv54xcrackslomalkaorg'

distance = 298
spam score = 7
title = 'm10 magic utilities magicdraw 2003 2004 uml ma actuateanalyticscubedesignerv80crackslomalkaorg'

distance = 299
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma aelitajournalv2xcrackslomalkaorg'

distance = 378
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma amfdailyplannerandpersonalinformationmanagerpimv939crackslomalkaorg'

distance = 384
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma airnavacarsdecoderv10byraccrackslomalkaorg'

distance = 404
spam score = 5
title = 'm10 magic utilities magicdraw 2003 2004 uml ma arconplusvisuellearchitekturv651germanrealdongleemulatedcrackslomalkaorg'

distance = 423
spam score = 6
title = 'm10 magic utilities magicdraw 2003 2004 uml ma favoaudioeditorv50bycafecrackslomalkaorg'

distance = 1361
spam score = 19
title = 'kaboom contact magic 20 kaboomcontactmagic20crackslomalkaorg'

distance = 1362
spam score = 17
title = 'antechinus photo magic v13 antechinusphotomagicv13crackslomalkaorg'

distance = 1392
spam score = 17
title = 'antechinus photo magic v11 by tmg antechinusphotomagicv11bytmgcrackslomalkaorg'

distance = 22
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 ebookv1001crackslomalkaorg'

distance = 28
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 table24crackslomalkaorg'

distance = 61
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 ecampaignv297crackslomalkaorg'

distance = 64
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 abpfiffv706crackslomalkaorg'

distance = 67
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 activepagerv10crackslomalkaorg'

distance = 72
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 forc43crackslomalkaorg'

distance = 73
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 ecampaignv30crackslomalkaorg'

distance = 73
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 advanceduninstallerpro2003v601crackslomalkaorg'

distance = 76
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 ecapturerv206crackslomalkaorg'

distance = 79
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 filesecurerv341byngencrackslomalkaorg'

distance = 80
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 autocadv2007crackslomalkaorg'

distance = 81
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 advancedmp3searchv16crackslomalkaorg'

distance = 82
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 vampv1400bycrossfirecrackslomalkaorg'

distance = 82
spam score = 6
title = 'a170 axman axion v20 axis axysnake axialis v1 activerefreshv20build613crackslomalkaorg'

distance = 83
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 actualdrawingv54crackslomalkaorg'

distance = 86
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 arcviewv31crackslomalkaorg'

distance = 90
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 alphajournalprov30crackslomalkaorg'

distance = 91
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 andorv10newcrackslomalkaorg'

distance = 92
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 folderindexerv130crackslomalkaorg'

distance = 93
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 halloweenv1666crackslomalkaorg'

distance = 150
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 fprotantivirusforwindowsv312acrackslomalkaorg'

distance = 150
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 albumexpressv26cbyrp2kcrackslomalkaorg'

distance = 151
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 activepdfdocconverterv352crackslomalkaorg'

distance = 152
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 flashfxpv143build835crackslomalkaorg'

distance = 152
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 audiotoolsv301crackslomalkaorg'

distance = 152
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 akilysv1000frenchcrackslomalkaorg'

distance = 153
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 allegrosurfv4300byeclipsecrackslomalkaorg'

distance = 153
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 nortoninternetsecurity2005crackslomalkaorg'

distance = 154
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 autoplaymenustudioprov3002crackslomalkaorg'

distance = 154
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 filetimeedit2v206crackslomalkaorg'

distance = 174
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 fonty98v2162crackslomalkaorg'

distance = 174
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 almostallflywheelsoftwareproductscrackslomalkaorg'

distance = 174
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 fileslicerv20build09001byeclipsecrackslomalkaorg'

distance = 174
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 autospellv546crackslomalkaorg'

distance = 175
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 folderguardprov55byngencrackslomalkaorg'

distance = 175
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 aladdintuner30crackslomalkaorg'

distance = 175
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 antihackerandtrojanexpertv200316crackslomalkaorg'

distance = 175
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 ebusinessappletv410crackslomalkaorg'

distance = 175
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 edomicrackslomalkaorg'

distance = 175
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 emailextractorexpressv21bydbccrackslomalkaorg'

distance = 189
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 activexmanagerv14byevccrackslomalkaorg'

distance = 189
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 addprintpro2000v06208000crackslomalkaorg'

distance = 190
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 eplanpro35crackslomalkaorg'

distance = 191
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 filescannerprov18002crackslomalkaorg'

distance = 191
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 activeskinv425byulises2kcrackslomalkaorg'

distance = 192
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 accessdiverv272crackslomalkaorg'

distance = 192
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 t3screensavercrackslomalkaorg'

distance = 192
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 alltagstagebuch2001060635crackslomalkaorg'

distance = 193
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 flaxv300crackslomalkaorg'

distance = 193
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 valentinecardscrackslomalkaorg'

distance = 208
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 amusicalgeneratorv200288crackslomalkaorg'

distance = 208
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 actualdrawingv31keygenbyorioncrackslomalkaorg'

distance = 208
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 facemailv10bytsrhcrackslomalkaorg'

distance = 208
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 faqfactoryv10byeminencecrackslomalkaorg'

distance = 209
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 antitracksv303crackslomalkaorg'

distance = 209
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 familymailv81build1101052crackslomalkaorg'

distance = 209
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 fatmanadventuresv103crackslomalkaorg'

distance = 209
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 stylexpv306keygenbyexclipsecrackslomalkaorg'

distance = 210
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 fancymovieseditorprov40crackslomalkaorg'

distance = 210
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 asnavisualrpg31crackslomalkaorg'

distance = 223
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 fileshredder2000v33byevidencecrackslomalkaorg'

distance = 223
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 alawarancienttaxiv10crackslomalkaorg'

distance = 223
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 filestoexev10betacrackslomalkaorg'

distance = 224
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 apluspopupblockerv21crackslomalkaorg'

distance = 224
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 fsecureantivirusclientsecurityv554crackslomalkaorg'

distance = 224
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 farpointinputproedit3021crackslomalkaorg'

distance = 224
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 findgraphv12xcrackslomalkaorg'

distance = 225
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 findyourmp3v102035byevidencecrackslomalkaorg'

distance = 225
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 acdsystemscanvasv904crackslomalkaorg'

distance = 225
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 acehtmlprov5060bytmg1crackslomalkaorg'

distance = 236
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 aipictureexplorer10crackslomalkaorg'

distance = 236
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 animagicgifanimatorv1xcrackslomalkaorg'

distance = 236
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 filesharingfornetv150904byorioncrackslomalkaorg'

distance = 236
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 apluscalcv11crackslomalkaorg'

distance = 236
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 fatecengineeringfmatv10137crackslomalkaorg'

distance = 237
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 activemp3activexcontrol17crackslomalkaorg'

distance = 237
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 analysisknowledgesoftwarepatternsv337crackslomalkaorg'

distance = 237
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 airandspacescenicreflectionsscreensaverv10crackslomalkaorg'

distance = 238
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 activeskinocxv425crackslomalkaorg'

distance = 238
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 afterburn25bfor3dstudiomax4crackslomalkaorg'

distance = 254
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 abelssoftabnotev17acrackslomalkaorg'

distance = 254
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 absolutistillustrixbirddreamv10forpalmos5crackslomalkaorg'

distance = 255
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 alawarbacktoearthv11bypizzacrackslomalkaorg'

distance = 255
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 kasperskyantiviruspersonalprov5020keygenfilebyblackstarcrackslomalkaorg'

distance = 256
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 focusphotoeditorv305crackslomalkaorg'

distance = 256
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 activeskincontrolocxv42crackslomalkaorg'

distance = 256
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 actualtestscomsun310080examcheatsheetv120303crackslomalkaorg'

distance = 257
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 firstclassfollytairev90crackslomalkaorg'

distance = 257
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 fileshredder2000v33bytsrhcrackslomalkaorg'

distance = 257
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 argosoftftpserverv1209crackslomalkaorg'

distance = 280
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 flamingpearsolarcell120crackslomalkaorg'

distance = 281
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 activexgltextv110crackslomalkaorg'

distance = 281
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 airefreshener11byfhcfcrackslomalkaorg'

distance = 282
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 actualtestscomsun310301examcheatsheetv40904crackslomalkaorg'

distance = 282
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 fprotantivirusforwindowsv310crackslomalkaorg'

distance = 282
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 282
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 appletpasswordwizardv30byucccrackslomalkaorg'

distance = 282
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 privatedesktopv19bynatabeccrackslomalkaorg'

distance = 283
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 pacbomberv154bytsrhcrackslomalkaorg'

distance = 286
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 ecodermaildecoderv200003crackslomalkaorg'

distance = 364
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 aheadneroburningromv66015ultraeditionkeygenbyorionzcrackslomalkaorg'

distance = 380
spam score = 5
title = 'a170 axman axion v20 axis axysnake axialis v1 agogovideotoipodpsp3gpxboxppcpdamp4v336crackslomalkaorg'

distance = 385
spam score = 4
title = 'a170 axman axion v20 axis axysnake axialis v1 windowsxpsp1andsp2activationcrackbygffcrackslomalkaorg'

distance = 1368
spam score = 15
title = 'axialis axcdplayer v260 english crack axialisaxcdplayerv260englishcrackcrackslomalkaorg'

distance = 1389
spam score = 16
title = 'axialis axcdplayer v251 english axialisaxcdplayerv251englishcrackslomalkaorg'

distance = 1396
spam score = 16
title = 'axialis axjukebox 10 french axialisaxjukebox10frenchcrackslomalkaorg'

distance = 1398
spam score = 16
title = 'axialis axcdplayer v260 new axialisaxcdplayerv260newcrackslomalkaorg'

distance = 38
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d tmailv121crackslomalkaorg'

distance = 41
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d fx2000v30crackslomalkaorg'

distance = 44
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d adcsv111crackslomalkaorg'

distance = 59
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d antispyinfov10crackslomalkaorg'

distance = 62
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d emailsv220crackslomalkaorg'

distance = 64
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d tablev203crackslomalkaorg'

distance = 66
spam score = 9
title = 'd47 meter du build dual v302 copy dvd dubit d activerefreshv22622crackslomalkaorg'

distance = 70
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d tagandrenamev20crackslomalkaorg'

distance = 80
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d f22raptor1000500rcrackslomalkaorg'

distance = 81
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d pacboyv10crackslomalkaorg'

distance = 83
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d fsearchv14crackslomalkaorg'

distance = 83
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d flashbackv282crackslomalkaorg'

distance = 85
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d emailseekerv17newcrackslomalkaorg'

distance = 90
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d qsetv132022crackslomalkaorg'

distance = 92
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d fcutterv160keygencrackslomalkaorg'

distance = 93
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d fcutterv160serialcrackslomalkaorg'

distance = 95
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d archicadv65r3usacrackslomalkaorg'

distance = 96
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d autobanktoolv10crackslomalkaorg'

distance = 98
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d fonty98v2163crackslomalkaorg'

distance = 98
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d gaintsv10crackslomalkaorg'

distance = 160
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d appopener32v102crackslomalkaorg'

distance = 160
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d p2crocket11crackslomalkaorg'

distance = 161
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d achristmasatsantasv272crackslomalkaorg'

distance = 161
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d atomsbondingandstructure14crackslomalkaorg'

distance = 161
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d archiverexplorerv10crackslomalkaorg'

distance = 161
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d automaintenanceprov90professionalcrackslomalkaorg'

distance = 162
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d allcrypkeyprotectedsoftwarecrackslomalkaorg'

distance = 162
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d actualtitlebuttonsv14crackslomalkaorg'

distance = 162
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d alarmclock2001v20serialcrackslomalkaorg'

distance = 162
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d auriconacrackslomalkaorg'

distance = 178
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d albumplayerv212bydigeraticrackslomalkaorg'

distance = 179
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d asplightningv111crackslomalkaorg'

distance = 179
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d purchaseorderv131crackslomalkaorg'

distance = 179
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d accessmanagerv60serialbytportcrackslomalkaorg'

distance = 179
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d activefaxserverv387build194crackslomalkaorg'

distance = 179
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d activefaxserverv388build195crackslomalkaorg'

distance = 180
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d audioslimmerv117keygencrackslomalkaorg'

distance = 181
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d activeskinv4273crackslomalkaorg'

distance = 181
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d nod32allversionsfixedcrackslomalkaorg'

distance = 181
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d freshuiv6xcrackslomalkaorg'

distance = 197
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d alohabobpcrelocatorv4071crackslomalkaorg'

distance = 197
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d xballv25crackslomalkaorg'

distance = 197
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d activewhoisv212591crackslomalkaorg'

distance = 198
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d a1dvdaudioripperv1138crackslomalkaorg'

distance = 198
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d actxformanimatorv10vbcomponentcrackslomalkaorg'

distance = 198
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d tagandrenamev2174v30rc4crackslomalkaorg'

distance = 198
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d qawizardv1601310crackslomalkaorg'

distance = 198
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d apptoservicev24abytsrhcrackslomalkaorg'

distance = 199
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d activeoptimizercrackslomalkaorg'

distance = 199
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d xenforcerv10abyfhcfcrackslomalkaorg'

distance = 214
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d fsecureantivirusv4092220crackslomalkaorg'

distance = 214
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d powereditv212byacmecrackslomalkaorg'

distance = 214
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d familytreemakerv302crackslomalkaorg'

distance = 215
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d p7dp7crackslomalkaorg'

distance = 215
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d vip4musicv11crackslomalkaorg'

distance = 215
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d namov308crackslomalkaorg'

distance = 215
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d avvcsv3089crackslomalkaorg'

distance = 215
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d activeskincontrolv43crackslomalkaorg'

distance = 215
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d auctionmessengerv453crackslomalkaorg'

distance = 215
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d admuncherv452build9048crackslomalkaorg'

distance = 232
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d activepdfdocconverterv352crackslomalkaorg'

distance = 232
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d amigo2000bydbccrackslomalkaorg'

distance = 232
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d atomparkemailloggerv130crackslomalkaorg'

distance = 232
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d aplusfileprotectionv21crackslomalkaorg'

distance = 233
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d activeskinv41bycorecrackslomalkaorg'

distance = 233
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d puzzelmasterv1000201crackslomalkaorg'

distance = 233
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d activefaxserverv388build195germancrackslomalkaorg'

distance = 233
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d powerarchiver2004v90033byrifcrackslomalkaorg'

distance = 233
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d autoptionv40businesscrackslomalkaorg'

distance = 233
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d activexmanagerv13bypccrackslomalkaorg'

distance = 252
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d actualtestscomlotus190522examcheatsheetv121703crackslomalkaorg'

distance = 252
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d advancedtexttospeechv350crackslomalkaorg'

distance = 253
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d flashgetmaxsimjobsfuckercrackslomalkaorg'

distance = 253
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d airborneheroddayfrontline1944multilanguagecrackslomalkaorg'

distance = 253
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d purgeieprov15062crackslomalkaorg'

distance = 253
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d namowebeditorv602105trialcrackslomalkaorg'

distance = 253
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d atovsreaderv104crackslomalkaorg'

distance = 254
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d privateshellv151567crackslomalkaorg'

distance = 254
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d windowsxpproproductkeychangercrackslomalkaorg'

distance = 254
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d pacdoomv121bytntcrackslomalkaorg'

distance = 275
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d windowsxpsp2keygenbyffgcrackslomalkaorg'

distance = 275
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d puzzlebrainstormv12crackslomalkaorg'

distance = 275
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d advancedmp3soundrecorderv16crackslomalkaorg'

distance = 276
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d animallogicmaxmanv13andabovefor3dstudiomaxcrackslomalkaorg'

distance = 276
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d apracticalguidetoenterprisearchitectureebookcrackslomalkaorg'

distance = 276
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d windowsxpservicepack2byunknowncrackslomalkaorg'

distance = 277
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d glockadvancedadministrativetools400624crackslomalkaorg'

distance = 277
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d activeskincontrolocxv40bycucrackslomalkaorg'

distance = 278
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d amletov216forlightwavecrackslomalkaorg'

distance = 278
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 307
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d actualtestscomcisco646301examcheatsheetv042104crackslomalkaorg'

distance = 307
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d privatedesktopv19bynatabeccrackslomalkaorg'

distance = 307
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d namewizv31loaderbytcacrackslomalkaorg'

distance = 308
spam score = 6
title = 'd47 meter du build dual v302 copy dvd dubit d appletbuttonfactoryv51byeminencecrackslomalkaorg'

distance = 308
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d advancedregistrytracerv167sr2bylashcrackslomalkaorg'

distance = 308
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d powerageskysimulatorv20crackslomalkaorg'

distance = 308
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d aheaddvdripperstandardeditioncrackslomalkaorg'

distance = 310
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d purchaseorderv14r3crackslomalkaorg'

distance = 310
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d powerarchiver2002v80063polishcrackslomalkaorg'

distance = 310
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d emailsv225serialbyfffcrackslomalkaorg'

distance = 362
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d activexmanagerv14byevccrackslomalkaorg'

distance = 363
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d aspmakerv30build9crackcrackslomalkaorg'

distance = 373
spam score = 7
title = 'd47 meter du build dual v302 copy dvd dubit d fsecurevpnplusv550166winnt2kxpcrackslomalkaorg'

distance = 373
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d argosoftmailserverplusv1619patchbyeminencecrackslomalkaorg'

distance = 373
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d avizthoughtmapperv11forwin9xmentcrackslomalkaorg'

distance = 399
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d adobeincopycsv30tryoutmultilanguagebycimcrackslomalkaorg'

distance = 427
spam score = 8
title = 'd47 meter du build dual v302 copy dvd dubit d amiracleinathoughtscreenflashscreensavercrackslomalkaorg'

distance = 1325
spam score = 15
title = 'qcopy 2000 beta 5 build 250 qcopy2000beta5build250crackslomalkaorg'

distance = 1883
spam score = 46
title = 'provisional fish list'

distance = 33
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy r2extremeprov151crackslomalkaorg'

distance = 49
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy filesave2000crackslomalkaorg'

distance = 57
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy personalpro502crackslomalkaorg'

distance = 66
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy finditprov40crackslomalkaorg'

distance = 69
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy ancestralauthorv23icrackslomalkaorg'

distance = 69
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy finditnowv10crackslomalkaorg'

distance = 70
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy autopage25crackslomalkaorg'

distance = 77
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy eiconsv316crackslomalkaorg'

distance = 78
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy eiconsv415crackslomalkaorg'

distance = 78
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy fireworksv301crackslomalkaorg'

distance = 79
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy ppdforiev703crackslomalkaorg'

distance = 82
spam score = 7
title = 'c94 cyd explorer domain cybersquoter editor cy finemetronome2007v20crackslomalkaorg'

distance = 83
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy airmessengerprov40keygencrackslomalkaorg'

distance = 84
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy fcutterv152crackslomalkaorg'

distance = 85
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy halflifev1016crackslomalkaorg'

distance = 86
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy adwareawayv22crackslomalkaorg'

distance = 87
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy eborderclient20crackslomalkaorg'

distance = 91
spam score = 10
title = 'c94 cyd explorer domain cybersquoter editor cy activerefresh136build551crackslomalkaorg'

distance = 92
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy aspgrid30crackslomalkaorg'

distance = 92
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy gsoftencryptor2006v101crackslomalkaorg'

distance = 157
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy privateeyev12crackslomalkaorg'

distance = 157
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy aplusfileprotectionv2101crackslomalkaorg'

distance = 157
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy acehtmlprov50crackslomalkaorg'

distance = 158
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy halworks22crackslomalkaorg'

distance = 158
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy accesslockv13crackslomalkaorg'

distance = 158
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy accessmanagerv60keygenbytportcrackslomalkaorg'

distance = 159
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy animatedscreenv68byorioncrackslomalkaorg'

distance = 159
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy autoptionv40crackslomalkaorg'

distance = 160
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy alinkv102crackslomalkaorg'

distance = 160
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy facefilterv109252standardeditioncrackslomalkaorg'

distance = 177
spam score = 7
title = 'c94 cyd explorer domain cybersquoter editor cy fantasticwomenscreensaverv10crackslomalkaorg'

distance = 177
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy nod32crackslomalkaorg'

distance = 177
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy abcmonitor165crackslomalkaorg'

distance = 178
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy frapsv221crackslomalkaorg'

distance = 178
spam score = 10
title = 'c94 cyd explorer domain cybersquoter editor cy activerefreshv22622crackslomalkaorg'

distance = 178
spam score = 7
title = 'c94 cyd explorer domain cybersquoter editor cy fifa2004keygenbydeviancecrackslomalkaorg'

distance = 178
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy okprintwatchv241crackslomalkaorg'

distance = 178
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy fsecureantivirusv409crackslomalkaorg'

distance = 178
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy absolutesecurityprov39keygenbyfffcrackslomalkaorg'

distance = 178
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy aboxv11release100crackslomalkaorg'

distance = 191
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy obriseasygradeprov36crackslomalkaorg'

distance = 191
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy activewhoisv212583crackslomalkaorg'

distance = 192
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy activewhoisbrowserv202466byheritagecrackslomalkaorg'

distance = 192
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy anfxv421crackslomalkaorg'

distance = 192
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy antitrojanv55build377crackslomalkaorg'

distance = 193
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy editorial2v201crackslomalkaorg'

distance = 193
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy aprcalcv40111bypukecrackslomalkaorg'

distance = 194
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy kasperskyantiviruspersonalv50xcrackslomalkaorg'

distance = 194
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy advancedmp3wmarecorderv50byucfcrackslomalkaorg'

distance = 194
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy purchaseorderv131crackslomalkaorg'

distance = 209
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy awphelpv21patchcrackslomalkaorg'

distance = 209
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy asoundrecorderv25crackslomalkaorg'

distance = 209
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy animatedblackjackv20bypccrackslomalkaorg'

distance = 209
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy acdimagefoxv11crackslomalkaorg'

distance = 209
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy akoffguitarassistantv101byfffcrackslomalkaorg'

distance = 209
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy hamhelperv201keygencrackslomalkaorg'

distance = 210
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy activeprofile12crackslomalkaorg'

distance = 210
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy purchaseorderv12crackslomalkaorg'

distance = 210
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy aliveinterneteraserv1362crackslomalkaorg'

distance = 210
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy activexmanagerv14byphaze2002crackslomalkaorg'

distance = 222
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy filescannerprov15patchcrackslomalkaorg'

distance = 222
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy audiotoolsv350serialcrackslomalkaorg'

distance = 223
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy a1dvdaudioripperv1148crackslomalkaorg'

distance = 223
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy animatedscreenv61serialbydbccrackslomalkaorg'

distance = 223
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy v12dbeformacromediadirectorv33crackslomalkaorg'

distance = 223
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy pacbomberv154crackslomalkaorg'

distance = 223
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy ashampoomp3studiov1036ecrackslomalkaorg'

distance = 223
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy windows2003xpkeygencrackslomalkaorg'

distance = 224
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy fireburnerv221bytnocrackslomalkaorg'

distance = 224
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy autorunassistantv282crackslomalkaorg'

distance = 239
spam score = 10
title = 'c94 cyd explorer domain cybersquoter editor cy activerefreshv134build531crackslomalkaorg'

distance = 240
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy atomsyncv202bynitrouscrackslomalkaorg'

distance = 240
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy emailseekerv15crackslomalkaorg'

distance = 240
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy fprotantivirusforwindowsv310ccrackslomalkaorg'

distance = 240
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy alphatrisv230crackslomalkaorg'

distance = 240
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy addremoveplus2003v401620crackslomalkaorg'

distance = 241
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy appletpasswordwizardv30byserials2000crackslomalkaorg'

distance = 242
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy kasperskyantiviruspersonalv50xfixedcrackslomalkaorg'

distance = 243
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy activequerycrackslomalkaorg'

distance = 243
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy nameityourwayniyowv141bydigeraticrackslomalkaorg'

distance = 263
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy fprotantivirusv312bcrackslomalkaorg'

distance = 264
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy arealvalidatorv111serialbyfhcfcrackslomalkaorg'

distance = 264
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy activexmanagerv14bydbccrackslomalkaorg'

distance = 264
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy accessanimationv190bytmgcrackslomalkaorg'

distance = 265
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy activexmanagerv13byamokcrackslomalkaorg'

distance = 265
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy faxamaticva93201bydbccrackslomalkaorg'

distance = 265
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy rguard22build970crackslomalkaorg'

distance = 265
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy absolutefuturityimagegrabberv103crackslomalkaorg'

distance = 265
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy gforcewinamppluginv253crackslomalkaorg'

distance = 266
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy agprotect2411forvb5crackslomalkaorg'

distance = 294
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy animateddesktopv12crackslomalkaorg'

distance = 295
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy fatcatpokerv357crackslomalkaorg'

distance = 296
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy activesizerbydatadynamicscrackslomalkaorg'

distance = 297
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy powercardmakerv34byfffcrackslomalkaorg'

distance = 298
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy actualtestscomcisco640801examcheatsheetv101803crackslomalkaorg'

distance = 301
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy fifaworldcup2006unlockercrackslomalkaorg'

distance = 302
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy privatepixv200fixedcrackslomalkaorg'

distance = 302
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy actualtestscomibm000191examcheatsheetv101503crackslomalkaorg'

distance = 303
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy absoluteshieldinterneteraserprov325crackslomalkaorg'

distance = 303
spam score = 9
title = 'c94 cyd explorer domain cybersquoter editor cy airxonixv135bydbccrackslomalkaorg'

distance = 427
spam score = 8
title = 'c94 cyd explorer domain cybersquoter editor cy postworkquickiescriptspsp8vol2crackslomalkaorg'

distance = 1346
spam score = 13
title = 'amazing photo editor v56 amazingphotoeditorv56crackslomalkaorg'

distance = 1355
spam score = 14
title = 'amazing photo editor v55 amazingphotoeditorv55crackslomalkaorg'

distance = 1929
spam score = 15
title = 'composite index of early manitoba mennonite church registers'

distance = 33
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 amusicalgeneratorv30crackslomalkaorg'

distance = 40
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 adayinthelifev15crackslomalkaorg'

distance = 40
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 uwipev20crackslomalkaorg'

distance = 49
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 firstaid2000crackslomalkaorg'

distance = 53
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 alittlevietnamesev12crackslomalkaorg'

distance = 65
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 ftpnetdrive310crackslomalkaorg'

distance = 67
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 filepreviewv131crackslomalkaorg'

distance = 67
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 eplanpro30crackslomalkaorg'

distance = 68
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 arcpad501crackslomalkaorg'

distance = 70
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 tabrowserv20crackslomalkaorg'

distance = 71
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 g6utilitiesv162build1crackslomalkaorg'

distance = 72
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 f12001keygencrackslomalkaorg'

distance = 75
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 fairstarsrecorderv250byagaincrackslomalkaorg'

distance = 78
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 r4v1xcrackslomalkaorg'

distance = 78
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 abovebeyond2003crackslomalkaorg'

distance = 80
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 actualsearchandreplacev237crackslomalkaorg'

distance = 81
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 babylonpro5crackslomalkaorg'

distance = 82
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 a1websitedownloadv100crackslomalkaorg'

distance = 82
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 eiconsv343crackcrackslomalkaorg'

distance = 85
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 r2v504ecrackslomalkaorg'

distance = 153
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 activewhoisv212591crackslomalkaorg'

distance = 153
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 angelfish4democrackslomalkaorg'

distance = 154
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 activemp3activexcontrol17crackslomalkaorg'

distance = 154
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 avantpager32v40crackslomalkaorg'

distance = 154
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 advancedmp3converterv220serialcrackslomalkaorg'

distance = 154
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 aistxsearch275crackslomalkaorg'

distance = 155
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 filetimev20crackslomalkaorg'

distance = 155
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 aheadneromixv14025crackslomalkaorg'

distance = 156
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 activewebcamv50crackslomalkaorg'

distance = 156
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 emailsv222crackslomalkaorg'

distance = 175
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 albumgeneratorandviewerv22crackslomalkaorg'

distance = 175
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 uwipev10betacrackslomalkaorg'

distance = 175
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 actualdrawingv53crackslomalkaorg'

distance = 175
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 p2psharespyv10crackslomalkaorg'

distance = 176
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 agdigitalactivex486crackslomalkaorg'

distance = 176
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 autowipev21crackslomalkaorg'

distance = 176
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 aheadsippsv204624crackslomalkaorg'

distance = 176
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 appointmentbooknetworkv365crackslomalkaorg'

distance = 176
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 adobetypemanagerdeluxev41crackslomalkaorg'

distance = 177
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 achristmasatsantasv29byfffcrackslomalkaorg'

distance = 193
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 fsecureantivirusv552crackslomalkaorg'

distance = 193
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 activewhoisbrowserv202466byheritagecrackslomalkaorg'

distance = 193
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 activeskincontrolocxv40crackslomalkaorg'

distance = 194
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 akinsoftallproductscrackslomalkaorg'

distance = 194
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 freshuiv700crackslomalkaorg'

distance = 194
spam score = 10
title = 'w27 win winace archiver winace win2pdf 211 2 activerefresh136build551crackslomalkaorg'

distance = 194
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 alleditorv242crackslomalkaorg'

distance = 195
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 aftercamv24crackslomalkaorg'

distance = 195
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 alawarbacktoearthv10byexplosioncrackslomalkaorg'

distance = 195
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 arielfaktura2000v277crackslomalkaorg'

distance = 210
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 adcsv105byelilacrackslomalkaorg'

distance = 211
spam score = 7
title = 'w27 win winace archiver winace win2pdf 211 2 powervideoconverterv138bycafecrackslomalkaorg'

distance = 211
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 powerdefragv301crackslomalkaorg'

distance = 211
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 aspmagicregistrycrackslomalkaorg'

distance = 211
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 alldayv65crackslomalkaorg'

distance = 211
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 fortressv212byrevengecrackslomalkaorg'

distance = 211
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 fireburnerv106bytntcrackslomalkaorg'

distance = 212
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 advancedmp3wmarecorderv39byucfcrackslomalkaorg'

distance = 212
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 folderguardprov55byunknowncrackslomalkaorg'

distance = 213
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 attributemagicprov21beta7crackslomalkaorg'

distance = 226
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 adayinthelifev13byemcrackslomalkaorg'

distance = 227
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 adventnetmanageenginejmxstudiov511crackslomalkaorg'

distance = 227
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 vandykecrtv409460crackslomalkaorg'

distance = 227
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 gadugaduv491crackslomalkaorg'

distance = 227
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 argosoftmailserverprov1618crackslomalkaorg'

distance = 228
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 228
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 alltagstagebuch200108crackslomalkaorg'

distance = 228
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 aplusfilenamingsystemv110crackslomalkaorg'

distance = 228
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 absolutemp3splitterandconverterv2212crackslomalkaorg'

distance = 228
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 windowsxphomeeditioncrackslomalkaorg'

distance = 246
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 friendlypingerv36bytsrhcrackslomalkaorg'

distance = 246
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 protoformprojectsvictoryv23crackslomalkaorg'

distance = 246
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 activesizerbydatadynamicscrackslomalkaorg'

distance = 246
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 airmessengerlitev193crackslomalkaorg'

distance = 246
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 valesoftwareaudiostudiov21crackslomalkaorg'

distance = 246
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 fprotantivirusforwindowsv309acrackslomalkaorg'

distance = 246
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 folderlockv5crackslomalkaorg'

distance = 246
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 flashfxpv3build1015crackslomalkaorg'

distance = 246
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 accessreporternetforiisv634crackslomalkaorg'

distance = 247
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 privateeyev20crackslomalkaorg'

distance = 265
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 powerwmarecorderv122crackslomalkaorg'

distance = 265
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 arealvalidatorv111byucfcrackslomalkaorg'

distance = 266
spam score = 7
title = 'w27 win winace archiver winace win2pdf 211 2 aipictureexplorerv5503001crackslomalkaorg'

distance = 266
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 akoffguitarassistantv101serialbyamokcrackslomalkaorg'

distance = 266
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 gallerymakerpro15crackslomalkaorg'

distance = 267
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 spywaredoctorv300288crackslomalkaorg'

distance = 268
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 rstudiofatv20crackslomalkaorg'

distance = 268
spam score = 7
title = 'w27 win winace archiver winace win2pdf 211 2 postersoftpublishitprov30icrackslomalkaorg'

distance = 268
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 autopilotv130build731keygenbyamokcrackslomalkaorg'

distance = 268
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 nortonantivirus2005completefixedcrackslomalkaorg'

distance = 292
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 antihackerandtrojanexpertv200314crackslomalkaorg'

distance = 292
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 namowebeditorv50147crackslomalkaorg'

distance = 292
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 avimpegrmwmvjoinerv448crackslomalkaorg'

distance = 292
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 fsecurevpnplusv550166winnt2kxpcrackslomalkaorg'

distance = 293
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 akoffmusiccomposerv20keygenbytmgcrackslomalkaorg'

distance = 294
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 polyviewv355regfilecrackslomalkaorg'

distance = 294
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 actuateereportdesignerprofessionalv80crackslomalkaorg'

distance = 295
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 formhelpv32forbcb4crackslomalkaorg'

distance = 296
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 uleadvideostudiov900100englishtbybtofullcrackbybidjancrackslomalkaorg'

distance = 296
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 rwipeclean50build1167crackslomalkaorg'

distance = 374
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 windowsxpallandwindows2003serverallactivatecrackcrackslomalkaorg'

distance = 378
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 pacsoftwarenetworkconsolev30crackslomalkaorg'

distance = 378
spam score = 9
title = 'w27 win winace archiver winace win2pdf 211 2 appliedflowtechnologyaftimpulsev3020030818winalldonglecrackedcrackslomalkaorg'

distance = 390
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 algolabrastertovectorconversiontoolkitv277byfreifall7crackslomalkaorg'

distance = 417
spam score = 8
title = 'w27 win winace archiver winace win2pdf 211 2 acousticamp3towaveconverterplusv2341byrevengecrackslomalkaorg'

distance = 1287
spam score = 15
title = 'rwin 2000 keyboard switch v601021 rwin2000keyboardswitchv601021crackslomalkaorg'

distance = 1325
spam score = 15
title = 'rwin 2000 keyboard switch v6001119 rwin2000keyboardswitchv6001119crackslomalkaorg'

distance = 1325
spam score = 14
title = 'rwin 2000 keyboard switch 6001119 rwin2000keyboardswitch6001119crackslomalkaorg'

distance = 1825
spam score = 78
title = 'lions clubs district 102'

distance = 22
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst ottrack280crackslomalkaorg'

distance = 30
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst a1monitorv410crackslomalkaorg'

distance = 36
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst g6renamer2000v14keygencrackslomalkaorg'

distance = 38
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst gabrielv19crackslomalkaorg'

distance = 38
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst ntrackstudiov30crackslomalkaorg'

distance = 39
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst kmlv38250crackslomalkaorg'

distance = 41
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst r2vv55crackslomalkaorg'

distance = 44
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst angelart12crackslomalkaorg'

distance = 48
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst vampv1210crackslomalkaorg'

distance = 49
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst raalchemyv102crackslomalkaorg'

distance = 50
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst nkoderv2000crackslomalkaorg'

distance = 50
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst h264webcamv162crackslomalkaorg'

distance = 51
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst kmlv313308crackslomalkaorg'

distance = 52
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst adronv20crackslomalkaorg'

distance = 54
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst bpuzzlev60crackslomalkaorg'

distance = 55
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst babynamesv101crackslomalkaorg'

distance = 57
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst altoblockallv551207crackslomalkaorg'

distance = 58
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst vcomsystemcommanderv705crackslomalkaorg'

distance = 60
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst r2v504ecrackslomalkaorg'

distance = 61
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst r4v108crackslomalkaorg'

distance = 153
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst rwin2000keyboardswitch6001119crackslomalkaorg'

distance = 153
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst gaeawinsievev112crackslomalkaorg'

distance = 153
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst fsecureantivirusv531crackslomalkaorg'

distance = 153
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst pacbomber16crackslomalkaorg'

distance = 153
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst tabitv158crackslomalkaorg'

distance = 153
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst finditcal14crackslomalkaorg'

distance = 153
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst alwaysonlinev10crackslomalkaorg'

distance = 153
spam score = 11
title = 'x1 x ripper dvd video joiner ball audio netst finemetronome2007v20crackslomalkaorg'

distance = 153
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst qsetv132022crackslomalkaorg'

distance = 154
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst anfyv145crackslomalkaorg'

distance = 172
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst namov505crackslomalkaorg'

distance = 172
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst aflowv350crackslomalkaorg'

distance = 172
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst uberweisnungsdrucker99v10germancrackslomalkaorg'

distance = 172
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst nameityourwayniyowv140crackslomalkaorg'

distance = 172
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst abilityoffice2000v20005crackslomalkaorg'

distance = 172
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst adobephotoshopv70fullretailcrackslomalkaorg'

distance = 172
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst ataniv393crackslomalkaorg'

distance = 172
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst uwipev27crackslomalkaorg'

distance = 172
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst activesearcherv12crackslomalkaorg'

distance = 172
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst abcbackupv31crackslomalkaorg'

distance = 191
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst freenetimporterv208crackslomalkaorg'

distance = 191
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst abhotkeysv3213crackslomalkaorg'

distance = 191
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst odbcviewerlite20crackslomalkaorg'

distance = 191
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst autowebviewscreensaverv10newcrackslomalkaorg'

distance = 191
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst atscreenthiefv361crackslomalkaorg'

distance = 191
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst alteros3dv21build2101byrp2kcrackslomalkaorg'

distance = 191
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst adobestreamlinecrackslomalkaorg'

distance = 191
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst galacticpatrolv160crackslomalkaorg'

distance = 191
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst adobeaftereffectsv50fullbyheavymetalcrackslomalkaorg'

distance = 191
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst h2omarker13crackslomalkaorg'

distance = 208
spam score = 11
title = 'x1 x ripper dvd video joiner ball audio netst amazingphotoeditorv55crackslomalkaorg'

distance = 208
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst objectbarv16build628crackslomalkaorg'

distance = 209
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst activefilerecoveryv20byheritagecrackslomalkaorg'

distance = 209
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst anachranoxv101crackslomalkaorg'

distance = 209
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst hackerv20byrhfactorcrackslomalkaorg'

distance = 209
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst oceanlifescreensaverv11crackslomalkaorg'

distance = 209
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst awiconsv232crackslomalkaorg'

distance = 209
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst awiconsv850bysccrackslomalkaorg'

distance = 209
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst namewizv31loaderbytcacrackslomalkaorg'

distance = 209
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst a1dvdaudioripperv1131crackslomalkaorg'

distance = 225
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst accusetclocktoolv50bproeditioncrackslomalkaorg'

distance = 225
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst fsecuresshclientv51crackslomalkaorg'

distance = 225
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst tagandrenamev20build2crackslomalkaorg'

distance = 225
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst ativaprov305byfhcfcrackslomalkaorg'

distance = 225
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst adobephotoshopv701updatecrackslomalkaorg'

distance = 225
spam score = 11
title = 'x1 x ripper dvd video joiner ball audio netst appletheadlinefactory4crackslomalkaorg'

distance = 225
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst alwaysontimev10112crackslomalkaorg'

distance = 225
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst alteros3dv21bytsrhcrackslomalkaorg'

distance = 225
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst anagrammilahnav111serialcrackslomalkaorg'

distance = 225
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst analogxscratchv10crackslomalkaorg'

distance = 241
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst aurorix2chaoticnoisev20crackslomalkaorg'

distance = 241
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst objectrescueprov41151crackslomalkaorg'

distance = 241
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst animagicgifanimatorv110acrackslomalkaorg'

distance = 241
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst xexev12russiancrackslomalkaorg'

distance = 241
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst activescreensaverkrackasskv201crackslomalkaorg'

distance = 242
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst protectxprofessionaleditionv403crackslomalkaorg'

distance = 242
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst awiconsv850bylashcrackslomalkaorg'

distance = 242
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst pacestarumldiagrammerv4121760retailcrackslomalkaorg'

distance = 242
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst advancedsecuritylevelv53bydbzcrackslomalkaorg'

distance = 242
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst octimaxv15100winampv2xplugincrackslomalkaorg'

distance = 262
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst xcomserverv25097crackslomalkaorg'

distance = 263
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst altomp3makerv220bytntcrackslomalkaorg'

distance = 263
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst awinsystemcleanerv115bycphvcrackslomalkaorg'

distance = 263
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst activescreensaverkrackasskv200crackslomalkaorg'

distance = 263
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst acloonvideoviewerv25crackslomalkaorg'

distance = 263
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst acidwavv24crackslomalkaorg'

distance = 263
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst gadugaduv489crackslomalkaorg'

distance = 263
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst khawksurvivalinstinctcheatscrackslomalkaorg'

distance = 263
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst namowebboardsuitev10810trialgermancrackslomalkaorg'

distance = 263
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst axialisaxviewer35003frenchcrackslomalkaorg'

distance = 295
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst pacdoomdangerousadventuresv121crackslomalkaorg'

distance = 295
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst atomicclockservicev15bydustcrackslomalkaorg'

distance = 296
spam score = 14
title = 'x1 x ripper dvd video joiner ball audio netst adobephotoshopv80cscreativesuitekeygencrackslomalkaorg'

distance = 296
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst atelierwebremotecommanderawrcv47crackslomalkaorg'

distance = 297
spam score = 13
title = 'x1 x ripper dvd video joiner ball audio netst activescreensaverdeveloperkitv20bynctcrackslomalkaorg'

distance = 297
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst advancedsmtpserverv24bymadmanherculescrackslomalkaorg'

distance = 297
spam score = 11
title = 'x1 x ripper dvd video joiner ball audio netst appletbuttonfactoryv51byucccrackslomalkaorg'

distance = 297
spam score = 12
title = 'x1 x ripper dvd video joiner ball audio netst advancedoffice2000passwordrecoverystandardcrackslomalkaorg'

distance = 297
spam score = 14
title = 'x1 x ripper dvd video joiner ball audio netst adobecreativesuite7crackslomalkaorg'

distance = 298
spam score = 11
title = 'x1 x ripper dvd video joiner ball audio netst appletcooltextwizardv10patchcrackslomalkaorg'

distance = 1859
spam score = 34
title = ''

distance = 1879
spam score = 17
title = ''

distance = 1887
spam score = 9
title = 'open directory world portugus desportos'

distance = 1897
spam score = 21
title = ''

distance = 1899
spam score = 48
title = 'rowing world best times'

distance = 5
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos f12001keygencrackslomalkaorg'

distance = 34
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos almanacv10crackslomalkaorg'

distance = 45
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos halocrackslomalkaorg'

distance = 47
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos f22raptor1002100rcrackslomalkaorg'

distance = 65
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos falbumv101crackslomalkaorg'

distance = 68
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos agentv20byrorcrackslomalkaorg'

distance = 73
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos pacecalc112crackslomalkaorg'

distance = 76
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activetaskv10crackslomalkaorg'

distance = 77
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos autumnleavesv10crackslomalkaorg'

distance = 78
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos accesstosystem30crackslomalkaorg'

distance = 79
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos fortknox2059crackslomalkaorg'

distance = 79
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos fishv333431crackslomalkaorg'

distance = 79
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos abcpix2131crackslomalkaorg'

distance = 81
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos eiconsv325crackslomalkaorg'

distance = 84
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos accessimagev23newcrackslomalkaorg'

distance = 84
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos ebook12crackslomalkaorg'

distance = 85
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos galaxyspyprov106crackslomalkaorg'

distance = 86
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos arialsoundrecorderv121crackslomalkaorg'

distance = 87
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos atomtime98v22crackslomalkaorg'

distance = 88
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos freshdownloadv712crackslomalkaorg'

distance = 163
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos fcutterv152crackslomalkaorg'

distance = 164
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos flashfxpv22968betacrackslomalkaorg'

distance = 164
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos tracksplugincrackslomalkaorg'

distance = 164
spam score = 4
title = 'p38 photo for phonepad phonewatch album palmos activerefresh136build551crackslomalkaorg'

distance = 164
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activexmanagerv14crackslomalkaorg'

distance = 165
spam score = 4
title = 'p38 photo for phonepad phonewatch album palmos absolutemp3splitter2218crackslomalkaorg'

distance = 165
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos foratomicsynchronizationv10005crackslomalkaorg'

distance = 165
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos avemariapokerv20crackslomalkaorg'

distance = 165
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activestatekomodoprofessionalv25178606crackslomalkaorg'

distance = 166
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos ahaviewv204build17mar2003crackslomalkaorg'

distance = 180
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activefaxserverv388build195germancrackslomalkaorg'

distance = 180
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos nortonantivirus2005completecrackslomalkaorg'

distance = 180
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos aisaliveproxyv454439crackslomalkaorg'

distance = 180
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activefaxv385build0192crackslomalkaorg'

distance = 180
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos fileandfolderprivacyv26crackslomalkaorg'

distance = 181
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos ashampoomailvirusblockerv101crackslomalkaorg'

distance = 181
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos affirmativeactiondunv211crackslomalkaorg'

distance = 181
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos powereditv203crackslomalkaorg'

distance = 181
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos atomsyncv105crackslomalkaorg'

distance = 182
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos audiotesterv14ecrackslomalkaorg'

distance = 200
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos filebackupwatcherv125russiancrackslomalkaorg'

distance = 201
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activewhoisv202466crackslomalkaorg'

distance = 201
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos purgeiev40417022002crackslomalkaorg'

distance = 201
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos gaeb2000iocrackslomalkaorg'

distance = 201
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos fprotantivirusforwindowsv307crackslomalkaorg'

distance = 201
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos addressfinderv961byfallencrackslomalkaorg'

distance = 201
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos editorial2v201crackslomalkaorg'

distance = 201
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos eiconsv334crackslomalkaorg'

distance = 202
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos formadventerprisev45crackslomalkaorg'

distance = 202
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos fifa2005byrevelationcrackslomalkaorg'

distance = 215
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos accessmanagerforwindowsv601crackslomalkaorg'

distance = 216
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos associativelogviewv10crackslomalkaorg'

distance = 216
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos powerarchiver2001v70026bycorecrackslomalkaorg'

distance = 216
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos galaxyrebellionv141germanallaccesscheatcrackslomalkaorg'

distance = 216
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos powerarchiver2002v80048rc2newcrackslomalkaorg'

distance = 216
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos adobephotoshopcs2keygenbyparodoxcrackslomalkaorg'

distance = 216
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activexmanagerv14byfhcfcrackslomalkaorg'

distance = 216
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos eiconsv343patchcrackslomalkaorg'

distance = 216
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos ecampaigncorporateeditionv488crackslomalkaorg'

distance = 216
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos amazinspispopdv14byamokcrackslomalkaorg'

distance = 230
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos proximusdvd2mpegv18crackslomalkaorg'

distance = 230
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos posterdownloadercrackslomalkaorg'

distance = 230
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos fontslist10crackslomalkaorg'

distance = 231
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos acqurlv40crackslomalkaorg'

distance = 231
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos archivershellv60by404crackslomalkaorg'

distance = 231
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos galacticpatrolv166bydisruptioncrackslomalkaorg'

distance = 231
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos pi2004editionsr1v8060014crackslomalkaorg'

distance = 232
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activeskincontrolocxv30crackslomalkaorg'

distance = 232
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos ecapturerv206crackslomalkaorg'

distance = 232
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos punthoprofessionalv30bynotroncrackslomalkaorg'

distance = 246
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos advancedmp3converterv210bytsrhcrackslomalkaorg'

distance = 246
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos fileshredder2000v31bylashcrackslomalkaorg'

distance = 247
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos akoffmusiccomposerv20serialbylashcrackslomalkaorg'

distance = 247
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos powervideoconverterv139crackslomalkaorg'

distance = 247
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos agendamsdv210spanishcrackslomalkaorg'

distance = 249
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos windows2003andwindowsxpsp2antiproductactivationcrackv12crackslomalkaorg'

distance = 250
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos affirmativeactionpreprof103crackslomalkaorg'

distance = 250
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos editorebookcompilerv25crackslomalkaorg'

distance = 250
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos assistbar99v23crackslomalkaorg'

distance = 250
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos postmaster134crackslomalkaorg'

distance = 267
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos av4custombackupandrestorev102crackslomalkaorg'

distance = 267
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos addremoveplus2002v30bydbccrackslomalkaorg'

distance = 268
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos kasperskyantiviruspersonalv50227keygenfilecrackslomalkaorg'

distance = 268
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos ashampoomp3studiodeluxev1036ecrackslomalkaorg'

distance = 268
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos privatebookmarksv32bytexcrackslomalkaorg'

distance = 268
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos privacyeraserv350bycimcrackslomalkaorg'

distance = 269
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos adayinthelifev13byc0nspiracycrackslomalkaorg'

distance = 269
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos akoffguitarassistantv101keygenbytnocrackslomalkaorg'

distance = 269
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos acedvdbackupv1xgenericcrackslomalkaorg'

distance = 269
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos powerdefragv200litecrackslomalkaorg'

distance = 290
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos polyphonykeyboardmanagerdeluxenetworkv26crackslomalkaorg'

distance = 290
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos arealvalidatorv111serialbyamokcrackslomalkaorg'

distance = 290
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos vacationrentaltrackerplusv123crackslomalkaorg'

distance = 291
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activestatetcldevkitv261crackslomalkaorg'

distance = 291
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activeskincontrolocxv40crackslomalkaorg'

distance = 293
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos atrisehtmlockv180byl1nkteamcrackslomalkaorg'

distance = 293
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos fishsoftmosaicsaverv10crackslomalkaorg'

distance = 293
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos absolutetelnetclient184crackslomalkaorg'

distance = 293
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos activeskinocxv43patchbydceptioncrackslomalkaorg'

distance = 294
spam score = 3
title = 'p38 photo for phonepad phonewatch album palmos acronismigrateeasyv60bydatacompboycrackslomalkaorg'

distance = 1804
spam score = 24
title = 'sim racing hall of fame'

distance = 26
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp rguard22b962crackslomalkaorg'

distance = 36
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp fast10crackslomalkaorg'

distance = 57
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp alp19ecrackslomalkaorg'

distance = 59
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp ascv30crackslomalkaorg'

distance = 59
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp adayinthelifev15crackcrackslomalkaorg'

distance = 63
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp r2v507hcrackslomalkaorg'

distance = 66
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp firemagicv12crackslomalkaorg'

distance = 69
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp ecampaigncorporateeditionv4811crackslomalkaorg'

distance = 70
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp fsecureantivirusv54xcrackslomalkaorg'

distance = 74
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp favoripper30crackslomalkaorg'

distance = 74
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp anziolitev120wcrackslomalkaorg'

distance = 75
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp folderlockv5crackslomalkaorg'

distance = 77
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp filescavengerv140ccrackslomalkaorg'

distance = 84
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp frigatev301658crackslomalkaorg'

distance = 87
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp filesecurerv354crackslomalkaorg'

distance = 88
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp epop203123crackslomalkaorg'

distance = 88
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp findv261crackslomalkaorg'

distance = 89
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp ancestralauthorv20bcrackslomalkaorg'

distance = 90
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp posterv76d06022002crackslomalkaorg'

distance = 94
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp arealvalidatorv111keygencrackslomalkaorg'

distance = 160
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp namebase30crackslomalkaorg'

distance = 160
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp filesecurerv360crackslomalkaorg'

distance = 161
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp advent2000v103crackslomalkaorg'

distance = 161
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp folderindexerv146crackslomalkaorg'

distance = 161
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp uberweisnungsdrucker99v10germancrackslomalkaorg'

distance = 161
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp abcpixv21bytmgcrackslomalkaorg'

distance = 162
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp activestateperldevkitv411crackslomalkaorg'

distance = 162
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp airmessengersnppv31crackslomalkaorg'

distance = 162
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp advancedmp3wmarecorderv371crackslomalkaorg'

distance = 162
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp avvcsv3089crackslomalkaorg'

distance = 177
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp fileshredder29serialbyfhcfcrackslomalkaorg'

distance = 178
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp frendv471germancrackslomalkaorg'

distance = 178
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp autosyncv16crackslomalkaorg'

distance = 178
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp arealvalidatorv101crackslomalkaorg'

distance = 178
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp fsecuresshclientv51crackslomalkaorg'

distance = 179
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp freshuiv620byimscrackslomalkaorg'

distance = 179
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp aboveblackbook10crackslomalkaorg'

distance = 179
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp purchaseorderv12crackslomalkaorg'

distance = 179
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp filescannerprov16001bytntcrackslomalkaorg'

distance = 179
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp activexmanagerv14byamokcrackslomalkaorg'

distance = 193
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp emailsv225keygenbyfffcrackslomalkaorg'

distance = 194
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp flashfxpv302build1044sceneeditioncrackslomalkaorg'

distance = 194
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp activefaxv385build0192crackslomalkaorg'

distance = 194
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp arobfantasticmp3encoderv13bycorecrackslomalkaorg'

distance = 194
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp activexmanagerv14bydbccrackslomalkaorg'

distance = 194
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp advancedregistryspyv17byevidencecrackslomalkaorg'

distance = 194
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp p2cpluspascalcompilerv2001ecrackslomalkaorg'

distance = 194
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp powerarchiver2003v86002bytnocrackslomalkaorg'

distance = 195
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp halocecrackslomalkaorg'

distance = 195
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp adressverwaltungv2002140crackslomalkaorg'

distance = 212
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp privatedesktopv16byeminencecrackslomalkaorg'

distance = 212
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp ecampaignprofessionaleditionv2944bynitrouscrackslomalkaorg'

distance = 212
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp activestatetcldevkitv261crackslomalkaorg'

distance = 212
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp argosoftmailserverplusv1600keygencrackslomalkaorg'

distance = 212
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp agent2000v10crackslomalkaorg'

distance = 213
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp fastmenuv105bydbccrackslomalkaorg'

distance = 213
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp advancedtaskmanager2002v22englishcrackslomalkaorg'

distance = 213
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp privatepixv200fixedcrackslomalkaorg'

distance = 213
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp powercardmakerv344crackslomalkaorg'

distance = 213
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp proverbsscreensaverv60crackslomalkaorg'

distance = 224
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp nabocorpcam2pcv443crackslomalkaorg'

distance = 225
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp privacyshredderv30crackslomalkaorg'

distance = 225
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp favoaudioconverterv50byfffcrackslomalkaorg'

distance = 225
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp animatedgifeditor95v12crackslomalkaorg'

distance = 225
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp microsoftoffice2003genericcrackcrackslomalkaorg'

distance = 225
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp findflashv15byc0nspiracycrackslomalkaorg'

distance = 225
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp abyssmediamp3towavconverterv271crackslomalkaorg'

distance = 225
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp raastrobaticsv102crackslomalkaorg'

distance = 226
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp emailextractorexpressv21byorioncrackslomalkaorg'

distance = 226
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp emailalertv1019byimscrackslomalkaorg'

distance = 243
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp activewhoisv202466crackslomalkaorg'

distance = 243
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp powerdeskexplorerv303crackslomalkaorg'

distance = 243
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp pacficyeilddamageidv10crackslomalkaorg'

distance = 243
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp postguardv32multilannguagecrackslomalkaorg'

distance = 243
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp animgolfballsscreensaver20crackslomalkaorg'

distance = 244
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp powerdefragv301bychrapekcrackslomalkaorg'

distance = 244
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp privatebookmarksv33crackslomalkaorg'

distance = 244
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp powerarchiver2003v88004crackslomalkaorg'

distance = 244
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp agentcyse10crackslomalkaorg'

distance = 244
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp aspodbcwebwizardv20crackslomalkaorg'

distance = 262
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp asmweraserprov20197crackslomalkaorg'

distance = 263
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp pacdoomdangerousadventuresv121byamokcrackslomalkaorg'

distance = 264
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp eiconsv343patchcrackslomalkaorg'

distance = 264
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp fabsoftreformenterprisev9003crackslomalkaorg'

distance = 264
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp antihackerandtrojanexpertv200316bydynamitecrackslomalkaorg'

distance = 264
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 265
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp purchaseorderv131crackslomalkaorg'

distance = 265
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp av4customermanagementsystemprov5680crackslomalkaorg'

distance = 265
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp privatedesktopv19bynatabeccrackslomalkaorg'

distance = 265
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp atlasducielv70crackslomalkaorg'

distance = 293
spam score = 6
title = 'b38 br bps photoarchiver remover adware pro sp activerefreshv22622crackslomalkaorg'

distance = 293
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp powerarchiver2001v702malaysiancrackslomalkaorg'

distance = 294
spam score = 6
title = 'b38 br bps photoarchiver remover adware pro sp actualtestscommicrosoft070340examqandav091404crackslomalkaorg'

distance = 294
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp airtrekcalnotesv312crackslomalkaorg'

distance = 294
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp actualtestscomcisco156510examcheatsheetv90804crackslomalkaorg'

distance = 295
spam score = 4
title = 'b38 br bps photoarchiver remover adware pro sp finalrecoveryv13crackslomalkaorg'

distance = 295
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp appletnavigationfactoryv20bytexcrackslomalkaorg'

distance = 295
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp windowsxpservicepack2activatorcrackbyhjcrackslomalkaorg'

distance = 296
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp absolutedelete2003v10crackslomalkaorg'

distance = 296
spam score = 5
title = 'b38 br bps photoarchiver remover adware pro sp arcsoftphotostudio2000v41byrp2kcrackslomalkaorg'

distance = 54
spam score = 13
title = 'l10 link build linkdissolver links linkfox org ageofsails2v100crackslomalkaorg'

distance = 58
spam score = 13
title = 'l10 link build linkdissolver links linkfox org amichartv150crackslomalkaorg'

distance = 60
spam score = 13
title = 'l10 link build linkdissolver links linkfox org eplanpro30crackslomalkaorg'

distance = 63
spam score = 12
title = 'l10 link build linkdissolver links linkfox org footballv211crackslomalkaorg'

distance = 63
spam score = 12
title = 'l10 link build linkdissolver links linkfox org halloweenv28crackslomalkaorg'

distance = 68
spam score = 13
title = 'l10 link build linkdissolver links linkfox org tabmailv12810crackslomalkaorg'

distance = 71
spam score = 13
title = 'l10 link build linkdissolver links linkfox org adayinthelifev15crackcrackslomalkaorg'

distance = 74
spam score = 13
title = 'l10 link build linkdissolver links linkfox org eiconsv343keygencrackslomalkaorg'

distance = 75
spam score = 13
title = 'l10 link build linkdissolver links linkfox org finditv107crackslomalkaorg'

distance = 75
spam score = 13
title = 'l10 link build linkdissolver links linkfox org serialslomalkaorg'

distance = 80
spam score = 13
title = 'l10 link build linkdissolver links linkfox org oasisprov1300crackslomalkaorg'

distance = 80
spam score = 13
title = 'l10 link build linkdissolver links linkfox org familyarchiveprov1201crackslomalkaorg'

distance = 81
spam score = 13
title = 'l10 link build linkdissolver links linkfox org packit14crackslomalkaorg'

distance = 83
spam score = 13
title = 'l10 link build linkdissolver links linkfox org accessmanager4xcrackslomalkaorg'

distance = 84
spam score = 13
title = 'l10 link build linkdissolver links linkfox org activesearcherv12crackslomalkaorg'

distance = 85
spam score = 13
title = 'l10 link build linkdissolver links linkfox org ebook12crackslomalkaorg'

distance = 85
spam score = 13
title = 'l10 link build linkdissolver links linkfox org adailybackupv350crackslomalkaorg'

distance = 86
spam score = 13
title = 'l10 link build linkdissolver links linkfox org achristmasatsantasv272crackslomalkaorg'

distance = 87
spam score = 13
title = 'l10 link build linkdissolver links linkfox org pcad2002crackslomalkaorg'

distance = 87
spam score = 13
title = 'l10 link build linkdissolver links linkfox org activeskinv41crackslomalkaorg'

distance = 147
spam score = 13
title = 'l10 link build linkdissolver links linkfox org amichartv1456bytsrhcrackslomalkaorg'

distance = 147
spam score = 13
title = 'l10 link build linkdissolver links linkfox org atropossb20030909crackslomalkaorg'

distance = 147
spam score = 12
title = 'l10 link build linkdissolver links linkfox org f22raptor1000500rcrackslomalkaorg'

distance = 147
spam score = 13
title = 'l10 link build linkdissolver links linkfox org emanagerv35b08crackslomalkaorg'

distance = 148
spam score = 13
title = 'l10 link build linkdissolver links linkfox org aspenv10crackslomalkaorg'

distance = 148
spam score = 13
title = 'l10 link build linkdissolver links linkfox org asplightningv111crackslomalkaorg'

distance = 148
spam score = 13
title = 'l10 link build linkdissolver links linkfox org arealvalidatorv111byfhcfcrackslomalkaorg'

distance = 149
spam score = 12
title = 'l10 link build linkdissolver links linkfox org qimage1102crackslomalkaorg'

distance = 149
spam score = 13
title = 'l10 link build linkdissolver links linkfox org accessimagev321crackslomalkaorg'

distance = 149
spam score = 13
title = 'l10 link build linkdissolver links linkfox org activexmanagerv13bypccrackslomalkaorg'

distance = 169
spam score = 12
title = 'l10 link build linkdissolver links linkfox org powerarchiver2004v90101germancrackslomalkaorg'

distance = 169
spam score = 13
title = 'l10 link build linkdissolver links linkfox org gadugaduv4030crackslomalkaorg'

distance = 169
spam score = 13
title = 'l10 link build linkdissolver links linkfox org aceofwavv25crackslomalkaorg'

distance = 169
spam score = 13
title = 'l10 link build linkdissolver links linkfox org ppdforiev703crackslomalkaorg'

distance = 170
spam score = 13
title = 'l10 link build linkdissolver links linkfox org arcrailv20crackslomalkaorg'

distance = 170
spam score = 12
title = 'l10 link build linkdissolver links linkfox org filestreamturbobackupv33914crackslomalkaorg'

distance = 170
spam score = 13
title = 'l10 link build linkdissolver links linkfox org p7dp7crackslomalkaorg'

distance = 170
spam score = 13
title = 'l10 link build linkdissolver links linkfox org automacrorecorderv33crackslomalkaorg'

distance = 170
spam score = 13
title = 'l10 link build linkdissolver links linkfox org fastmenuv107crackslomalkaorg'

distance = 170
spam score = 13
title = 'l10 link build linkdissolver links linkfox org radminv22crackbyscgcrackslomalkaorg'

distance = 184
spam score = 13
title = 'l10 link build linkdissolver links linkfox org actualdrawingv46byvirilitycrackslomalkaorg'

distance = 184
spam score = 13
title = 'l10 link build linkdissolver links linkfox org qacp16crackslomalkaorg'

distance = 184
spam score = 13
title = 'l10 link build linkdissolver links linkfox org privatedesktopv13byskywalkercrackslomalkaorg'

distance = 184
spam score = 13
title = 'l10 link build linkdissolver links linkfox org apluscadcopyv20crackslomalkaorg'

distance = 184
spam score = 13
title = 'l10 link build linkdissolver links linkfox org ntrackstudiov3111crackslomalkaorg'

distance = 184
spam score = 13
title = 'l10 link build linkdissolver links linkfox org aptschedulerv130crackslomalkaorg'

distance = 185
spam score = 12
title = 'l10 link build linkdissolver links linkfox org advancedrarpasswordrecoveryv11crackslomalkaorg'

distance = 185
spam score = 12
title = 'l10 link build linkdissolver links linkfox org fsecureantivirusv55010260forserverscrackslomalkaorg'

distance = 185
spam score = 13
title = 'l10 link build linkdissolver links linkfox org analysislottov15crackslomalkaorg'

distance = 185
spam score = 13
title = 'l10 link build linkdissolver links linkfox org advancedadministrativetoolsv556build1070crackslomalkaorg'

distance = 198
spam score = 13
title = 'l10 link build linkdissolver links linkfox org appliedflowtechnologyarrowv30crackslomalkaorg'

distance = 198
spam score = 13
title = 'l10 link build linkdissolver links linkfox org atriseeveryfindv510crackslomalkaorg'

distance = 198
spam score = 13
title = 'l10 link build linkdissolver links linkfox org addremove4goodv20byevccrackslomalkaorg'

distance = 198
spam score = 13
title = 'l10 link build linkdissolver links linkfox org tabmailv20build426crackcrackslomalkaorg'

distance = 198
spam score = 13
title = 'l10 link build linkdissolver links linkfox org avdvideoprocessorv731crackslomalkaorg'

distance = 199
spam score = 13
title = 'l10 link build linkdissolver links linkfox org animagicgifanimatorv122byucccrackslomalkaorg'

distance = 199
spam score = 12
title = 'l10 link build linkdissolver links linkfox org adotmessv30crackslomalkaorg'

distance = 199
spam score = 13
title = 'l10 link build linkdissolver links linkfox org glockeasymailprofessionalv4701000crackslomalkaorg'

distance = 199
spam score = 13
title = 'l10 link build linkdissolver links linkfox org antiviruskasperskypersonalpro5xfixedcrackslomalkaorg'

distance = 199
spam score = 13
title = 'l10 link build linkdissolver links linkfox org oceantigerjdeveloperv20crackslomalkaorg'

distance = 212
spam score = 12
title = 'l10 link build linkdissolver links linkfox org filesecurerv343crackslomalkaorg'

distance = 212
spam score = 12
title = 'l10 link build linkdissolver links linkfox org xdvdripperv1180bytsrhcrackslomalkaorg'

distance = 212
spam score = 12
title = 'l10 link build linkdissolver links linkfox org privateshellv151567crackslomalkaorg'

distance = 212
spam score = 13
title = 'l10 link build linkdissolver links linkfox org ashampoouninstallersuitev10300crackslomalkaorg'

distance = 212
spam score = 12
title = 'l10 link build linkdissolver links linkfox org filepulverizerv40crackslomalkaorg'

distance = 212
spam score = 13
title = 'l10 link build linkdissolver links linkfox org activemessenger105crackslomalkaorg'

distance = 212
spam score = 12
title = 'l10 link build linkdissolver links linkfox org activeskincontrolocxv22byeclipsecrackslomalkaorg'

distance = 212
spam score = 13
title = 'l10 link build linkdissolver links linkfox org animatedscreenv521crackslomalkaorg'

distance = 213
spam score = 13
title = 'l10 link build linkdissolver links linkfox org windows2003andxpandlhantiproductactivationv200crackslomalkaorg'

distance = 213
spam score = 13
title = 'l10 link build linkdissolver links linkfox org aaerusiconcommanderv114crackslomalkaorg'

distance = 228
spam score = 13
title = 'l10 link build linkdissolver links linkfox org powerarchiver2003v880betakeygenbyrevengecrackslomalkaorg'

distance = 228
spam score = 13
title = 'l10 link build linkdissolver links linkfox org privateshellv131240crackslomalkaorg'

distance = 228
spam score = 13
title = 'l10 link build linkdissolver links linkfox org abiseruceprov1012crackslomalkaorg'

distance = 228
spam score = 13
title = 'l10 link build linkdissolver links linkfox org powerdvdv40bynkrhccrackslomalkaorg'

distance = 228
spam score = 13
title = 'l10 link build linkdissolver links linkfox org activestartupv112build57crackslomalkaorg'

distance = 229
spam score = 13
title = 'l10 link build linkdissolver links linkfox org privatedesktopv16crackslomalkaorg'

distance = 229
spam score = 13
title = 'l10 link build linkdissolver links linkfox org powerarchiver2001v70crackslomalkaorg'

distance = 229
spam score = 12
title = 'l10 link build linkdissolver links linkfox org purchaseorderv131workingbyacmecrackslomalkaorg'

distance = 229
spam score = 13
title = 'l10 link build linkdissolver links linkfox org purgem2000v302crackslomalkaorg'

distance = 229
spam score = 13
title = 'l10 link build linkdissolver links linkfox org activestateperldevkitv411crackslomalkaorg'

distance = 250
spam score = 13
title = 'l10 link build linkdissolver links linkfox org windowsxphomeeditionactivationcrackcrackslomalkaorg'

distance = 250
spam score = 12
title = 'l10 link build linkdissolver links linkfox org advancedarchivepasswordrecoveryv20bythesorcerercrackslomalkaorg'

distance = 251
spam score = 13
title = 'l10 link build linkdissolver links linkfox org arealvalidatorv111serialbyamokcrackslomalkaorg'

distance = 251
spam score = 13
title = 'l10 link build linkdissolver links linkfox org powerarchiver2002v80570crackslomalkaorg'

distance = 251
spam score = 12
title = 'l10 link build linkdissolver links linkfox org purchaseorderv11byacmecrackslomalkaorg'

distance = 251
spam score = 13
title = 'l10 link build linkdissolver links linkfox org nameityourwayniyowv141bycafecrackslomalkaorg'

distance = 252
spam score = 12
title = 'l10 link build linkdissolver links linkfox org fsecuresshclientv5323crackslomalkaorg'

distance = 252
spam score = 12
title = 'l10 link build linkdissolver links linkfox org frostbowhomeinventory301crackslomalkaorg'

distance = 252
spam score = 13
title = 'l10 link build linkdissolver links linkfox org nancydrewdangerondeceptionislandcrackslomalkaorg'

distance = 252
spam score = 13
title = 'l10 link build linkdissolver links linkfox org namewizv31loaderbytcacrackslomalkaorg'

distance = 273
spam score = 12
title = 'l10 link build linkdissolver links linkfox org nortonantivirus2005completecrackslomalkaorg'

distance = 274
spam score = 13
title = 'l10 link build linkdissolver links linkfox org airandspacescenicreflectionsscreensaverv10crackslomalkaorg'

distance = 274
spam score = 13
title = 'l10 link build linkdissolver links linkfox org ahandyaddressbookserverv10crackslomalkaorg'

distance = 274
spam score = 13
title = 'l10 link build linkdissolver links linkfox org privacyforwindowsv32bypccrackslomalkaorg'

distance = 275
spam score = 13
title = 'l10 link build linkdissolver links linkfox org ahsplitv10bymetamorfercrackslomalkaorg'

distance = 275
spam score = 12
title = 'l10 link build linkdissolver links linkfox org adpictureviewerv25build231crackslomalkaorg'

distance = 276
spam score = 13
title = 'l10 link build linkdissolver links linkfox org poweraudiotoolsv362fixedcrackslomalkaorg'

distance = 277
spam score = 13
title = 'l10 link build linkdissolver links linkfox org powerarchiver2001v702croatiancrackslomalkaorg'

distance = 277
spam score = 12
title = 'l10 link build linkdissolver links linkfox org filewatch330crackslomalkaorg'

distance = 277
spam score = 12
title = 'l10 link build linkdissolver links linkfox org acousticamp3towaveconverterplusv226bysndcrackslomalkaorg'

distance = 1729
spam score = 42
title = 'dotfilesorg community for sharing dotfiles like bashrc vimrc and bashprofile'

distance = 1752
spam score = 4
title = 'galeries lafayette'

distance = 1752
spam score = 4
title = 'galeries lafayette'

distance = 1803
spam score = 40
title = 'winterer agu 2002 1'

distance = 1830
spam score = 86
title = 'embsay and bolton abbey steam railway photogalleries embsay junction to rylstone'

distance = 39
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa amisv20crackslomalkaorg'

distance = 43
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa p7dp7crackslomalkaorg'

distance = 49
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa ppdforiev703crackslomalkaorg'

distance = 52
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa f1racingsimcrackslomalkaorg'

distance = 55
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa ebiurov1000crackslomalkaorg'

distance = 60
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa ataniv23crackslomalkaorg'

distance = 64
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa f12001keygencrackslomalkaorg'

distance = 69
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa albumseev15crackslomalkaorg'

distance = 79
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa activeskinv422crackcrackslomalkaorg'

distance = 79
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa arialsoundrecorderv116crackslomalkaorg'

distance = 79
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa animatedgifproducerv32crackslomalkaorg'

distance = 80
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa filesecurerv342crackslomalkaorg'

distance = 80
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa advancedprintsnifferv10053crackslomalkaorg'

distance = 84
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa tabletalk11crackslomalkaorg'

distance = 84
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa xsqueezemev402crackslomalkaorg'

distance = 85
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa autodialogsv1040crackslomalkaorg'

distance = 88
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa frigateprov326086crackslomalkaorg'

distance = 90
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa eiconsv343crackcrackslomalkaorg'

distance = 91
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa accesslockv151byinfernocrackslomalkaorg'

distance = 91
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa ntrackstudiov20crackslomalkaorg'

distance = 162
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa audiotoolsv320crackslomalkaorg'

distance = 162
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa aepryuscalculatorv1xcrackslomalkaorg'

distance = 163
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa octagon10serialbyamokcrackslomalkaorg'

distance = 163
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa acedvdbackupv1xgenericcrackslomalkaorg'

distance = 163
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa folderlockv5crackslomalkaorg'

distance = 164
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa achristmasatsantasv29byfffcrackslomalkaorg'

distance = 164
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa oounerasev10build254crackslomalkaorg'

distance = 164
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa abcmonitor170crackslomalkaorg'

distance = 164
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa filesearchforlanv11crackslomalkaorg'

distance = 164
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa fircv11crackslomalkaorg'

distance = 185
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa ppingtools26crackslomalkaorg'

distance = 185
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa reallusionfacefilterv105181studioeditioncrackslomalkaorg'

distance = 185
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa ubsellerv218crackslomalkaorg'

distance = 185
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa facefilterstandardv10008192crackslomalkaorg'

distance = 186
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa abcwallpapermachinev1100303crackslomalkaorg'

distance = 186
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa autostarv10byagaincrackslomalkaorg'

distance = 186
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa emailsv222crackslomalkaorg'

distance = 186
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa filescipherv140crackslomalkaorg'

distance = 187
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa privatepixv290crackslomalkaorg'

distance = 187
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa all2bmpv120byeminencecrackslomalkaorg'

distance = 201
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa atrexv80crackslomalkaorg'

distance = 201
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa oceanscreensavervolume1to5crackslomalkaorg'

distance = 202
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa aviationphotographyscreensaverv11crackslomalkaorg'

distance = 202
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa fprotantivirusforwindowsv310ccrackslomalkaorg'

distance = 202
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa fsecuresshclientv540japanesecrackslomalkaorg'

distance = 202
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa amusicalgeneratorv20288crackslomalkaorg'

distance = 203
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa akoffguitarassistantv101keygenbytnocrackslomalkaorg'

distance = 204
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa powereditv12crackslomalkaorg'

distance = 204
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa advertisingmessagerv20081crackslomalkaorg'

distance = 204
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa powerarchiver2001v702portuguesecrackslomalkaorg'

distance = 219
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa ebusinessappletv40crackslomalkaorg'

distance = 219
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa fprotantivirusforwindowsv307crackslomalkaorg'

distance = 219
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa availsuitev20crackslomalkaorg'

distance = 219
spam score = 6
title = 'p20 pc atomic sync v10 payroll monitor pro pa advancedbusinesscardsv15serialbyfffcrackslomalkaorg'

distance = 219
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa fo2pixphotoartmasterclassicv15crackslomalkaorg'

distance = 219
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa powerclock416serialcrackslomalkaorg'

distance = 220
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa albumgeneratorandviewerv2100bydigeraticrackslomalkaorg'

distance = 220
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa activewhoisv212591crackslomalkaorg'

distance = 220
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa agnitumoutpostfirewallcrackslomalkaorg'

distance = 220
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa powerdefragv200litecrackslomalkaorg'

distance = 234
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa galacticpatrolv166bydisruptioncrackslomalkaorg'

distance = 234
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa privacyeraserv30crackslomalkaorg'

distance = 234
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa activefaxserverv3610181crackslomalkaorg'

distance = 234
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa aslvocab10forpalmoscrackslomalkaorg'

distance = 234
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa abcalculator110bydbccrackslomalkaorg'

distance = 235
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa nerodvdvideoplugincrackslomalkaorg'

distance = 235
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa powercardmakerv34crackslomalkaorg'

distance = 235
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa xdvdripperv1150byucfcrackslomalkaorg'

distance = 235
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa hackmandisassemblerv801crackslomalkaorg'

distance = 236
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa arfive112crackslomalkaorg'

distance = 254
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa activexmanagerv14byevccrackslomalkaorg'

distance = 254
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa puzzlechampionv1030215bytmgcrackslomalkaorg'

distance = 254
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa archivexplorerv1001303crackslomalkaorg'

distance = 255
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa pacestarlanflownetdiagrammerv5021808crackslomalkaorg'

distance = 255
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa privacyshredderv216bytsrhcrackslomalkaorg'

distance = 255
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa activefaxserverv387build194crackslomalkaorg'

distance = 255
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa akmail4alpha3germancrackslomalkaorg'

distance = 255
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa aiplspincyclev21crackslomalkaorg'

distance = 256
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa privatedesktopv19crackslomalkaorg'

distance = 256
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa powerarchiver8crackslomalkaorg'

distance = 275
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa privatepixv280crackslomalkaorg'

distance = 275
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa adobephotoshopcscecrackslomalkaorg'

distance = 275
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa ariolicnetsend9xv13crackslomalkaorg'

distance = 276
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa pacestarumldiagrammer417build1787trialcrackslomalkaorg'

distance = 276
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa gawebserverv1077crackslomalkaorg'

distance = 276
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa purchaseorderv131crackslomalkaorg'

distance = 276
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa xnetstatprofessionalv50bymadmanherculescrackslomalkaorg'

distance = 276
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa arobfantasticmp3encoderv20crackcrackslomalkaorg'

distance = 276
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa advancedrarpasswordrecoveryv120bycimcrackslomalkaorg'

distance = 277
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa windows2003andxpantiproductactivationcrackv162crackslomalkaorg'

distance = 309
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa efunsoftmastermind10bytntcrackslomalkaorg'

distance = 310
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa aerotagstagslockprov222crackslomalkaorg'

distance = 312
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa privateidahoemail4520crackslomalkaorg'

distance = 312
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa activepdfdocconverterv352crackslomalkaorg'

distance = 314
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa ahmtritontools2000beta1fordelphi4crackslomalkaorg'

distance = 315
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa albummultimedialnyv10crackslomalkaorg'

distance = 315
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa animagicgifanimatorv122apatchcrackslomalkaorg'

distance = 315
spam score = 8
title = 'p20 pc atomic sync v10 payroll monitor pro pa windowsxpactivationhackhomeoemretailcrackslomalkaorg'

distance = 315
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa vampirethemasqueraderedemptionv11crackslomalkaorg'

distance = 315
spam score = 7
title = 'p20 pc atomic sync v10 payroll monitor pro pa activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 28
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w associatev13crackslomalkaorg'

distance = 44
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w r2jv10crackslomalkaorg'

distance = 53
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w ghackerv20crackslomalkaorg'

distance = 64
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w activepagerv10crackslomalkaorg'

distance = 67
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w apispyv25crackslomalkaorg'

distance = 70
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w ecampaignv30crackslomalkaorg'

distance = 71
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w emailtalkerv40crackslomalkaorg'

distance = 73
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w animatedbuttonv103crackslomalkaorg'

distance = 75
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w abovebeyond2003crackslomalkaorg'

distance = 77
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w footballgenerationcrackslomalkaorg'

distance = 78
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w xchat28crackslomalkaorg'

distance = 79
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w rwipeandcleanv351104crackslomalkaorg'

distance = 81
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w alignitv202crackslomalkaorg'

distance = 81
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w andromedashadowcrackcrackslomalkaorg'

distance = 84
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w aboutspades12crackslomalkaorg'

distance = 90
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w findduplicate101build112crackslomalkaorg'

distance = 91
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w activequerycrackslomalkaorg'

distance = 92
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w odbcviewer22crackslomalkaorg'

distance = 93
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w eborderclient211crackslomalkaorg'

distance = 94
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w p2crocket11crackslomalkaorg'

distance = 158
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fileshredder2000v33crackslomalkaorg'

distance = 159
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w aplusfilenamingsystemv111crackslomalkaorg'

distance = 159
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w advancedmp3wmarecorderv32crackslomalkaorg'

distance = 160
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w p2cpluspascal12407ecrackslomalkaorg'

distance = 160
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w apptrackerv210bysyntaxcrackslomalkaorg'

distance = 160
spam score = 7
title = 'w28 winamp pro maker skin serial winace v50 w ebusinessappletv2102crackslomalkaorg'

distance = 160
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w abcencrypt12crackslomalkaorg'

distance = 160
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fastopenpro1110crackslomalkaorg'

distance = 160
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w accessdeniedv220patchcrackslomalkaorg'

distance = 160
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w pacemakerv132crackslomalkaorg'

distance = 178
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w agtransform117crackslomalkaorg'

distance = 178
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w emailmanv311build0302crackslomalkaorg'

distance = 178
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w adressverwaltung2004v159crackslomalkaorg'

distance = 178
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w pacestaredgediagrammerv5021808crackslomalkaorg'

distance = 178
spam score = 10
title = 'w28 winamp pro maker skin serial winace v50 w apracticalguidetoenterprisearchitectureebookcrackslomalkaorg'

distance = 178
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w financialadvisorv251crackslomalkaorg'

distance = 179
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w animatenaturescreensaverv101crackslomalkaorg'

distance = 179
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w emailextractorexpressv210511crackcrackslomalkaorg'

distance = 179
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w adayinthelifev15crackcrackslomalkaorg'

distance = 180
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w aplusfileprotectionv27crackslomalkaorg'

distance = 194
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w airxonixv136bysouravcrackslomalkaorg'

distance = 194
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w actualdrawingv52byfffcrackslomalkaorg'

distance = 194
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w folderguardprov55byunknowncrackslomalkaorg'

distance = 194
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w audiospherev257crackslomalkaorg'

distance = 194
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w forumswebserverprov1600710crackslomalkaorg'

distance = 195
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w finditv3xcrackslomalkaorg'

distance = 195
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w aboveandbeyond2000b27crackslomalkaorg'

distance = 195
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w halflifev1106onlinepatchcrackslomalkaorg'

distance = 196
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w atomtimeprov31cbynatabeccrackslomalkaorg'

distance = 196
spam score = 7
title = 'w28 winamp pro maker skin serial winace v50 w fireburnerv221crackslomalkaorg'

distance = 211
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w advancedbiorhythms2004v20crackslomalkaorg'

distance = 211
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fotostationprov45build137crackslomalkaorg'

distance = 212
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w filestoragev26fordelphi3crackslomalkaorg'

distance = 212
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w familyrunner36crackslomalkaorg'

distance = 212
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w autoyachtv820crackslomalkaorg'

distance = 213
spam score = 7
title = 'w28 winamp pro maker skin serial winace v50 w fsecureantivirusforwindowsv540crackslomalkaorg'

distance = 213
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w agendamsdv230crackslomalkaorg'

distance = 213
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fotosaverv11crackslomalkaorg'

distance = 213
spam score = 7
title = 'w28 winamp pro maker skin serial winace v50 w flashonlinescannerv101crackslomalkaorg'

distance = 214
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w airnavselcaldecoderv10serialcrackslomalkaorg'

distance = 227
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w arkandroidv19crackslomalkaorg'

distance = 227
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w luxorv10534ragamescrackbyffgcrackslomalkaorg'

distance = 228
spam score = 7
title = 'w28 winamp pro maker skin serial winace v50 w fastnetconnectionacceleratorcrackslomalkaorg'

distance = 228
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w activeskincontrolocxv40crackslomalkaorg'

distance = 228
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fifa2005byunknowncrackslomalkaorg'

distance = 228
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w ua1zclcpluspluseditorv17crackslomalkaorg'

distance = 229
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w aisbannerblocker10crackslomalkaorg'

distance = 229
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w ancienttripeaksv851r102crackslomalkaorg'

distance = 230
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w flamingpearglitteratov102crackslomalkaorg'

distance = 230
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w facefilterv109252standardeditioncrackslomalkaorg'

distance = 246
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w abpfiffv703germancrackslomalkaorg'

distance = 246
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w activewebcamv50crackslomalkaorg'

distance = 247
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w kasperskyantiviruskeyscollectioncrackslomalkaorg'

distance = 247
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w valesoftwareaudiostudiov21crackslomalkaorg'

distance = 247
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fleximusiccomposermarch2003crackslomalkaorg'

distance = 247
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w adobephotoshopcs2v90keygenbyss2crackslomalkaorg'

distance = 247
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w emailalertv1019byimscrackslomalkaorg'

distance = 248
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w qarbonviewletcamv102003crackslomalkaorg'

distance = 248
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w allwebmenusv13build360byfreifall7crackslomalkaorg'

distance = 248
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w activeskinv422crackslomalkaorg'

distance = 269
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w appsoftclassmaster1052crackslomalkaorg'

distance = 269
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w filecut2v22serialbylashcrackslomalkaorg'

distance = 270
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w arcservev6xforwindowsntcrackslomalkaorg'

distance = 270
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fatecengineeringfmatv10137byscfcrackslomalkaorg'

distance = 271
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fprotantivirusforwindowsv307crackslomalkaorg'

distance = 271
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fsecureantivirusv55010260forserverscrackslomalkaorg'

distance = 272
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w editorebookcompilerv25crackslomalkaorg'

distance = 272
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w achessexpertprofessionaleditionv371crackslomalkaorg'

distance = 272
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w fsecureantivirusworkstationv530crackslomalkaorg'

distance = 272
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w autodebugfornetv10bvcrackslomalkaorg'

distance = 301
spam score = 7
title = 'w28 winamp pro maker skin serial winace v50 w galaxyrebellionv141germanallaccesscheatcrackslomalkaorg'

distance = 303
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w aesupersubmitter193bcrackslomalkaorg'

distance = 305
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w powereditv212byacmecrackslomalkaorg'

distance = 305
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w apluscalcv20crackslomalkaorg'

distance = 305
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w puzzlechampionv1030215bytmgcrackslomalkaorg'

distance = 306
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w puzzleblastv10bypizzacrackslomalkaorg'

distance = 307
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w argosoftftpserverv12crackslomalkaorg'

distance = 308
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 309
spam score = 9
title = 'w28 winamp pro maker skin serial winace v50 w absolutedatabasecomponentv489singleusereditioncrackslomalkaorg'

distance = 310
spam score = 8
title = 'w28 winamp pro maker skin serial winace v50 w apolloaudioanddataburnerv119byagaincrackslomalkaorg'

distance = 524
spam score = 8
title = 'd18 dfx for winamp dhtml v50 jukebox and diab amigoeasydvdmakerv328crackslomalkaorg'

distance = 537
spam score = 8
title = 'd17 dfx for winamp audio dexster devplanner en powercardmakerv34byfffcrackslomalkaorg'

distance = 1478
spam score = 21
title = 'hellgate london crack serial ing by njs torrentbasketcom torrents download torrents search'

distance = 1849
spam score = 47
title = 'dansac incutech 63'

distance = 1927
spam score = 46
title = 'ictinaetus malayensis gujarat'

distance = 87
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 alarmv630crackslomalkaorg'

distance = 87
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina fcutterv152crackslomalkaorg'

distance = 91
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 ascv30crackslomalkaorg'

distance = 95
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina accesstoweb41crackslomalkaorg'

distance = 96
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina ebusinesssolutionsv7000003crackslomalkaorg'

distance = 96
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 tabledit264b7crackslomalkaorg'

distance = 96
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina f1racingsimcrackslomalkaorg'

distance = 108
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 g6renamerv151crackslomalkaorg'

distance = 112
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina slomalkaorg'

distance = 113
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 eborderclient21crackslomalkaorg'

distance = 113
spam score = 6
title = 'c90 cuteftp build pro xp v425 v50 v42 fina formelbank22crackslomalkaorg'

distance = 116
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina axev30crackslomalkaorg'

distance = 116
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina findv26bydfcrackslomalkaorg'

distance = 118
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 allegrosurfv60crackslomalkaorg'

distance = 119
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 xballv211crackslomalkaorg'

distance = 119
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 ebookv1001crackslomalkaorg'

distance = 120
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 freshuiv360crackslomalkaorg'

distance = 120
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina alarmclockv211crackslomalkaorg'

distance = 120
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina aprcalcv40112crackslomalkaorg'

distance = 120
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina emailsv210crackslomalkaorg'

distance = 194
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 ebackup10byelilacrackslomalkaorg'

distance = 194
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina alignitv120crackslomalkaorg'

distance = 194
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 facemailv10bycovecrackslomalkaorg'

distance = 195
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina activeskinv422crackcrackslomalkaorg'

distance = 195
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 apollodatabaseserverv6108crackslomalkaorg'

distance = 195
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 fineprint2000v461enterpriseeditioncrackslomalkaorg'

distance = 195
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina finalfantasy7crackslomalkaorg'

distance = 195
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina activeprofile12crackslomalkaorg'

distance = 195
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina agendapr900v1711114crackslomalkaorg'

distance = 196
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 hackersblackbookcrackslomalkaorg'

distance = 216
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 alpha26byelilacrackslomalkaorg'

distance = 216
spam score = 6
title = 'c90 cuteftp build pro xp v425 v50 v42 fina gaeb90iov22015germancrackslomalkaorg'

distance = 216
spam score = 8
title = 'c89 cuteftp xp customizer pro v10 build v20 activerefreshv136build551crackslomalkaorg'

distance = 216
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina asposelicensev12crackslomalkaorg'

distance = 216
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina fsecureantivirusv552crackslomalkaorg'

distance = 216
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina avcatalogerv20377crackslomalkaorg'

distance = 217
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina amusicalgeneratorv30crackslomalkaorg'

distance = 217
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 ubsellerv206crackslomalkaorg'

distance = 217
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina ecleanv101crackslomalkaorg'

distance = 217
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 agescrackslomalkaorg'

distance = 232
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 obriseasygradeprov36crackslomalkaorg'

distance = 232
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina aviarymanagerv301crackslomalkaorg'

distance = 232
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina familyrunner38crackslomalkaorg'

distance = 232
spam score = 8
title = 'c90 cuteftp build pro xp v425 v50 v42 fina absolutesoundrecorderv328crackslomalkaorg'

distance = 233
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina auctioninformantv200crackslomalkaorg'

distance = 233
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina pacestarlanflowv4171787crackslomalkaorg'

distance = 233
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina fsecureworkstationsuite401crackslomalkaorg'

distance = 233
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina activefaxserverv387build194crackslomalkaorg'

distance = 233
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 avlabelsv11d456crackslomalkaorg'

distance = 233
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina activefile227crackslomalkaorg'

distance = 248
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 faststatsanalyzerv27xcrackslomalkaorg'

distance = 248
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 kasperskyantiviruspersonalcrackslomalkaorg'

distance = 248
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina alldatadonglecrackcrackslomalkaorg'

distance = 248
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 filenameprov206crackslomalkaorg'

distance = 248
spam score = 5
title = 'c89 cuteftp xp customizer pro v10 build v20 emailextractorexpressv21byorioncrackslomalkaorg'

distance = 248
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 avirtgatewaysuitev42crackslomalkaorg'

distance = 249
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina facemailv10bycovecrackslomalkaorg'

distance = 249
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 autosurf11crackslomalkaorg'

distance = 249
spam score = 8
title = 'c90 cuteftp build pro xp v425 v50 v42 fina absolutesecurityprov39keygenbyaaocgcrackslomalkaorg'

distance = 249
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina g6ftpserverallversionscrackslomalkaorg'

distance = 262
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 finetunev150serialbyfhcfcrackslomalkaorg'

distance = 263
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina gadugaduv489crackslomalkaorg'

distance = 263
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina finditv400bytsrhcrackslomalkaorg'

distance = 263
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina absolutelyonlinev23build27crackslomalkaorg'

distance = 263
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 animatedoptionboxv100ccrackslomalkaorg'

distance = 263
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 autorunassistantv282crackslomalkaorg'

distance = 263
spam score = 6
title = 'c90 cuteftp build pro xp v425 v50 v42 fina agprotect2411forvb5crackslomalkaorg'

distance = 264
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 acehtmlprov5060bywargodcrackslomalkaorg'

distance = 264
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 appletmarqueewizardv35byserials2000crackslomalkaorg'

distance = 264
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina advancedbiorhythmsv151crackslomalkaorg'

distance = 282
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 namodeepsearchv306fullnewcrackslomalkaorg'

distance = 282
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina animagicgifanimatorv122byucfcrackslomalkaorg'

distance = 282
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina folderguardv53aprofessionalcrackslomalkaorg'

distance = 282
spam score = 6
title = 'c90 cuteftp build pro xp v425 v50 v42 fina finemetronome2007v20crackslomalkaorg'

distance = 282
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 okprintwatchv241crackslomalkaorg'

distance = 282
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina arobfantasticmp3networkedencoderv14bymanifestcrackslomalkaorg'

distance = 283
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina adobephotoshopcs2v90keygenbyss2crackslomalkaorg'

distance = 283
spam score = 6
title = 'c90 cuteftp build pro xp v425 v50 v42 fina fprotantivirusforwindowsv311apatchbytntcrackslomalkaorg'

distance = 283
spam score = 8
title = 'c89 cuteftp xp customizer pro v10 build v20 activerefreshv135build535crackslomalkaorg'

distance = 283
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina autozip40crackslomalkaorg'

distance = 299
spam score = 6
title = 'c90 cuteftp build pro xp v425 v50 v42 fina fprotantivirusforwindowsv312crackslomalkaorg'

distance = 299
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 finditv400bytsrhcrackslomalkaorg'

distance = 299
spam score = 8
title = 'c90 cuteftp build pro xp v425 v50 v42 fina actualtestscomcitrix1y0991examcheatsheetv120103bynitrouscrackslomalkaorg'

distance = 299
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina poweraudiotoolsv362fixedcrackslomalkaorg'

distance = 299
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 namowebeditor5bysccrackslomalkaorg'

distance = 299
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina ashampoowinoptimizerplatinumsuitev110crackslomalkaorg'

distance = 299
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina fabsoftreformenterprisev9003crackslomalkaorg'

distance = 299
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 arclabmaillistcontrolleramlcv201crackslomalkaorg'

distance = 300
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina activeskincontrolocxv30crackslomalkaorg'

distance = 300
spam score = 6
title = 'c90 cuteftp build pro xp v425 v50 v42 fina pusoy10crackslomalkaorg'

distance = 324
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 activestateperldevkitv520520crackslomalkaorg'

distance = 324
spam score = 5
title = 'c89 cuteftp xp customizer pro v10 build v20 filesharingfornetv1522june2004crackslomalkaorg'

distance = 324
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 ashampoouninstallersuiteplusv1341crackslomalkaorg'

distance = 324
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina arcplandynaselworkshopv11226crackslomalkaorg'

distance = 324
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 aliveinterneteraserv1028bysndcrackslomalkaorg'

distance = 324
spam score = 6
title = 'c89 cuteftp xp customizer pro v10 build v20 flashfxpv340build1145finalcrackslomalkaorg'

distance = 325
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina ageofempiresspain10briseofromespain10crackslomalkaorg'

distance = 325
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina agprotect2411forvb6crackslomalkaorg'

distance = 325
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina freshdiagnosev350byrp2kcrackslomalkaorg'

distance = 325
spam score = 7
title = 'c90 cuteftp build pro xp v425 v50 v42 fina efunsoftmastermind10bylashcrackslomalkaorg'

distance = 442
spam score = 6
title = 'c90 cuteftp build pro xp v425 v50 v42 fina ashampoomovieshrinkandburnv211bylucidcrackslomalkaorg'

distance = 492
spam score = 7
title = 'p16 passmark passware password recovery build windowsxp4in1keygenandchangeinfocrackslomalkaorg'

distance = 500
spam score = 9
title = 'h8 hebrew hedit heart helium heliobar xp supp firestormv23build185crackslomalkaorg'

distance = 40
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof accessadministratorv14crackslomalkaorg'

distance = 67
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof amusicalgeneratorv200288crackslomalkaorg'

distance = 67
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof auctionchiefv229crackslomalkaorg'

distance = 75
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof adr2000v131crackslomalkaorg'

distance = 77
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof addresseverywherev25crackslomalkaorg'

distance = 80
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof arealv15crackslomalkaorg'

distance = 81
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof pacboyv10crackslomalkaorg'

distance = 88
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof fcutterv160serialcrackslomalkaorg'

distance = 89
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof adayinthelifev13crackslomalkaorg'

distance = 90
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof finanzrechner10crackslomalkaorg'

distance = 91
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof activewhoisv212591crackslomalkaorg'

distance = 91
spam score = 17
title = 'g17 goldwave golden32 build goldview32 goldsof activerefreshv22622crackslomalkaorg'

distance = 92
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof acehtmlprov4008crackslomalkaorg'

distance = 95
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof fcutterv160crackslomalkaorg'

distance = 97
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof airmessengerascii143crackslomalkaorg'

distance = 98
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof udeployv1730crackslomalkaorg'

distance = 98
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof footballv101javacrackslomalkaorg'

distance = 99
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof archiveexplorerv30crackslomalkaorg'

distance = 100
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof rguardv20942crackslomalkaorg'

distance = 102
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof acecapturev18crackslomalkaorg'

distance = 154
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof flashrenamerv461crackslomalkaorg'

distance = 154
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof windowsxpservicepack2byunknowncrackslomalkaorg'

distance = 154
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof activeskinocxv4257crackslomalkaorg'

distance = 155
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof asianviewerv11crackslomalkaorg'

distance = 155
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof abcwallpapermachinev2010444crackslomalkaorg'

distance = 155
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof axiconsv45byasmcrackslomalkaorg'

distance = 155
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof absoluterprofessionaleditionv121crackslomalkaorg'

distance = 156
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof fileshredderv34crackslomalkaorg'

distance = 156
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof fatmanadventuresv103byeclipsecrackslomalkaorg'

distance = 157
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof fivesandthreesv13keygencrackslomalkaorg'

distance = 170
spam score = 16
title = 'g17 goldwave golden32 build goldview32 goldsof arobfantasticmp3encoderv13byciacrackslomalkaorg'

distance = 170
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof atmospheredeluxev53bysndcrackslomalkaorg'

distance = 171
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof ecampaigncorporateeditionv2961crackslomalkaorg'

distance = 171
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof activewhoisv212587crackslomalkaorg'

distance = 171
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof activeskinocxv425crackslomalkaorg'

distance = 171
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof alignitv210keygenbyorioncrackslomalkaorg'

distance = 172
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof autowinnet95professionalv50crackslomalkaorg'

distance = 172
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof namov311crackslomalkaorg'

distance = 173
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof activeskinv422crackslomalkaorg'

distance = 173
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof aplusfilenamingsystemv110crackslomalkaorg'

distance = 186
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof activestatevisualxsltforvs2002v1812494crackslomalkaorg'

distance = 186
spam score = 17
title = 'g17 goldwave golden32 build goldview32 goldsof activerefreshv136build551crackslomalkaorg'

distance = 187
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof imtoo3gpvideoconverterv2115build1201crackslomalkaorg'

distance = 187
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof arconv50demopolishcrackslomalkaorg'

distance = 187
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof activewhoisv212583crackslomalkaorg'

distance = 188
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof axcursors45crackslomalkaorg'

distance = 188
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof ecampaignprofessionaleditionv2944byfffcrackslomalkaorg'

distance = 188
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof finditprov40bysevencrackslomalkaorg'

distance = 188
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof animatedscreenv52crackslomalkaorg'

distance = 189
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof filesynchronizerv10crackslomalkaorg'

distance = 202
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof airstrike3dallaccesscheatcrackslomalkaorg'

distance = 202
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof automp3renamerv22crackslomalkaorg'

distance = 202
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof animagicgifanimatorv123crackslomalkaorg'

distance = 203
spam score = 13
title = 'g17 goldwave golden32 build goldview32 goldsof fileprotector2001v205specialeditioncrackslomalkaorg'

distance = 203
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof activeskinv4273crackslomalkaorg'

distance = 203
spam score = 16
title = 'g17 goldwave golden32 build goldview32 goldsof alawarlittlebombersreturnsv17crackslomalkaorg'

distance = 203
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof actualwindowmenuv28crackslomalkaorg'

distance = 203
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof acronismigrateeasyv60crackslomalkaorg'

distance = 204
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof fsecureinternetgatekeeperv206linuxcrackslomalkaorg'

distance = 204
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof filetimeedit2v206byacmecrackslomalkaorg'

distance = 217
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof animatedformeffect10fordelphi5crackslomalkaorg'

distance = 217
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof flashoptimizerv11773unlimitedbusinesscrackslomalkaorg'

distance = 218
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof advancedtexttospeechattsv20bydfcrackslomalkaorg'

distance = 218
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof abcwallpapermachinev2110511crackslomalkaorg'

distance = 220
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof namowebeditorv307crackslomalkaorg'

distance = 220
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof fprotantivirusv312dbyfullmooncrackslomalkaorg'

distance = 220
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof ebackup14byeaglecrackslomalkaorg'

distance = 221
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof auctionsentryv231crackslomalkaorg'

distance = 221
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof actualtestscomapple9l0504examcheatsheetv102004crackslomalkaorg'

distance = 221
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof absolutesecurityprov39keygenbydbccrackslomalkaorg'

distance = 232
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof pacdoomiiihalloweenv10crackslomalkaorg'

distance = 232
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof achessexpertprofessionaleditionv371crackslomalkaorg'

distance = 232
spam score = 16
title = 'g17 goldwave golden32 build goldview32 goldsof audioslimmerv1190bytntcrackslomalkaorg'

distance = 232
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof aceftpv2063probytsrhcrackslomalkaorg'

distance = 232
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof fprotantivirus312cbycrackdemon2003crackslomalkaorg'

distance = 234
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof advancedrarpasswordrecoveryv110crackslomalkaorg'

distance = 234
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof arobfantasticmp3encoderv20crackslomalkaorg'

distance = 234
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof alawarmagicballv176crackslomalkaorg'

distance = 234
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof arealvalidatorv111serialbyfhcfcrackslomalkaorg'

distance = 234
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof antiviruskasperskypersonalpro5xcrackslomalkaorg'

distance = 250
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof advancedquerytoolv511crackslomalkaorg'

distance = 251
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof aaarealrecorderv170bytdscrackslomalkaorg'

distance = 251
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof flexiblesoftdialerv121crackslomalkaorg'

distance = 252
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof fprotantivirusv312cbyfreezecrackslomalkaorg'

distance = 252
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof activestatekomodoprofessionalv25178606crackslomalkaorg'

distance = 253
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof glockadvancedadministrativetoolsv555crackslomalkaorg'

distance = 253
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof fontsee32crackslomalkaorg'

distance = 253
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof pacestarwizflowv4191790crackslomalkaorg'

distance = 253
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof windowsxpservicepack2activatorcrackbyhjcrackslomalkaorg'

distance = 253
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof eplusmaxaltera100crackslomalkaorg'

distance = 281
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof activemp3activexcontrol19byblizzardcrackslomalkaorg'

distance = 281
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof fabsoftreformenterprisev9003crackslomalkaorg'

distance = 283
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof acronisdiskeditorv60byneocoderzcrackslomalkaorg'

distance = 283
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof addremove4goodv20byfhcfcrackslomalkaorg'

distance = 284
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof namov55regfilebyneocoderzcrackslomalkaorg'

distance = 284
spam score = 17
title = 'g17 goldwave golden32 build goldview32 goldsof activerefreshv136build551bytsrhcrackslomalkaorg'

distance = 284
spam score = 13
title = 'g17 goldwave golden32 build goldview32 goldsof protectxprofessionaleditionv411keygencrackslomalkaorg'

distance = 285
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof xdvdripperv1150byfffcrackslomalkaorg'

distance = 285
spam score = 15
title = 'g17 goldwave golden32 build goldview32 goldsof activeskincontrolocxv352crackslomalkaorg'

distance = 286
spam score = 14
title = 'g17 goldwave golden32 build goldview32 goldsof fsecureinternetsecurity2005multilanguagecrackslomalkaorg'

distance = 368
spam score = 16
title = 'g17 goldwave golden32 build goldview32 goldsof actualtestscomhphp0500examcheatsheetv50504crackslomalkaorg'

distance = 382
spam score = 16
title = 'g17 goldwave golden32 build goldview32 goldsof actualtestscomsscpexamcheatsheetv32604crackslomalkaorg'

distance = 1230
spam score = 16
title = 'obasic 97 v97033 build 07 obasic97v97033build07crackslomalkaorg'

distance = 1308
spam score = 14
title = 'b2b activator 10 b2bactivator10crackslomalkaorg'

distance = 1349
spam score = 16
title = 'accum 2001a by tmg accum2001abytmgcrackslomalkaorg'

distance = 1356
spam score = 15
title = 'encrypted messenger v30069 encryptedmessengerv30069crackslomalkaorg'

distance = 1360
spam score = 12
title = 'fsecure ssh client v51 fsecuresshclientv51crackslomalkaorg'

distance = 1411
spam score = 16
title = 'nero burning rom v5564 mp3pro encoder by the wraith neroburningromv5564mp3proencoderbythewraithcrackslomalkaorg'

distance = 27
spam score = 5
title = 't1 and tag rename tabmail v20 build t table gutecollectioncrackslomalkaorg'

distance = 33
spam score = 5
title = 't1 and tag rename tabmail v20 build t table v3mail11crackslomalkaorg'

distance = 35
spam score = 5
title = 't1 and tag rename tabmail v20 build t table accountprov82410crackslomalkaorg'

distance = 36
spam score = 6
title = 't1 and tag rename tabmail v20 build t table f12001keygencrackslomalkaorg'

distance = 36
spam score = 6
title = 't1 and tag rename tabmail v20 build t table xballv21crackslomalkaorg'

distance = 37
spam score = 5
title = 't1 and tag rename tabmail v20 build t table kmlv35200crackslomalkaorg'

distance = 43
spam score = 6
title = 't1 and tag rename tabmail v20 build t table nameityourwayv110crackslomalkaorg'

distance = 46
spam score = 5
title = 't1 and tag rename tabmail v20 build t table tabmailv22crackslomalkaorg'

distance = 46
spam score = 5
title = 't1 and tag rename tabmail v20 build t table find12crackslomalkaorg'

distance = 48
spam score = 6
title = 't1 and tag rename tabmail v20 build t table anywhere2000crackslomalkaorg'

distance = 48
spam score = 6
title = 't1 and tag rename tabmail v20 build t table anywhere2000newcrackslomalkaorg'

distance = 49
spam score = 6
title = 't1 and tag rename tabmail v20 build t table fishv333431crackslomalkaorg'

distance = 49
spam score = 5
title = 't1 and tag rename tabmail v20 build t table r2v507gcrackslomalkaorg'

distance = 49
spam score = 6
title = 't1 and tag rename tabmail v20 build t table xballv211crackslomalkaorg'

distance = 51
spam score = 5
title = 't1 and tag rename tabmail v20 build t table nameit10crackslomalkaorg'

distance = 51
spam score = 5
title = 't1 and tag rename tabmail v20 build t table halflifev1107crackslomalkaorg'

distance = 53
spam score = 6
title = 't1 and tag rename tabmail v20 build t table objectbarv12crackslomalkaorg'

distance = 54
spam score = 6
title = 't1 and tag rename tabmail v20 build t table xhdlv3237crackslomalkaorg'

distance = 54
spam score = 5
title = 't1 and tag rename tabmail v20 build t table tabmailv12810crackslomalkaorg'

distance = 55
spam score = 6
title = 't1 and tag rename tabmail v20 build t table auriconacrackslomalkaorg'

distance = 158
spam score = 6
title = 't1 and tag rename tabmail v20 build t table azimagev101byeminencecrackslomalkaorg'

distance = 158
spam score = 5
title = 't1 and tag rename tabmail v20 build t table glockadvancedemailverifier220104crackslomalkaorg'

distance = 159
spam score = 6
title = 't1 and tag rename tabmail v20 build t table activebarcodev513crackslomalkaorg'

distance = 159
spam score = 6
title = 't1 and tag rename tabmail v20 build t table oasisprov1305crackslomalkaorg'

distance = 159
spam score = 6
title = 't1 and tag rename tabmail v20 build t table abcuploadasp46crackslomalkaorg'

distance = 159
spam score = 6
title = 't1 and tag rename tabmail v20 build t table adressman340build2crackslomalkaorg'

distance = 159
spam score = 5
title = 't1 and tag rename tabmail v20 build t table athletesdiaryv102forpalmoscrackslomalkaorg'

distance = 159
spam score = 6
title = 't1 and tag rename tabmail v20 build t table anagramgeniusv84crackslomalkaorg'

distance = 159
spam score = 5
title = 't1 and tag rename tabmail v20 build t table amateurinvest2000revisionbcrackslomalkaorg'

distance = 159
spam score = 5
title = 't1 and tag rename tabmail v20 build t table advancedsecuritylevelv51byfulmooncrackslomalkaorg'

distance = 180
spam score = 5
title = 't1 and tag rename tabmail v20 build t table octopodforc30crackslomalkaorg'

distance = 180
spam score = 6
title = 't1 and tag rename tabmail v20 build t table anyrecorderv168crackslomalkaorg'

distance = 180
spam score = 6
title = 't1 and tag rename tabmail v20 build t table freshdiagnosev350byimscrackslomalkaorg'

distance = 180
spam score = 5
title = 't1 and tag rename tabmail v20 build t table adobephotoshopv701bynitruscrackslomalkaorg'

distance = 180
spam score = 6
title = 't1 and tag rename tabmail v20 build t table altarserversprov333bylucidcrackslomalkaorg'

distance = 180
spam score = 6
title = 't1 and tag rename tabmail v20 build t table anydvd596xupdated3universalpatchcrackslomalkaorg'

distance = 180
spam score = 6
title = 't1 and tag rename tabmail v20 build t table amazingphotoeditorv55crackslomalkaorg'

distance = 181
spam score = 6
title = 't1 and tag rename tabmail v20 build t table amazingblocksv14serialcrackslomalkaorg'

distance = 181
spam score = 5
title = 't1 and tag rename tabmail v20 build t table ubrechnungv213crackslomalkaorg'

distance = 181
spam score = 6
title = 't1 and tag rename tabmail v20 build t table alteros3dv21build2101serialcrackslomalkaorg'

distance = 200
spam score = 6
title = 't1 and tag rename tabmail v20 build t table hailstormv30crackslomalkaorg'

distance = 200
spam score = 5
title = 't1 and tag rename tabmail v20 build t table angelfirecombannerpopupkillercrackcrackslomalkaorg'

distance = 200
spam score = 5
title = 't1 and tag rename tabmail v20 build t table b3htmlappsv203146crackslomalkaorg'

distance = 200
spam score = 6
title = 't1 and tag rename tabmail v20 build t table anfyv21crackslomalkaorg'

distance = 200
spam score = 5
title = 't1 and tag rename tabmail v20 build t table pacdoom3halloweenpartyv21crackslomalkaorg'

distance = 200
spam score = 6
title = 't1 and tag rename tabmail v20 build t table abbyyfinereaderprofessionalv7001006crackslomalkaorg'

distance = 200
spam score = 6
title = 't1 and tag rename tabmail v20 build t table abicoderv3613crackslomalkaorg'

distance = 200
spam score = 6
title = 't1 and tag rename tabmail v20 build t table rdiomp3v21byamokcrackslomalkaorg'

distance = 200
spam score = 6
title = 't1 and tag rename tabmail v20 build t table odbcexplorerv21crackslomalkaorg'

distance = 200
spam score = 6
title = 't1 and tag rename tabmail v20 build t table animagicgifanimatorv110ccrackslomalkaorg'

distance = 219
spam score = 5
title = 't1 and tag rename tabmail v20 build t table abcpagerplus507crackslomalkaorg'

distance = 219
spam score = 5
title = 't1 and tag rename tabmail v20 build t table finanzv101nokia7650bythesaintcrackslomalkaorg'

distance = 219
spam score = 6
title = 't1 and tag rename tabmail v20 build t table antitracerv13crackslomalkaorg'

distance = 219
spam score = 6
title = 't1 and tag rename tabmail v20 build t table animpaintshoppro30beta2crackslomalkaorg'

distance = 219
spam score = 6
title = 't1 and tag rename tabmail v20 build t table adobeacrobat40crackslomalkaorg'

distance = 219
spam score = 6
title = 't1 and tag rename tabmail v20 build t table glockeasymailprofessional440build600crackslomalkaorg'

distance = 219
spam score = 5
title = 't1 and tag rename tabmail v20 build t table abroncardgames1v10crackslomalkaorg'

distance = 219
spam score = 6
title = 't1 and tag rename tabmail v20 build t table namowebeditorv404byamokcrackslomalkaorg'

distance = 219
spam score = 5
title = 't1 and tag rename tabmail v20 build t table g6renamer2000v141bytntcrackslomalkaorg'

distance = 219
spam score = 5
title = 't1 and tag rename tabmail v20 build t table abookv222byurgupcrackslomalkaorg'

distance = 239
spam score = 6
title = 't1 and tag rename tabmail v20 build t table qed221palmpilotcrackslomalkaorg'

distance = 239
spam score = 6
title = 't1 and tag rename tabmail v20 build t table halworks22crackslomalkaorg'

distance = 239
spam score = 5
title = 't1 and tag rename tabmail v20 build t table proteusv52litebytolyancrackslomalkaorg'

distance = 239
spam score = 6
title = 't1 and tag rename tabmail v20 build t table abiseruceprov1012crackslomalkaorg'

distance = 239
spam score = 6
title = 't1 and tag rename tabmail v20 build t table atscreenthiefv305crackslomalkaorg'

distance = 239
spam score = 6
title = 't1 and tag rename tabmail v20 build t table arlesimagewebpagecreatorv50newcrackslomalkaorg'

distance = 239
spam score = 6
title = 't1 and tag rename tabmail v20 build t table namodeepsearchv306basicnewcrackslomalkaorg'

distance = 239
spam score = 6
title = 't1 and tag rename tabmail v20 build t table advancedscreencapturev11crackslomalkaorg'

distance = 239
spam score = 5
title = 't1 and tag rename tabmail v20 build t table aware2000v160crackslomalkaorg'

distance = 239
spam score = 5
title = 't1 and tag rename tabmail v20 build t table a2softlogicballsv10bylinezer0crackslomalkaorg'

distance = 259
spam score = 5
title = 't1 and tag rename tabmail v20 build t table powerarchiver2004v90026bysndcrackslomalkaorg'

distance = 259
spam score = 6
title = 't1 and tag rename tabmail v20 build t table glockadvancedadministrativetools400624crackslomalkaorg'

distance = 260
spam score = 6
title = 't1 and tag rename tabmail v20 build t table freshdiagnosev620crackslomalkaorg'

distance = 260
spam score = 5
title = 't1 and tag rename tabmail v20 build t table abcpixv219serialbyevidencecrackslomalkaorg'

distance = 260
spam score = 5
title = 't1 and tag rename tabmail v20 build t table a1dvdaudioripper1139crackslomalkaorg'

distance = 260
spam score = 6
title = 't1 and tag rename tabmail v20 build t table adressermdv20036frenchcrackslomalkaorg'

distance = 260
spam score = 5
title = 't1 and tag rename tabmail v20 build t table powerarchiver2004v90026byfffcrackslomalkaorg'

distance = 260
spam score = 6
title = 't1 and tag rename tabmail v20 build t table abouttime98v20crackslomalkaorg'

distance = 260
spam score = 6
title = 't1 and tag rename tabmail v20 build t table acdfotoangelo20crackslomalkaorg'

distance = 260
spam score = 6
title = 't1 and tag rename tabmail v20 build t table alteros3dv21byrp2kcrackslomalkaorg'

distance = 289
spam score = 7
title = 'w50 winrar v340 beta multilanguage v341 1 v3 tabmailv27build525crackslomalkaorg'

distance = 289
spam score = 6
title = 't1 and tag rename tabmail v20 build t table aurorix2electrofieldv20crackslomalkaorg'

distance = 289
spam score = 6
title = 't1 and tag rename tabmail v20 build t table xnetstatprofessionalv40pr3byamokcrackslomalkaorg'

distance = 289
spam score = 5
title = 't1 and tag rename tabmail v20 build t table anfibiawatchmanv46crackslomalkaorg'

distance = 289
spam score = 6
title = 't1 and tag rename tabmail v20 build t table adronv102crackslomalkaorg'

distance = 289
spam score = 5
title = 't1 and tag rename tabmail v20 build t table appraiserstoolbox10v100152byfhcfcrackslomalkaorg'

distance = 290
spam score = 5
title = 't1 and tag rename tabmail v20 build t table odderadataduck51crackslomalkaorg'

distance = 290
spam score = 5
title = 't1 and tag rename tabmail v20 build t table advancedntsecurityexplorerx0fcrackslomalkaorg'

distance = 290
spam score = 5
title = 't1 and tag rename tabmail v20 build t table alphanotesv10keygenbydbccrackslomalkaorg'

distance = 290
spam score = 5
title = 't1 and tag rename tabmail v20 build t table appletheadlinefactory4crackslomalkaorg'

distance = 347
spam score = 5
title = 't1 and tag rename tabmail v20 build t table qcollectorproforesignalv110build46crackslomalkaorg'

distance = 348
spam score = 5
title = 't1 and tag rename tabmail v20 build t table auroravideovcdsvcddvdconvertercreatorv132crackslomalkaorg'

distance = 348
spam score = 10
title = 'l7 for letter leech chase tutor lemmy recorde tabmailv20build426crackcrackslomalkaorg'

distance = 348
spam score = 23
title = 'h9 help manual and build pro live helix cente tabmailv25812crackslomalkaorg'

distance = 348
spam score = 6
title = 't1 and tag rename tabmail v20 build t table arlesimagewebpagecreatorv494bylashcrackslomalkaorg'

distance = 348
spam score = 8
title = 'c84 crypto 2000 v36 v10 serial keygen crypto tabmailv20build426serialcrackslomalkaorg'

distance = 348
spam score = 15
title = 'o15 mpack ordix v12 pro crawler v10 option o tabmailv20build426serialcrackslomalkaorg'

distance = 348
spam score = 8
title = 'm56 movie movieplay moviejack moving for organ tabmailv13build1120crackslomalkaorg'

distance = 349
spam score = 14
title = 'u2 m70 v40 prepkit ucertify ucertify prepkit tagandrenamev20build2byevidencecrackslomalkaorg'

distance = 349
spam score = 5
title = 't1 and tag rename tabmail v20 build t table acctsyncsdkpocketpceditionv20crackslomalkaorg'

distance = 1327
spam score = 14
title = 'tag and rename v18 tagandrenamev18crackslomalkaorg'

distance = 1333
spam score = 14
title = 'tag and rename v15 beta 1 tagandrenamev15beta1crackslomalkaorg'

distance = 1333
spam score = 13
title = 'tag and rename v20 build 2 by tsrh tagandrenamev20build2bytsrhcrackslomalkaorg'

distance = 1337
spam score = 14
title = 'tag and rename v2174 v30 rc 4 tagandrenamev2174v30rc4crackslomalkaorg'

distance = 1337
spam score = 14
title = 'tag and rename v18 beta 4 tagandrenamev18beta4crackslomalkaorg'

distance = 1337
spam score = 14
title = 'tag and rename v20 final tagandrenamev20finalcrackslomalkaorg'

distance = 1343
spam score = 14
title = 'tag and rename v18 beta 3 tagandrenamev18beta3crackslomalkaorg'

distance = 1355
spam score = 14
title = 'tag and rename v20 xp fixed tagandrenamev20xpfixedcrackslomalkaorg'

distance = 1646
spam score = 0
title = 'serial killer news serial killer history ultimate news database'

distance = 32
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc ecapturerv206crackslomalkaorg'

distance = 35
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc fishv333431crackslomalkaorg'

distance = 49
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc fa18hornetv30crackslomalkaorg'

distance = 66
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc allwebmenusv12keygencrackslomalkaorg'

distance = 67
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc epop203123crackslomalkaorg'

distance = 68
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc halcyon60501crackslomalkaorg'

distance = 69
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc halocrackslomalkaorg'

distance = 69
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc observersuitev90crackslomalkaorg'

distance = 70
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc fcutterv152crackslomalkaorg'

distance = 72
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc achristmasatsantasv29crackslomalkaorg'

distance = 76
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc adayinthelifev151keygencrackslomalkaorg'

distance = 77
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc anagramizerv131crackslomalkaorg'

distance = 77
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activeskinv421crackslomalkaorg'

distance = 78
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc f22raptor1002100rcrackslomalkaorg'

distance = 80
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc animatedscreenv67crackslomalkaorg'

distance = 84
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc aplusfileprotectionv21crackslomalkaorg'

distance = 84
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc windowsxpkeygencrackslomalkaorg'

distance = 88
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc animatedpuzzlescrackslomalkaorg'

distance = 89
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc achristmasatsantasv29byfffcrackslomalkaorg'

distance = 90
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc bpuzzlev50serialcrackslomalkaorg'

distance = 152
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc appexpire15crackslomalkaorg'

distance = 152
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc flashcamv158crackslomalkaorg'

distance = 152
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc agentcyselfextractorv101crackslomalkaorg'

distance = 153
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc emailhunterv120crackslomalkaorg'

distance = 153
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc nortonantivirus2005completecrackslomalkaorg'

distance = 153
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc ppingtools26crackslomalkaorg'

distance = 153
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc arkandroidv124crackslomalkaorg'

distance = 153
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activeskincontrolv43crackslomalkaorg'

distance = 153
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc animateboxv10bylaxitycrackslomalkaorg'

distance = 154
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activewhoisv212591crackslomalkaorg'

distance = 168
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc acousticav310227crackslomalkaorg'

distance = 168
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc albumseev15crackslomalkaorg'

distance = 169
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc animatedbuttonv103crackslomalkaorg'

distance = 169
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc adronv102bypizzacrackslomalkaorg'

distance = 169
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc aaamp3wavconverterv252crackslomalkaorg'

distance = 169
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc fideswallsv2004126bilingualbynitrouscrackslomalkaorg'

distance = 170
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc audiospherev257newcrackslomalkaorg'

distance = 170
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc animatedgifproducerv302crackslomalkaorg'

distance = 170
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc agendamsdv400crackslomalkaorg'

distance = 171
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc forwardmailv280crackslomalkaorg'

distance = 187
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc ageofempires10crackslomalkaorg'

distance = 187
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc apollophoto2vcdv100crackslomalkaorg'

distance = 187
spam score = 7
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activerefreshv135build537crackslomalkaorg'

distance = 187
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc windowsxpallandwindows2003serverallactivatecrackcrackslomalkaorg'

distance = 187
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc pacboyv11cheatscrackslomalkaorg'

distance = 187
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activefaxserverv3610181crackslomalkaorg'

distance = 187
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc atscreenthiefv361byfffcrackslomalkaorg'

distance = 188
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc apersonaltodolistv10crackslomalkaorg'

distance = 188
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc findnprint32bit30crackslomalkaorg'

distance = 188
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc arghiforgotv11crackslomalkaorg'

distance = 202
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc pusoydos10crackslomalkaorg'

distance = 202
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc emailextractorexpressv21byevidencecrackslomalkaorg'

distance = 202
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc freshuiv500crackslomalkaorg'

distance = 203
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc acewinscreenv40crackslomalkaorg'

distance = 203
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc autocapturev15acrackslomalkaorg'

distance = 203
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc acetranslatorv22crackslomalkaorg'

distance = 203
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc advancedtexttospeechattsv300crackslomalkaorg'

distance = 203
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc advancedmp3wmarecorderv375crackslomalkaorg'

distance = 203
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc oceanwavesscreensaverv13crackslomalkaorg'

distance = 204
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc hamhelperv131crackslomalkaorg'

distance = 217
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc allwebmenusv13build352crackslomalkaorg'

distance = 217
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc accessanimationv115crackslomalkaorg'

distance = 217
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc forumproxyleecherv107712crackslomalkaorg'

distance = 217
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc ntrackstudiov202214pluginscrackslomalkaorg'

distance = 217
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc windows2003xpkeygencrackslomalkaorg'

distance = 218
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activefaxserverv388build195germancrackslomalkaorg'

distance = 218
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc ebusinesssolutionsv5006crackslomalkaorg'

distance = 218
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc windowsxpservicepack2activatorcrackslomalkaorg'

distance = 218
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc absolutistmahjongv10forpocketpccrackslomalkaorg'

distance = 218
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc faxamaticvv97101bynitrouscrackslomalkaorg'

distance = 231
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc arobfantasticmp3networkedencoder14crackslomalkaorg'

distance = 231
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc advancedmp3wmarecorderv378byucfcrackslomalkaorg'

distance = 232
spam score = 4
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc foodservicesreportingsystemv141crackslomalkaorg'

distance = 232
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activexmanagerv13byserials2000crackslomalkaorg'

distance = 232
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc galaxyrebellionv141germanallaccesscheatcrackslomalkaorg'

distance = 233
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc editorial2v201crackslomalkaorg'

distance = 233
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activeskincontrolocxv22bylogic90crackslomalkaorg'

distance = 233
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc arcpad501crackslomalkaorg'

distance = 234
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc flamingpearflexifyv19foradobephotoshopcrackslomalkaorg'

distance = 234
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc alfapadnotesorganizerv22crackslomalkaorg'

distance = 257
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc fileandfolderprivacyv26crackslomalkaorg'

distance = 257
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc oddinfaust2000v55crackslomalkaorg'

distance = 257
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc emailfactoryv12bytsrhcrackslomalkaorg'

distance = 258
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc protectxprofessionaleditionv415crackslomalkaorg'

distance = 258
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc acehighmp3recorderv15crackslomalkaorg'

distance = 258
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc editorebookcompilerv25crackslomalkaorg'

distance = 258
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc a1clickultrapccleanerv10132crackslomalkaorg'

distance = 258
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc privateidahoemail4520crackslomalkaorg'

distance = 258
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc halflife2episodeoneplus9trainercrackslomalkaorg'

distance = 258
spam score = 6
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc animagicgifanimatorv122apatchcrackslomalkaorg'

distance = 283
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc emailextractorexpressv20byevccrackslomalkaorg'

distance = 284
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc advancedrarpasswordrecoveryv120bycimcrackslomalkaorg'

distance = 284
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc efunsoftmastermind10bytntcrackslomalkaorg'

distance = 284
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc aheadneroburningromultraeditionv6300crackslomalkaorg'

distance = 285
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc acedvdbackupv1xgenericcrackslomalkaorg'

distance = 286
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activeskincontrolocxv40crackslomalkaorg'

distance = 286
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc friedrichlochnerstatikdatecode11152004germancrackslomalkaorg'

distance = 287
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc activestateperldevkitv520520crackslomalkaorg'

distance = 287
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc acousticamp3towaveconvertorplusv203bytntcrackslomalkaorg'

distance = 288
spam score = 5
title = 'p24 pcboost pcmedik build pcdj tsrh fx v25 pc postersoftposterv79hcrackslomalkaorg'

distance = 1351
spam score = 18
title = 'ascii art studio v201 by tsrh asciiartstudiov201bytsrhcrackslomalkaorg'

distance = 1359
spam score = 18
title = 'artstudio v251 by tsrh artstudiov251bytsrhcrackslomalkaorg'

distance = 1359
spam score = 15
title = 'pacbomber v154 crack by tsrh pacbomberv154crackbytsrhcrackslomalkaorg'

distance = 1374
spam score = 16
title = 'advanced system optimizer v102 build 981 by tsrh advancedsystemoptimizerv102build981bytsrhcrackslomalkaorg'

distance = 1391
spam score = 15
title = 'pacdoom 3 halloween party v21 by tsrh pacdoom3halloweenpartyv21bytsrhcrackslomalkaorg'

distance = 1397
spam score = 15
title = 'pacbomber v154 loader by tsrh pacbomberv154loaderbytsrhcrackslomalkaorg'

distance = 18
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile ecampaignv2961crackslomalkaorg'

distance = 38
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile packit14crackslomalkaorg'

distance = 55
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile ebook12crackslomalkaorg'

distance = 57
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile qacp16crackslomalkaorg'

distance = 62
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile airmessengerprov385crackslomalkaorg'

distance = 65
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile aimatfilev10crackslomalkaorg'

distance = 68
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile eiconsv334crackslomalkaorg'

distance = 72
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile accalcv3145crackslomalkaorg'

distance = 79
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile animatedbuttonv103crackslomalkaorg'

distance = 80
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile f22raptor1002100rcrackslomalkaorg'

distance = 81
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile focusparrotsprov572ecrackslomalkaorg'

distance = 81
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile halcyon60501crackslomalkaorg'

distance = 85
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile activefaxv385build0192crackslomalkaorg'

distance = 86
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile oodefragv6professional60710keygencrackslomalkaorg'

distance = 87
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile ebiurov1000crackslomalkaorg'

distance = 89
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile atomtime98v22crackslomalkaorg'

distance = 92
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile antechinusanimatorprofessionalv50crackslomalkaorg'

distance = 94
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile kmp3v50025rc2crackslomalkaorg'

distance = 94
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile oasisprov1310crackslomalkaorg'

distance = 96
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile filesearchforlanv11crackslomalkaorg'

distance = 152
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile pacdoom3halloweenparty21crackslomalkaorg'

distance = 153
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile autotextv117crackslomalkaorg'

distance = 153
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile activeskinv421crackslomalkaorg'

distance = 154
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile absolutememoryv14keygencrackslomalkaorg'

distance = 154
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile autoptionv211crackslomalkaorg'

distance = 154
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile halocrackslomalkaorg'

distance = 154
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile filescannerprov13crackslomalkaorg'

distance = 154
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile appmakerv331crackslomalkaorg'

distance = 155
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile acousticav30crackslomalkaorg'

distance = 155
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile advancedmp3wmarecorderv376crackslomalkaorg'

distance = 174
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile arealvalidatorv111byucfcrackslomalkaorg'

distance = 174
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile ppingtoolsv25crackslomalkaorg'

distance = 175
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile p2cpluspascal12407ecrackslomalkaorg'

distance = 175
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile ascv30crackslomalkaorg'

distance = 175
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile efunsoftmastermind10bytntcrackslomalkaorg'

distance = 176
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile hackmanv501crackslomalkaorg'

distance = 176
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile finalwayv131build20011010crackslomalkaorg'

distance = 176
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile advancedaircraftanalysis22acrackslomalkaorg'

distance = 176
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile kasperskyantiviruspersonalprocrackslomalkaorg'

distance = 176
spam score = 7
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile arobfantasticmp3encoderv13byciacrackslomalkaorg'

distance = 190
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile pcad2001trial3fixedcrackslomalkaorg'

distance = 190
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile fishguidecrackslomalkaorg'

distance = 190
spam score = 5
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile ebusinessappletv40crackslomalkaorg'

distance = 190
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile addressgrabberv23crackslomalkaorg'

distance = 191
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile arealvalidatorv111serialbyfhcfcrackslomalkaorg'

distance = 191
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile achristmasatsantasv29crackslomalkaorg'

distance = 191
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile autumnleavesv1008crackslomalkaorg'

distance = 192
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile atrexv80crackslomalkaorg'

distance = 192
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile ashampoomovieshrinkandburnv20bycimcrackslomalkaorg'

distance = 192
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile fathsendmailcontrolforwin32v15crackslomalkaorg'

distance = 207
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile amusicalgeneratorv20crackslomalkaorg'

distance = 207
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile activefile227crackslomalkaorg'

distance = 208
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile fineprintenterprisev522crackslomalkaorg'

distance = 208
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile arealvalidatorv111serialbyamokcrackslomalkaorg'

distance = 208
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile antechinusphpeditorv11byrp2kcrackslomalkaorg'

distance = 208
spam score = 5
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile halloweenslotscrackslomalkaorg'

distance = 208
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile amabilis3dcanvasprov60byepscrackslomalkaorg'

distance = 209
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile pushftpv2011bytccrackslomalkaorg'

distance = 209
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile fircv11crackslomalkaorg'

distance = 210
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile p2cpluspascalcompilerv2006ecrackslomalkaorg'

distance = 220
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile pacboyv11cheatscrackslomalkaorg'

distance = 220
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile firehandemberprov3123crackslomalkaorg'

distance = 220
spam score = 7
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile authorware5crackslomalkaorg'

distance = 221
spam score = 7
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile alphaballv13trainerbyfffcrackslomalkaorg'

distance = 222
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile pacdoomv121bytntcrackslomalkaorg'

distance = 222
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile filespy100bycorecrackslomalkaorg'

distance = 222
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile av4custombackupandrestorev102crackslomalkaorg'

distance = 222
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile filesynchronizerv111crackslomalkaorg'

distance = 224
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile fileprotectorv101crackslomalkaorg'

distance = 224
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile fprotantivirusforwindowsv307crackslomalkaorg'

distance = 239
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile kasperskyantiviruspersonalv50227keygenfilecrackslomalkaorg'

distance = 239
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile abcmonitor170crackslomalkaorg'

distance = 239
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile aurorampegtodvdburnerv332byfficrackslomalkaorg'

distance = 240
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile fireburnerv20beta1crackslomalkaorg'

distance = 240
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile powerarchiver2003v85015crackslomalkaorg'

distance = 240
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile activestateperldevkitv20crackslomalkaorg'

distance = 241
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile allairehomesitev401evaluationcrackslomalkaorg'

distance = 241
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile adobeacrobatv70professionalkeygenbyparodoxcrackslomalkaorg'

distance = 241
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile emailalertv10110bystreamcrackslomalkaorg'

distance = 241
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile activexmanagerv14crackslomalkaorg'

distance = 261
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile abcpdfnetv5008crackslomalkaorg'

distance = 262
spam score = 7
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile avizthoughtmapperv11forwin2kxpcrackslomalkaorg'

distance = 262
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile privacyfencev30crackslomalkaorg'

distance = 262
spam score = 7
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile asposepdfv19crackslomalkaorg'

distance = 262
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile ucalcfastmathparserprofessional20crackslomalkaorg'

distance = 262
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile ashampoomailvirusblockerv102secrackslomalkaorg'

distance = 262
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile activestateperldevkitv520520crackslomalkaorg'

distance = 262
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile windowsxpallandwindows2003serverallactivatecrackcrackslomalkaorg'

distance = 262
spam score = 7
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile actualtestscomibm000199examcheatsheetv101503crackslomalkaorg'

distance = 263
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile antechinuscsharpeditorv42bytsrhcrackslomalkaorg'

distance = 293
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile algolabphotovectorv14byevidencecrackslomalkaorg'

distance = 293
spam score = 5
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile uleadvideostudiov900100englishtbybtofullcrackbybidjancrackslomalkaorg'

distance = 293
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile activeskincontrolocxv40crackslomalkaorg'

distance = 293
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile activeskincontrolocxv352crackslomalkaorg'

distance = 294
spam score = 7
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile actualtestscomhphp0680examcheatsheetv101304crackslomalkaorg'

distance = 295
spam score = 7
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile aardvarkprohtmleditorv301crackslomalkaorg'

distance = 295
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile vacationrentaltrackerplusv123crackslomalkaorg'

distance = 296
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile acehightexttospeechreader160crackslomalkaorg'

distance = 296
spam score = 5
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile puzzlechampionv1030215bytmgcrackslomalkaorg'

distance = 297
spam score = 6
title = 'p85 ps filerenamer pss fhcf 10 pswincom maile antechinuscsharpeditorcrackslomalkaorg'

distance = 1404
spam score = 15
title = 'apollo versatile burner v1225 by fhcf apolloversatileburnerv1225byfhcfcrackslomalkaorg'

distance = 1814
spam score = 1
title = 'kung fu panda cinemenium'

distance = 1897
spam score = 3
title = 'final fantasy online italia tutto sui final fantasy'

distance = 3
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack r2v507gcrackslomalkaorg'

distance = 22
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack ebookv1001crackslomalkaorg'

distance = 60
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack g6renamer2000v14keygencrackslomalkaorg'

distance = 62
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack faxamaticva93511crackslomalkaorg'

distance = 67
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack allkasperskyproductscrackslomalkaorg'

distance = 74
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack galacticcivilizationcrackslomalkaorg'

distance = 78
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack atafv511crackslomalkaorg'

distance = 81
spam score = 11
title = 'j9 jumpover v10 jss windows jump master hack abilityoffice2000v21001crackslomalkaorg'

distance = 82
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack hackerv11crackslomalkaorg'

distance = 82
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack fsecureantivirusv531crackslomalkaorg'

distance = 83
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack halov100564crackslomalkaorg'

distance = 85
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack anfxv5234crackslomalkaorg'

distance = 85
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack ecampaignv297crackslomalkaorg'

distance = 85
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack g6utilitiesv170crackslomalkaorg'

distance = 86
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack accessadministratorprov34crackslomalkaorg'

distance = 87
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack formularyv121crackslomalkaorg'

distance = 88
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack ascv30crackslomalkaorg'

distance = 90
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack auctionchiefv215crackslomalkaorg'

distance = 91
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack alldayv66crackslomalkaorg'

distance = 91
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack alteros3dv101crackbyevidencecrackslomalkaorg'

distance = 152
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack axefangv118crackslomalkaorg'

distance = 153
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack flightmanagerv12crackslomalkaorg'

distance = 153
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack p2cpascalcompiler1236ecrackslomalkaorg'

distance = 153
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack atlasv117crackslomalkaorg'

distance = 154
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack uanimatorv101newcrackslomalkaorg'

distance = 154
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack ecodermaildecoderv200003crackslomalkaorg'

distance = 154
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack awiconsv470crackslomalkaorg'

distance = 154
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack albumplayerv212crackslomalkaorg'

distance = 154
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack acedesignprocrackslomalkaorg'

distance = 155
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack amusicalgeneratorv20crackslomalkaorg'

distance = 175
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack tableditv233acrackslomalkaorg'

distance = 175
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack halloweenhauntsv12crackslomalkaorg'

distance = 175
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack hackmanhexeditorv705crackslomalkaorg'

distance = 176
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack asplightningv111crackslomalkaorg'

distance = 176
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack namowebeditorv55crackslomalkaorg'

distance = 176
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack access2mysqlprov21crackslomalkaorg'

distance = 176
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack aisbackupv183192crackslomalkaorg'

distance = 176
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack fprotantivirusv312bcrackslomalkaorg'

distance = 176
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack fireburnerv20beta2crackslomalkaorg'

distance = 176
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack advancedmp3wmarecorderv32newcrackslomalkaorg'

distance = 192
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack filetimeedit2v206bydigeraticrackslomalkaorg'

distance = 192
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack pinnaclestudioplusv93multilanguagecrackslomalkaorg'

distance = 192
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack activeskincontrolocxv42crackslomalkaorg'

distance = 192
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack filecompareromeo101crackslomalkaorg'

distance = 192
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack octopusvs411dcrackslomalkaorg'

distance = 193
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack aelitavirtuosityv3xcrackslomalkaorg'

distance = 193
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack adressen2000101138germancrackslomalkaorg'

distance = 194
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack abpfiffv802germancrackslomalkaorg'

distance = 194
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack pshieldwatcherv15crackslomalkaorg'

distance = 194
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack autoplaymediastudiov5005professionalpart2crackslomalkaorg'

distance = 210
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack fireplacev10crackslomalkaorg'

distance = 210
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack appsprotectorxpcrackslomalkaorg'

distance = 210
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack pacsoftwarenetworkconsolev30crackslomalkaorg'

distance = 210
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack abcpixv216serialcrackslomalkaorg'

distance = 210
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack avimpegasfwmvsplitterv231crackslomalkaorg'

distance = 210
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack acbrowserplusv2350crackslomalkaorg'

distance = 211
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack facefilterv105181studioeditioncrackslomalkaorg'

distance = 211
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack advancedmp3wmarecorderv3xxcrackslomalkaorg'

distance = 211
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack ventafaxv50crackslomalkaorg'

distance = 211
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack all4audiomp3makerv110crackslomalkaorg'

distance = 227
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack fatecengineeringfmatv10137crackslomalkaorg'

distance = 228
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack appshelfv11crackslomalkaorg'

distance = 228
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack forumswebserverv1600817crackslomalkaorg'

distance = 228
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack windows2003andwindowsxpsp2antiproductactivationcrackv12crackslomalkaorg'

distance = 228
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack airmessengerlanserverv16crackslomalkaorg'

distance = 228
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack vamp3playerv2xgermancrackslomalkaorg'

distance = 228
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack fontshowv31byjhtcrackslomalkaorg'

distance = 229
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack pmanv10bandwjavacrackslomalkaorg'

distance = 229
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack findandreplace10crackslomalkaorg'

distance = 229
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack fprotantivirusforwindowsv307crackslomalkaorg'

distance = 243
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack anawavegravityv20crackslomalkaorg'

distance = 243
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack activexmanagerv13bycokecrackslomalkaorg'

distance = 244
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack airnavv31loaderbyevccrackslomalkaorg'

distance = 244
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack formpilotprov126crackslomalkaorg'

distance = 244
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack acqurlv52bylinezer0crackslomalkaorg'

distance = 245
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack namenormprofiv490germancrackslomalkaorg'

distance = 245
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack flipalbumprofessionalv55build550173crackslomalkaorg'

distance = 245
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack spywaredoctorv310312serialbyart3amcrackslomalkaorg'

distance = 245
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack fsecureantivirusforwindowsv540crackslomalkaorg'

distance = 246
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack emailsv175crackslomalkaorg'

distance = 261
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack absolutesecurityprov39serialbyantiher0crackslomalkaorg'

distance = 261
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack kasperskyantiviruspersonalcrackslomalkaorg'

distance = 261
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack ashampoowinoptimizerplatinumsuitev113bynhgcrackslomalkaorg'

distance = 262
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack allwebmenusv13build354byaaocgcrackslomalkaorg'

distance = 262
spam score = 11
title = 'j9 jumpover v10 jss windows jump master hack antennawebdesignstudiov2078crackslomalkaorg'

distance = 262
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack advancedapplicationcontrolsappcontrolsv232crackslomalkaorg'

distance = 262
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack rwipeandcleanv30901crackslomalkaorg'

distance = 262
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack hackersmackerv11crackslomalkaorg'

distance = 263
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack addressfinderv961byfallencrackslomalkaorg'

distance = 263
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack pacdoomiiihalloweenpartyv30crackslomalkaorg'

distance = 292
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack gaeawinsievev112crackslomalkaorg'

distance = 293
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack findstring460crackslomalkaorg'

distance = 293
spam score = 11
title = 'j9 jumpover v10 jss windows jump master hack emailmanv311build0302crackslomalkaorg'

distance = 293
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack namedropperv23crackslomalkaorg'

distance = 294
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack assettrackerfornetworksv304crackslomalkaorg'

distance = 294
spam score = 9
title = 'j9 jumpover v10 jss windows jump master hack pacdoomiiihalloweenpartyv30plus7trainercrackslomalkaorg'

distance = 294
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack xballv25crackslomalkaorg'

distance = 294
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack aplusexameprepv40crackslomalkaorg'

distance = 296
spam score = 10
title = 'j9 jumpover v10 jss windows jump master hack advancedmp3wmarecorderv375crackslomalkaorg'

distance = 297
spam score = 11
title = 'j9 jumpover v10 jss windows jump master hack adobeillustratorcsv110tryoutmultilanguagebyfffcrackslomalkaorg'

distance = 1374
spam score = 15
title = 'fprot antivirus for windows v308 fprotantivirusforwindowsv308crackslomalkaorg'

distance = 1375
spam score = 15
title = 'fprot antivirus for windows v312 fprotantivirusforwindowsv312crackslomalkaorg'

distance = 1383
spam score = 16
title = 'fprot antivirus for windows v311b fprotantivirusforwindowsv311bcrackslomalkaorg'

distance = 1404
spam score = 15
title = 'abbyy finereader 5 pro try and buy windows xp abbyyfinereader5protryandbuywindowsxpcrackslomalkaorg'

distance = 1900
spam score = 23
title = 'open babel class members'

distance = 45
spam score = 7
title = 'f50 full fulldisk ftpwolf video control ftp mo hackmanv601crackslomalkaorg'

distance = 48
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo qbzv17gcrackslomalkaorg'

distance = 52
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo fprotv312acrackslomalkaorg'

distance = 62
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo filtergatev408crackslomalkaorg'

distance = 63
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo fulldiskv45crackslomalkaorg'

distance = 64
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo qfolder95v31crackslomalkaorg'

distance = 79
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo hackerv11crackslomalkaorg'

distance = 84
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo p7avantgardecrackslomalkaorg'

distance = 85
spam score = 7
title = 'f50 full fulldisk ftpwolf video control ftp mo autoprintv23312crackslomalkaorg'

distance = 85
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo filepeekv23crackslomalkaorg'

distance = 88
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo powerarchiver860crackslomalkaorg'

distance = 89
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo keygenslomalkaorg'

distance = 89
spam score = 7
title = 'f50 full fulldisk ftpwolf video control ftp mo ebusinesssolutionsv5006crackslomalkaorg'

distance = 91
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo amusicalgeneratorv200288crackslomalkaorg'

distance = 91
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo albumplayerv212crackslomalkaorg'

distance = 98
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo ecampaignv297crackslomalkaorg'

distance = 98
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo akeywordthingv10101serialcrackslomalkaorg'

distance = 100
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo aimatfilev10crackslomalkaorg'

distance = 100
spam score = 6
title = 'f50 full fulldisk ftpwolf video control ftp mo qfolder95v31crackslomalkaorg'

distance = 101